Citrus Sinensis ID: 008808


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550---
MSTESEPPKVQEEVDSSSQSISKKAAKKEAAKKAKEERRKEAEAAASAASALSIEEEGPLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRPVGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKGATQQVEVQIKKLYCVSRAAKTPITIEDASRSEAEIEKASKEGVQLPRVNQDTRLNNRVIDIRTLANQGIFRIQSQVGNIFRQFLLSENFVEIHTPKLIAGSSEGGSAVFRLDYKGQSACLAQSPQLHKQMSICGDFGRVFETGPVFRAEDSYTHRHLCEFTGLDVEMEIKKHYSEVMDIVDRLFVTIFDGLNNVCKKELEAVAKQYPFEPLKYKPKTLRLTFEEGVQMLKDAGVEIDPLGDLNTESERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNSLYSNSFDVFIRGEEIISGAQRIHIPEFLAERAQACGIDVKTISTYIDSFRYGAPPHGGFGVGLERVVMLFCGLNNIRKTSLYPRDPLRIAP
ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEccccccccccEEEEEEEEEEcccccccEEEEEEEccccEEEEEEEcccccccHHHHHHHcccccccEEEEEEEEEccccccccccccEEEEEEEEEEEEcccccccccccccccHHHHHHHHHcccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHcccEEECcccEEcccccccccccccccccccEEEccccHHHHHHHcccccccEEEEcccccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccEEEEEEEEccccEEEEcccccccHHHHHHHHHHcccccccHHHHHHcccccccccccccccHHHHHHHHHcccccccccccccccccccc
***************************************************************YGDVPLQ************WSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRPVGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKGATQQVEVQIKKLYCVSRAAKTPITIEDASRSEAEIE***KEGVQLPRVNQDTRLNNRVIDIRTLANQGIFRIQSQVGNIFRQFLLSENFVEIHTPKLIAGSSEGGSAVFRLDYKGQSACLAQSPQLHKQMSICGDFGRVFETGPVFRAEDSYTHRHLCEFTGLDVEMEIKKHYSEVMDIVDRLFVTIFDGLNNVCKKELEAVAKQYPFEPLKYKPKTLRLTFEEGVQMLKDAGVEIDPLGDLNTESERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNSLYSNSFDVFIRGEEIISGAQRIHIPEFLAERAQACGIDVKTISTYIDSFRYGAPPHGGFGVGLERVVMLFCGLNNIRKTSLYPRDPLRI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTESEPPKVQEEVDSSSQSISxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSIEEEGPLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRPVGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKGATQQVEVQIKKLYCVSRAAKTPITIEDASRSEAEIEKASKEGVQLPRVNQDTRLNNRVIDIRTLANQGIFRIQSQVGNIFRQFLLSENFVEIHTPKLIAGSSEGGSAVFRLDYKGQSACLAQSPQLHKQMSICGDFGRVFETGPVFRAEDSYTHRHLCEFTGLDVEMEIKKHYSEVMDIVDRLFVTIFDGLNNVCKKELEAVAKQYPFEPLKYKPKTLRLTFEEGVQMLKDAGVEIDPLGDLNTESERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNSLYSNSFDVFIRGEEIISGAQRIHIPEFLAERAQACGIDVKTISTYIDSFRYGAPPHGGFGVGLERVVMLFCGLNNIRKTSLYPRDPLRIAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aspartate--tRNA ligase, cytoplasmic Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.probableP15178
Aspartate--tRNA ligase, cytoplasmic Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.probableQ5R9I5
Aspartate--tRNA ligase, cytoplasmic Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.probableQ922B2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.12Aspartate--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1C0A, chain A
Confidence level:very confident
Coverage over the Query: 93-205,225-552
View the alignment between query and template
View the model in PyMOL
Template: 3I7F, chain A
Confidence level:very confident
Coverage over the Query: 53-74,87-276,296-553
View the alignment between query and template
View the model in PyMOL