Citrus Sinensis ID: 008872
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 550 | 2.2.26 [Sep-21-2011] | |||||||
| Q9SXB8 | 842 | G-type lectin S-receptor- | yes | no | 0.932 | 0.609 | 0.458 | 1e-131 | |
| Q9SXB4 | 820 | G-type lectin S-receptor- | no | no | 0.96 | 0.643 | 0.438 | 1e-127 | |
| Q9SXB5 | 820 | G-type lectin S-receptor- | no | no | 0.967 | 0.648 | 0.429 | 1e-121 | |
| Q9LPZ9 | 830 | G-type lectin S-receptor- | no | no | 0.914 | 0.606 | 0.408 | 1e-111 | |
| O81906 | 849 | G-type lectin S-receptor- | no | no | 0.941 | 0.610 | 0.379 | 1e-103 | |
| O64784 | 821 | G-type lectin S-receptor- | no | no | 0.952 | 0.638 | 0.375 | 1e-100 | |
| Q9SY89 | 842 | Putative G-type lectin S- | no | no | 0.943 | 0.616 | 0.382 | 2e-99 | |
| Q9SYA0 | 804 | G-type lectin S-receptor- | no | no | 0.950 | 0.650 | 0.386 | 4e-98 | |
| O64783 | 814 | G-type lectin S-receptor- | no | no | 0.96 | 0.648 | 0.367 | 8e-98 | |
| O64781 | 831 | G-type lectin S-receptor- | no | no | 0.952 | 0.630 | 0.359 | 2e-96 |
| >sp|Q9SXB8|Y1133_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 OS=Arabidopsis thaliana GN=At1g11330 PE=1 SV=3 | Back alignment and function desciption |
|---|
Score = 468 bits (1204), Expect = e-131, Method: Compositional matrix adjust.
Identities = 251/548 (45%), Positives = 346/548 (63%), Gaps = 35/548 (6%)
Query: 25 DTITSSQFIRDPES--IISSGSKFKLGFFSPDGNFTN-RYIGIWYNKGGSANKTVVWVAN 81
D IT S I+D ES ++ F+ GFF+P + T RY+GIWY K +TVVWVAN
Sbjct: 31 DRITFSSPIKDSESETLLCKSGIFRFGFFTPVNSTTRLRYVGIWYEK--IPIQTVVWVAN 88
Query: 82 RNKPLIDSSGIFTISEDGNLVVLNGKKQVHWSSNVSSLANNSNTRAQLLDSGNLVLHDNI 141
++ P+ D+SG+ +I +DGNL V +G+ ++ WS+NVS + T QL+DSGNL+L DN
Sbjct: 89 KDSPINDTSGVISIYQDGNLAVTDGRNRLVWSTNVSVPVAPNATWVQLMDSGNLMLQDNR 148
Query: 142 SQVSI-WDSFQEPTDTFYSEMKVSTDLRTGKKVQLTSWRSLSNPSIGSFSAGLDSFTIPE 200
+ I W+SF+ P D+F M + TD RTG ++LTSW S +PS G+++AG+ FT PE
Sbjct: 149 NNGEILWESFKHPYDSFMPRMTLGTDGRTGGNLKLTSWTSHDDPSTGNYTAGIAPFTFPE 208
Query: 201 VFIWINGTRPYWRSGPWNGRYFIGIPDMNSV-YLDGFNLGEDHQKGTRYLTFAFADNDVF 259
+ IW N P WRSGPWNG+ FIG+P+M+S+ +LDGFNL D+Q GT +++A ND F
Sbjct: 209 LLIWKNNV-PTWRSGPWNGQVFIGLPNMDSLLFLDGFNLNSDNQ-GTISMSYA---NDSF 263
Query: 260 ---FALTPQGNLEERAWVDGKAHLKIYFFYPTNDCDVYGKCGAFGSCNSQKIPICSCLLG 316
F L P+G + ++ W +I +P DCD YG+CG FGSC++ + P C C+ G
Sbjct: 264 MYHFNLDPEGIIYQKDWSTSMRTWRIGVKFPYTDCDAYGRCGRFGSCHAGENPPCKCVKG 323
Query: 317 FEPKNAEDWNRGNWSGGEVE------------------GKQDGFFKLETMKVPYFAERSS 358
F PKN +WN GNWS G + GK DGF KL+ MKVP AERS
Sbjct: 324 FVPKNNTEWNGGNWSNGCMRKAPLQCERQRNVSNGGGGGKADGFLKLQKMKVPISAERSE 383
Query: 359 ANEDKCKDQCSNNCSCKAYAYEIGVGCMIWTHNLIDIRKLPSGGTNLYIRVAHEELDRKD 418
A+E C C +NCSC AYAY+ G+GCM+W+ +L+D++ G +L+IRVAH EL
Sbjct: 384 ASEQVCPKVCLDNCSCTAYAYDRGIGCMLWSGDLVDMQSFLGSGIDLFIRVAHSELKTHS 443
Query: 419 MKLVIILSVIVGIIAI-AICTFFAWRWFAKRKA-MKENSKVQRLDLGEAYANFSTEKVNP 476
V+I + ++G++ I A+C A R + KR A K+ S EA + + N
Sbjct: 444 NLAVMIAAPVIGVMLIAAVCVLLACRKYKKRPAPAKDRSAELMFKRMEALTSDNESASNQ 503
Query: 477 ARLQDLLVFNFEELANATNNFQLANKLGQGGFGPVYKGKLQDGQEIAVKRLSKASGQGQE 536
+L++L +F F+ LA +T++F L NKLGQGGFGPVYKGKL +GQEIAVKRLS+ SGQG E
Sbjct: 504 IKLKELPLFEFQVLATSTDSFSLRNKLGQGGFGPVYKGKLPEGQEIAVKRLSRKSGQGLE 563
Query: 537 EFMNEVMI 544
E MNEV++
Sbjct: 564 ELMNEVVV 571
|
Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1 |
| >sp|Q9SXB4|Y1130_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11300 OS=Arabidopsis thaliana GN=At1g11300 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SXB5|Y1135_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11305 OS=Arabidopsis thaliana GN=At1g11305 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LPZ9|SD113_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-13 OS=Arabidopsis thaliana GN=SD113 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O81906|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B120 OS=Arabidopsis thaliana GN=B120 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O64784|Y1136_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61360 OS=Arabidopsis thaliana GN=At1g61360 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SY89|Y1661_ARATH Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610 OS=Arabidopsis thaliana GN=At1g61610 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SYA0|Y1150_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61500 OS=Arabidopsis thaliana GN=At1g61500 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O64783|Y1137_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61370 OS=Arabidopsis thaliana GN=At1g61370 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|O64781|Y1639_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61390 OS=Arabidopsis thaliana GN=At1g61390 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 550 | ||||||
| 359496521 | 844 | PREDICTED: G-type lectin S-receptor-like | 0.961 | 0.626 | 0.532 | 1e-166 | |
| 224114125 | 832 | predicted protein [Populus trichocarpa] | 0.969 | 0.640 | 0.543 | 1e-162 | |
| 224104212 | 1217 | predicted protein [Populus trichocarpa] | 0.969 | 0.437 | 0.543 | 1e-162 | |
| 224114141 | 824 | predicted protein [Populus trichocarpa] | 0.976 | 0.651 | 0.517 | 1e-158 | |
| 224112032 | 824 | predicted protein [Populus trichocarpa] | 0.967 | 0.645 | 0.521 | 1e-158 | |
| 224114137 | 827 | predicted protein [Populus trichocarpa] | 0.965 | 0.642 | 0.529 | 1e-158 | |
| 359497887 | 565 | PREDICTED: G-type lectin S-receptor-like | 0.912 | 0.888 | 0.535 | 1e-156 | |
| 147774142 | 823 | hypothetical protein VITISV_024545 [Viti | 0.963 | 0.643 | 0.525 | 1e-154 | |
| 224078778 | 831 | predicted protein [Populus trichocarpa] | 0.969 | 0.641 | 0.507 | 1e-154 | |
| 296084622 | 817 | unnamed protein product [Vitis vinifera] | 0.947 | 0.637 | 0.527 | 1e-153 |
| >gi|359496521|ref|XP_002262970.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 590 bits (1520), Expect = e-166, Method: Compositional matrix adjust.
Identities = 301/565 (53%), Positives = 408/565 (72%), Gaps = 36/565 (6%)
Query: 4 VAIVVLLSSCFYSDFGTATATDTITSSQFIRDPESIISSGSKFKLGFFSPDGNFTNRYIG 63
+A+++LLS FG TA DT+TS++FI DPE+++S+GS FKLGFFS + TNRY+G
Sbjct: 10 IALLLLLSVIC---FGFCTAIDTMTSTRFIEDPETLVSNGSAFKLGFFSL-ADSTNRYVG 65
Query: 64 IWYNKGGSANKTVVWVANRNKPLIDSSGIFTISEDGNLVVLNGKKQVHWSSNVSSLANNS 123
IWY+ + TV+WVANR+KPL DSSGI TISEDGNL+V+NG+K++ WSSNVS+ + NS
Sbjct: 66 IWYST--PSLSTVIWVANRDKPLNDSSGIVTISEDGNLLVMNGQKEIVWSSNVSNASANS 123
Query: 124 NTRAQLLDSGNLVLHDNISQVSIWDSFQEPTDTFYSEMKVSTDLRTGKKVQLTSWRSLSN 183
+ AQLLDSGNLVL DN ++ W+S Q P+ + MK+STD TG+KV LTSW+S S+
Sbjct: 124 S--AQLLDSGNLVLQDNSGSIT-WESIQHPSHSLLPNMKISTDTNTGEKVVLTSWKSPSD 180
Query: 184 PSIGSFSAGLDSFTIPEVFIWINGTRPYWRSGPWNGRYFIGIPDMNSVYLDGFNLGEDHQ 243
PSIGSFS G++ IP++FIW NG+ PYWRSGPW+ + FIGIPDM+SVY GF + +D +
Sbjct: 181 PSIGSFSLGMNPLNIPQIFIW-NGSHPYWRSGPWSSQIFIGIPDMDSVYRSGFQVVDD-K 238
Query: 244 KGTRYLTFAFADNDVF--FALTPQGNLEERAWVDGKAHLKIYFFYPTNDCDVYGKCGAFG 301
+GT Y TF A++ +F + LT QG+L + GK + + ++CDVYG CGAFG
Sbjct: 239 EGTVYATFTEANSSIFLYYVLTSQGSLVQTDREYGKEEWGVTWRSNKSECDVYGTCGAFG 298
Query: 302 SCNSQKIPICSCLLGFEPKNAEDWNRGNWSGGEV---------------EGKQDGFFKLE 346
CNS PICSCL G+EPK E+W+RGNW+ G V +GK DGFF+L
Sbjct: 299 ICNSGTSPICSCLRGYEPKYTEEWSRGNWTSGCVRKTTLQCERTNSSGQQGKIDGFFRLT 358
Query: 347 TMKVPYFAERSSANEDKCKDQCSNNCSCKAYAYEIGVGCMIWTHNLIDIRKLPSGGTNLY 406
T+KVP +A+ S A+ED+C+++C NCSC AY+Y G+GCM+W+ +LID++K G +LY
Sbjct: 359 TVKVPDYADWSLAHEDECREECLKNCSCIAYSYYSGIGCMLWSGSLIDLQKFTKRGADLY 418
Query: 407 IRVAHEEL--DRKDMKLVIILSVIVGIIAIAICTFFAWRWFAKRKAMKENSK-VQRLDLG 463
IR+AH EL +++DMK++I +++++G IAIAICT+F WRW R+A+KE SK + D G
Sbjct: 419 IRLAHSELGKNKRDMKVIISVTIVIGTIAIAICTYFLWRWIG-RQAVKEKSKEILPSDRG 477
Query: 464 EAYANFST----EKVNPARLQDLLVFNFEELANATNNFQLANKLGQGGFGPVYKGKLQDG 519
AY N+ + VN +L++L + +FE+LA ATNNF ANKLGQGGFGPVY+G L G
Sbjct: 478 HAYQNYDMNMLGDNVNRVKLEELPLLDFEKLAAATNNFHEANKLGQGGFGPVYRGNLPGG 537
Query: 520 QEIAVKRLSKASGQGQEEFMNEVMI 544
Q+IAVKRLS+AS QGQEEFMNE+++
Sbjct: 538 QKIAVKRLSRASAQGQEEFMNEMIV 562
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224114125|ref|XP_002316674.1| predicted protein [Populus trichocarpa] gi|222859739|gb|EEE97286.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224104212|ref|XP_002333971.1| predicted protein [Populus trichocarpa] gi|222839418|gb|EEE77755.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224114141|ref|XP_002316678.1| predicted protein [Populus trichocarpa] gi|222859743|gb|EEE97290.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224112032|ref|XP_002332843.1| predicted protein [Populus trichocarpa] gi|222833304|gb|EEE71781.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224114137|ref|XP_002316677.1| predicted protein [Populus trichocarpa] gi|222859742|gb|EEE97289.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359497887|ref|XP_003635683.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147774142|emb|CAN63401.1| hypothetical protein VITISV_024545 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224078778|ref|XP_002305625.1| predicted protein [Populus trichocarpa] gi|222848589|gb|EEE86136.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296084622|emb|CBI25710.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 550 | ||||||
| TAIR|locus:2197649 | 821 | AT1G61360 [Arabidopsis thalian | 0.941 | 0.630 | 0.369 | 1.8e-87 | |
| TAIR|locus:2200888 | 804 | AT1G61500 [Arabidopsis thalian | 0.852 | 0.583 | 0.390 | 2.3e-87 | |
| TAIR|locus:2200908 | 842 | AT1G61610 [Arabidopsis thalian | 0.56 | 0.365 | 0.352 | 4.6e-86 | |
| TAIR|locus:2141176 | 849 | B120 [Arabidopsis thaliana (ta | 0.774 | 0.501 | 0.336 | 2.4e-85 | |
| TAIR|locus:2197734 | 814 | AT1G61370 [Arabidopsis thalian | 0.861 | 0.582 | 0.369 | 8e-85 | |
| TAIR|locus:2197704 | 831 | AT1G61390 [Arabidopsis thalian | 0.94 | 0.622 | 0.340 | 1.7e-84 | |
| TAIR|locus:2197744 | 807 | AT1G61420 [Arabidopsis thalian | 0.858 | 0.584 | 0.380 | 3.4e-84 | |
| TAIR|locus:2197709 | 809 | AT1G61480 [Arabidopsis thalian | 0.861 | 0.585 | 0.380 | 1.5e-83 | |
| TAIR|locus:2197664 | 804 | AT1G61490 [Arabidopsis thalian | 0.845 | 0.578 | 0.379 | 3.9e-83 | |
| TAIR|locus:2200923 | 802 | AT1G61550 [Arabidopsis thalian | 0.925 | 0.634 | 0.352 | 5.8e-82 |
| TAIR|locus:2197649 AT1G61360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 874 (312.7 bits), Expect = 1.8e-87, P = 1.8e-87
Identities = 209/565 (36%), Positives = 297/565 (52%)
Query: 4 VAIVVLLSSCFYSDFGTATATDTITSSQFIRDPESI---IXXXXXXXXXXXXPDGNFTNR 60
VA ++L+++ F S +G A T TSS P SI + N N+
Sbjct: 4 VACLLLITALF-SSYGYAAIT---TSS-----PLSIGVTLSSPGGSYELGFFSSNNSGNQ 54
Query: 61 YIGIWYNKGGSANKTVVWVANRNKPLIDSSGIFTISEDGNLVVLNGKKQVHWXXXXXXXX 120
Y+GIW+ K + +VWVANR KP+ + TIS +G+L++L+ KK + W
Sbjct: 55 YVGIWFKK--VTPRVIVWVANREKPVSSTMANLTISSNGSLILLDSKKDLVWSSGGDPTS 112
Query: 121 XXXXTRAQLLDSGNLVLHDNISQVSIWDSFQEPTDTFYSEMKVSTDLRTGKKVQLTSWRS 180
RA+LLD+GNLV+ DN++ +W SF+ DT + D+ KK LTSW+S
Sbjct: 113 NK--CRAELLDTGNLVVVDNVTGNYLWQSFEHLGDTMLPLTSLMYDIPNNKKRVLTSWKS 170
Query: 181 LSNPSIGSFSAGLDSFTIPEVFIWINGTRPYWRSGPWNGRYFIGIPDMNSVYLDGFNLGE 240
++PS G F A + +P + G+ PYWRSGPW G F GIP+M++ Y++ + +
Sbjct: 171 ETDPSPGEFVAEITP-QVPSQGLIRKGSSPYWRSGPWAGTRFTGIPEMDASYVNPLGMVQ 229
Query: 241 DHQKGTRYLTFAFADND--VFFALTPQGNLEERAWVDGKAHLKIYFFYPTNDCDVYGKCG 298
D GT F N + LTP+G+L +G +K +F P CD+YG+CG
Sbjct: 230 DEVNGTGVFAFCVLRNFNLSYIKLTPEGSLRITR-NNGTDWIK-HFEGPLTSCDLYGRCG 287
Query: 299 AFGSCNSQKIPICSCLLGFEPKNAEDWNRGNWSGG---------------EVEGK-QDGF 342
FG C P+C CL GFEPK+ E+W GNWS G E +GK +D F
Sbjct: 288 PFGLCVRSGTPMCQCLKGFEPKSDEEWRSGNWSRGCVRRTNLSCQGNSSVETQGKDRDVF 347
Query: 343 FKLETMKVPYFAERSS-ANEDKCKDQCSNNCSCKAYAYEIGVGCMIWTHNLIDIRKLPSG 401
+ + +K P E +S +NE++C C NCSC A++Y G+GC++W L+D K G
Sbjct: 348 YHVSNIKPPDSYELASFSNEEQCHQGCLRNCSCTAFSYVSGIGCLVWNQELLDTVKFIGG 407
Query: 402 GTNLYIRVAHEELD-RKDMKXXXXXXXXXXXXXXXXCTFFA-WRWFAKRKAMKENSKVQR 459
G L +R+AH EL RK +K WR+ K+ SK
Sbjct: 408 GETLSLRLAHSELTGRKRIKIITVATLSLSVCLILVLVACGCWRYRVKQNGSSLVSK-DN 466
Query: 460 LDLGEAYANFSTEKVNPARLQDLLVFNFEELANATNNFQLANKLGQGGFGPVYKGKLQDG 519
++ G ++ ++ V+ L F +L ATNNF + NKLGQGGFG VYKGKLQDG
Sbjct: 467 VE-GAWKSDLQSQDVS-----GLNFFEIHDLQTATNNFSVLNKLGQGGFGTVYKGKLQDG 520
Query: 520 QEIAVKRLSKASGQGQEEFMNEVMI 544
+EIAVKRL+ +S QG EEFMNE+ +
Sbjct: 521 KEIAVKRLTSSSVQGTEEFMNEIKL 545
|
|
| TAIR|locus:2200888 AT1G61500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200908 AT1G61610 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141176 B120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197734 AT1G61370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197704 AT1G61390 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197744 AT1G61420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197709 AT1G61480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197664 AT1G61490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200923 AT1G61550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.7.11 | 0.766 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00005055001 | SubName- Full=Chromosome undetermined scaffold_907, whole genome shotgun sequence; Flags- Fragment; (560 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 550 | |||
| pfam01453 | 109 | pfam01453, B_lectin, D-mannose binding lectin | 3e-35 | |
| cd00028 | 116 | cd00028, B_lectin, Bulb-type mannose-specific lect | 2e-30 | |
| smart00108 | 114 | smart00108, B_lectin, Bulb-type mannose-specific l | 7e-30 | |
| pfam00954 | 110 | pfam00954, S_locus_glycop, S-locus glycoprotein fa | 2e-29 | |
| cd01098 | 84 | cd01098, PAN_AP_plant, Plant PAN/APPLE-like domain | 4e-22 | |
| pfam08276 | 66 | pfam08276, PAN_2, PAN-like domain | 9e-18 | |
| smart00473 | 78 | smart00473, PAN_AP, divergent subfamily of APPLE d | 1e-10 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 3e-06 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 5e-06 | |
| cd05148 | 261 | cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro | 1e-05 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 1e-05 | |
| cd06627 | 254 | cd06627, STKc_Cdc7_like, Catalytic domain of Cell | 1e-05 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 5e-05 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 6e-05 | |
| cd06614 | 286 | cd06614, STKc_PAK, Catalytic domain of the Protein | 9e-05 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 9e-05 | |
| cd06606 | 260 | cd06606, STKc_MAPKKK, Catalytic domain of the Prot | 1e-04 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 2e-04 | |
| cd08530 | 256 | cd08530, STKc_CNK2-like, Catalytic domain of the P | 3e-04 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 3e-04 | |
| cd05036 | 277 | cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro | 0.002 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 0.002 | |
| cd05041 | 251 | cd05041, PTKc_Fes_like, Catalytic domain of Fes-li | 0.004 | |
| cd05068 | 261 | cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re | 0.004 |
| >gnl|CDD|216511 pfam01453, B_lectin, D-mannose binding lectin | Back alignment and domain information |
|---|
Score = 127 bits (321), Expect = 3e-35
Identities = 54/113 (47%), Positives = 67/113 (59%), Gaps = 4/113 (3%)
Query: 73 NKTVVWVANRNKPLIDSSGIFTISEDGNLVVLNGKKQVHWSSNVSSLANNSNTRAQLLDS 132
N+TVVWVANR PL DSS + DGNLV+ +G +V WSSN S S A L D
Sbjct: 1 NQTVVWVANRLNPLTDSSYTLILQSDGNLVLYDGNGRVVWSSNTSG--KGSGCVAVLQDD 58
Query: 133 GNLVLHDNISQVSIWDSFQEPTDTFYSEMKVSTDLRTGKKVQLTSWRSLSNPS 185
GNLVL+DN S +W SF PTDT K ++ G +LTSW+S ++PS
Sbjct: 59 GNLVLYDN-SGKVLWQSFDHPTDTLLPGQKD-GNVVIGGSRRLTSWKSNTDPS 109
|
These proteins include mannose-specific lectins from plants as well as bacteriocins from bacteria. Length = 109 |
| >gnl|CDD|237995 cd00028, B_lectin, Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >gnl|CDD|214519 smart00108, B_lectin, Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >gnl|CDD|201524 pfam00954, S_locus_glycop, S-locus glycoprotein family | Back alignment and domain information |
|---|
| >gnl|CDD|238531 cd01098, PAN_AP_plant, Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins | Back alignment and domain information |
|---|
| >gnl|CDD|219774 pfam08276, PAN_2, PAN-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214680 smart00473, PAN_AP, divergent subfamily of APPLE domains | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 550 | |||
| PF01453 | 114 | B_lectin: D-mannose binding lectin; InterPro: IPR0 | 99.95 | |
| cd00028 | 116 | B_lectin Bulb-type mannose-specific lectin. The do | 99.92 | |
| PF00954 | 110 | S_locus_glycop: S-locus glycoprotein family; Inter | 99.92 | |
| smart00108 | 114 | B_lectin Bulb-type mannose-specific lectin. | 99.91 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 99.26 | |
| PF08276 | 66 | PAN_2: PAN-like domain; InterPro: IPR013227 PAN do | 99.13 | |
| cd00129 | 80 | PAN_APPLE PAN/APPLE-like domain; present in N-term | 98.92 | |
| cd01098 | 84 | PAN_AP_plant Plant PAN/APPLE-like domain; present | 98.83 | |
| smart00108 | 114 | B_lectin Bulb-type mannose-specific lectin. | 98.74 | |
| cd00028 | 116 | B_lectin Bulb-type mannose-specific lectin. The do | 98.67 | |
| PF01453 | 114 | B_lectin: D-mannose binding lectin; InterPro: IPR0 | 98.47 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 98.39 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 97.91 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 97.77 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.77 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 97.67 | |
| smart00473 | 78 | PAN_AP divergent subfamily of APPLE domains. Apple | 97.67 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 97.55 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 97.45 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 97.34 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 97.3 | |
| KOG0595 | 429 | consensus Serine/threonine-protein kinase involved | 97.14 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 96.91 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 96.9 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 96.81 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 96.81 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 96.8 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 96.79 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 96.68 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 96.55 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 96.54 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 96.51 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 96.47 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 96.46 | |
| PTZ00284 | 467 | protein kinase; Provisional | 96.45 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 96.43 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 96.42 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 96.42 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 96.39 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 96.35 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 96.27 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 96.24 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 96.23 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 96.22 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 96.21 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 96.19 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 96.18 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 96.15 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 96.14 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 96.14 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 96.1 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 96.08 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 96.06 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 96.04 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 96.04 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 96.03 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 96.02 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 96.02 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 96.01 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 95.99 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 95.98 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 95.91 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 95.9 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 95.87 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 95.86 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 95.86 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 95.81 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 95.8 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 95.78 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 95.78 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 95.71 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 95.69 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 95.64 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 95.64 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 95.59 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 95.58 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 95.57 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 95.56 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 95.55 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 95.54 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 95.51 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 95.51 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 95.47 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 95.43 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 95.39 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 95.37 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 95.36 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 95.35 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 95.34 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 95.33 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 95.29 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 95.29 | |
| cd01100 | 73 | APPLE_Factor_XI_like Subfamily of PAN/APPLE-like d | 95.28 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 95.27 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 95.27 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 95.24 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 95.21 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 95.2 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 95.19 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 95.18 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 95.18 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 95.16 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 95.11 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 95.11 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 95.11 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 95.09 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 95.06 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 95.05 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 95.02 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 95.01 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 95.01 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 94.98 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 94.92 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 94.9 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 94.88 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 94.88 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 94.87 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 94.86 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 94.84 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 94.84 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 94.82 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 94.8 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 94.8 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 94.78 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 94.74 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 94.74 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 94.73 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 94.71 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 94.67 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 94.67 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 94.66 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 94.63 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 94.63 | |
| KOG0594 | 323 | consensus Protein kinase PCTAIRE and related kinas | 94.61 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 94.61 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 94.6 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 94.59 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 94.54 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 94.54 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 94.54 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 94.46 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 94.45 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 94.44 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 94.42 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 94.4 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 94.38 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 94.38 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 94.38 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 94.35 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 94.3 | |
| smart00090 | 237 | RIO RIO-like kinase. | 94.29 | |
| KOG1989 | 738 | consensus ARK protein kinase family [Signal transd | 94.25 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 94.15 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 94.12 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 94.05 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 94.03 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 94.02 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 93.95 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 93.9 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 93.84 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 93.82 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 93.7 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 93.67 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 93.67 | |
| KOG0661 | 538 | consensus MAPK related serine/threonine protein ki | 93.52 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 93.51 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 93.48 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 93.36 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 93.34 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 93.14 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 93.04 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 93.03 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 92.62 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 92.28 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 92.25 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 92.01 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 91.86 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 91.72 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 91.4 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 91.33 | |
| KOG0598 | 357 | consensus Ribosomal protein S6 kinase and related | 90.9 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 90.79 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 90.67 | |
| KOG0582 | 516 | consensus Ste20-like serine/threonine protein kina | 90.37 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 90.37 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 90.23 | |
| KOG0578 | 550 | consensus p21-activated serine/threonine protein k | 89.88 | |
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 89.65 | |
| KOG0200 | 609 | consensus Fibroblast/platelet-derived growth facto | 89.42 | |
| KOG0596 | 677 | consensus Dual specificity; serine/threonine and t | 89.15 | |
| KOG0660 | 359 | consensus Mitogen-activated protein kinase [Signal | 88.6 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 88.05 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 87.5 | |
| KOG0583 | 370 | consensus Serine/threonine protein kinase [Signal | 87.1 | |
| KOG1164 | 322 | consensus Casein kinase (serine/threonine/tyrosine | 86.98 | |
| KOG1219 | 4289 | consensus Uncharacterized conserved protein, conta | 86.03 | |
| KOG0984 | 282 | consensus Mitogen-activated protein kinase (MAPK) | 85.85 | |
| KOG0611 | 668 | consensus Predicted serine/threonine protein kinas | 85.82 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 85.76 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 85.27 | |
| COG0661 | 517 | AarF Predicted unusual protein kinase [General fun | 84.84 | |
| KOG1163 | 341 | consensus Casein kinase (serine/threonine/tyrosine | 84.81 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 84.35 | |
| KOG4721 | 904 | consensus Serine/threonine protein kinase, contain | 84.06 | |
| KOG0986 | 591 | consensus G protein-coupled receptor kinase [Signa | 83.95 | |
| KOG1027 | 903 | consensus Serine/threonine protein kinase and endo | 83.56 | |
| KOG0607 | 463 | consensus MAP kinase-interacting kinase and relate | 83.13 | |
| KOG0592 | 604 | consensus 3-phosphoinositide-dependent protein kin | 82.09 | |
| KOG1166 | 974 | consensus Mitotic checkpoint serine/threonine prot | 82.09 | |
| KOG2345 | 302 | consensus Serine/threonine protein kinase/TGF-beta | 81.98 | |
| KOG1024 | 563 | consensus Receptor-like protein tyrosine kinase RY | 81.83 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 81.19 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 80.92 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 80.38 |
| >PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity | Back alignment and domain information |
|---|
Probab=99.95 E-value=2.6e-29 Score=217.17 Aligned_cols=111 Identities=46% Similarity=0.682 Sum_probs=80.9
Q ss_pred CceEEEEeCCCCCCCCC--CceEEEeeCCcEEEEcCCccEEEee-ccccCcCCCCceEEEecCCCeEEEeCCCCceeeee
Q 008872 73 NKTVVWVANRNKPLIDS--SGIFTISEDGNLVVLNGKKQVHWSS-NVSSLANNSNTRAQLLDSGNLVLHDNISQVSIWDS 149 (550)
Q Consensus 73 ~~~~vW~anr~~p~~~~--~~~l~l~~~G~L~l~~~~~~~~W~s-~~~~~~~~~~~~~~l~d~GNlvl~~~~~~~~~WqS 149 (550)
++||||+|||+.|+... ..+|.|+.||+|+|+|..+.++|++ ++.+... .+..|.|+|+|||||++.. +.+||||
T Consensus 1 ~~tvvW~an~~~p~~~~s~~~~L~l~~dGnLvl~~~~~~~iWss~~t~~~~~-~~~~~~L~~~GNlvl~d~~-~~~lW~S 78 (114)
T PF01453_consen 1 PRTVVWVANRNSPLTSSSGNYTLILQSDGNLVLYDSNGSVIWSSNNTSGRGN-SGCYLVLQDDGNLVLYDSS-GNVLWQS 78 (114)
T ss_dssp ---------TTEEEEECETTEEEEEETTSEEEEEETTTEEEEE--S-TTSS--SSEEEEEETTSEEEEEETT-SEEEEES
T ss_pred CcccccccccccccccccccccceECCCCeEEEEcCCCCEEEEecccCCccc-cCeEEEEeCCCCEEEEeec-ceEEEee
Confidence 36899999999999542 4789999999999999999999999 5444321 3789999999999999975 8899999
Q ss_pred cCCCCccccCCCeeccccCCCcceEEeeccCCCCCC
Q 008872 150 FQEPTDTFYSEMKVSTDLRTGKKVQLTSWRSLSNPS 185 (550)
Q Consensus 150 Fd~PTDtlLpgq~l~~~~~tg~~~~L~S~~s~~~~s 185 (550)
|||||||+||+|+|+.+..+|.+..++||++.+|||
T Consensus 79 f~~ptdt~L~~q~l~~~~~~~~~~~~~sw~s~~dps 114 (114)
T PF01453_consen 79 FDYPTDTLLPGQKLGDGNVTGKNDSLTSWSSNTDPS 114 (114)
T ss_dssp TTSSS-EEEEEET--TSEEEEESTSSEEEESS----
T ss_pred cCCCccEEEeccCcccCCCccccceEEeECCCCCCC
Confidence 999999999999999987777666799999999996
|
Each bulb-type lectin domain consists of three sequential beta-sheet subdomains (I, II, III) that are inter-related by pseudo three-fold symmetry. The three subdomains are flat four-stranded, antiparrallel beta-sheets. Together they form a 12-stranded beta-barrel in which the barrel axis coincides with the pseudo 3-fold axis.; GO: 0005529 sugar binding; PDB: 3M7H_A 3M7J_B 3MEZ_D 1DLP_A 1BWU_D 1KJ1_A 1B2P_A 1XD6_A 2DPF_C 2D04_B .... |
| >cd00028 B_lectin Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation | Back alignment and domain information |
|---|
| >smart00108 B_lectin Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08276 PAN_2: PAN-like domain; InterPro: IPR013227 PAN domains have significant functional versatility fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions [] | Back alignment and domain information |
|---|
| >cd00129 PAN_APPLE PAN/APPLE-like domain; present in N-terminal (N) domains of plasminogen/ hepatocyte growth factor proteins, plasma prekallikrein/coagulation factor XI and microneme antigen proteins, plant receptor-like protein kinases, and various nematode and leech anti-platelet proteins | Back alignment and domain information |
|---|
| >cd01098 PAN_AP_plant Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins | Back alignment and domain information |
|---|
| >smart00108 B_lectin Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >cd00028 B_lectin Bulb-type mannose-specific lectin | Back alignment and domain information |
|---|
| >PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00473 PAN_AP divergent subfamily of APPLE domains | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01100 APPLE_Factor_XI_like Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >COG0661 AarF Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 550 | ||||
| 3tl8_A | 349 | The Avrptob-Bak1 Complex Reveals Two Structurally S | 7e-09 | ||
| 3uim_A | 326 | Structural Basis For The Impact Of Phosphorylation | 7e-09 | ||
| 2qkw_B | 321 | Structural Basis For Activation Of Plant Immunity B | 1e-05 | ||
| 3hgk_A | 327 | Crystal Structure Of Effect Protein Avrptob Complex | 1e-05 | ||
| 2nry_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 3e-04 | ||
| 2oib_A | 301 | Crystal Structure Of Irak4 Kinase Domain Apo Form L | 3e-04 | ||
| 2nru_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 3e-04 |
| >pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 | Back alignment and structure |
|
| >pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 | Back alignment and structure |
| >pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 | Back alignment and structure |
| >pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 | Back alignment and structure |
| >pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
| >pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 | Back alignment and structure |
| >pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
Score = 109 bits (275), Expect = 1e-26
Identities = 31/62 (50%), Positives = 40/62 (64%), Gaps = 1/62 (1%)
Query: 484 VFNFEELANATNNFQLANKLGQGGFGPVYKGKLQDGQEIAVKRLSKASGQGQE-EFMNEV 542
F+ EL A++NF N LG+GGFG VYKG+L DG +AVKRL + QG E +F EV
Sbjct: 19 RFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEV 78
Query: 543 MI 544
+
Sbjct: 79 EM 80
|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >1kj1_A Lectin I, lecgna 1; BULB lectin, mannose, plant protein; HET: MAN; 2.20A {Allium sativum} SCOP: b.78.1.1 PDB: 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Length = 109 | Back alignment and structure |
|---|
| >3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Length = 110 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* Length = 115 | Back alignment and structure |
|---|
| >1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Length = 119 | Back alignment and structure |
|---|
| >3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* Length = 109 | Back alignment and structure |
|---|
| >1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Length = 112 | Back alignment and structure |
|---|
| >3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 110 | Back alignment and structure |
|---|
| >3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 109 | Back alignment and structure |
|---|
| >3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} Length = 113 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Length = 276 | Back alignment and structure |
|---|
| >3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Length = 276 | Back alignment and structure |
|---|
| >3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Length = 276 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 Length = 236 | Back alignment and structure |
|---|
| >1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 Length = 236 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} Length = 111 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 550 | |||
| 3m7h_A | 276 | Putidacin L1; monocot mannose-binding lectin, bact | 100.0 | |
| 1dlp_A | 236 | Lectin scafet precursor; two-domain lectin, beta p | 100.0 | |
| 4h3o_A | 105 | Lectin; cadmium, plant protein; 2.17A {Allium sati | 99.86 | |
| 3a0c_A | 110 | Mannose/sialic acid-binding lectin; beta-prism II, | 99.84 | |
| 1b2p_A | 119 | Protein (lectin); mannose-binding lectin, monocot, | 99.82 | |
| 2dpf_A | 115 | Curculin; sweet taste, taste modifying, plant prot | 99.81 | |
| 1xd5_A | 112 | Gastrodianin-1, antifungal protein GAFP-1; monocot | 99.79 | |
| 3dzw_A | 109 | Agglutinin; lectin, mannobiose, mannose-alpha1, 3- | 99.77 | |
| 3mez_B | 113 | Mannose-specific lectin 3 chain 2; heterotetramer, | 99.71 | |
| 3r0e_B | 110 | Lectin; carbohydrate binding, carbohydrate, sugar | 99.71 | |
| 1xd5_A | 112 | Gastrodianin-1, antifungal protein GAFP-1; monocot | 99.68 | |
| 3r0e_A | 109 | Lectin; carbohydrate binding, carbohydrate, sugar | 99.67 | |
| 3a0c_A | 110 | Mannose/sialic acid-binding lectin; beta-prism II, | 99.65 | |
| 3mez_A | 111 | Mannose-specific lectin 3 chain 1; heterotetramer, | 99.61 | |
| 1b2p_A | 119 | Protein (lectin); mannose-binding lectin, monocot, | 99.6 | |
| 2dpf_A | 115 | Curculin; sweet taste, taste modifying, plant prot | 99.59 | |
| 3mez_B | 113 | Mannose-specific lectin 3 chain 2; heterotetramer, | 99.39 | |
| 3mez_A | 111 | Mannose-specific lectin 3 chain 1; heterotetramer, | 99.35 | |
| 3m7h_A | 276 | Putidacin L1; monocot mannose-binding lectin, bact | 99.32 | |
| 3dzw_A | 109 | Agglutinin; lectin, mannobiose, mannose-alpha1, 3- | 99.23 | |
| 3r0e_B | 110 | Lectin; carbohydrate binding, carbohydrate, sugar | 99.21 | |
| 3r0e_A | 109 | Lectin; carbohydrate binding, carbohydrate, sugar | 99.15 | |
| 4h3o_A | 105 | Lectin; cadmium, plant protein; 2.17A {Allium sati | 99.07 | |
| 1dlp_A | 236 | Lectin scafet precursor; two-domain lectin, beta p | 98.93 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 98.33 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 98.24 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 98.22 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 97.95 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 97.93 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 97.91 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 97.87 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 97.72 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 97.64 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 97.57 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 97.55 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 97.55 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 97.52 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 97.47 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 97.32 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 97.25 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 97.23 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 97.19 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 97.19 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 97.14 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 97.1 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 97.08 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 97.07 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 97.05 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 97.05 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 97.03 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 97.01 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 96.99 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 96.99 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 96.98 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 96.97 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 96.96 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 96.95 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 96.94 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 96.93 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 96.93 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 96.91 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 96.9 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 96.89 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 96.89 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 96.87 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 96.86 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 96.83 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 96.81 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 96.81 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 96.78 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 96.78 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 96.78 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 96.76 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 96.76 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 96.75 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 96.75 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 96.74 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 96.74 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 96.73 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 96.7 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 96.69 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 96.69 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 96.68 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 96.66 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 96.66 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 96.64 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 96.63 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 96.62 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 96.61 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 96.61 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 96.61 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 96.6 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 96.59 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 96.59 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 96.59 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 96.58 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 96.57 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 96.57 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 96.56 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 96.55 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 96.54 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 96.54 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 96.52 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 96.52 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 96.52 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 96.51 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 96.51 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 96.5 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 96.5 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 96.49 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 96.49 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 96.45 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 96.44 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 96.43 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 96.43 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 96.43 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 96.4 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 96.39 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 96.38 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 96.35 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 96.35 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 96.34 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 96.33 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 96.32 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 96.32 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 96.32 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 96.31 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 96.31 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 96.3 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 96.3 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 96.29 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 96.29 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 96.29 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 96.29 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 96.28 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 96.28 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 96.28 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 96.27 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 96.25 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 96.25 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 96.24 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 96.24 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 96.24 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 96.23 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 96.22 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 96.21 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 96.21 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 96.21 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 96.2 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 96.19 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 96.19 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 96.18 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 96.18 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 96.18 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 96.17 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 96.17 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 96.17 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 96.16 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 96.16 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 96.16 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 96.15 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 96.15 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 96.14 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 96.14 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 96.14 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 96.14 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 96.13 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 96.09 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 96.07 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 96.06 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 96.06 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 96.06 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 96.05 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 96.05 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 96.05 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 96.03 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 96.03 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 96.03 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 96.02 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 96.02 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 96.01 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 96.01 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 96.0 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 96.0 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 95.97 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 95.95 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 95.94 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 95.94 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 95.93 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 95.92 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 95.92 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 95.92 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 95.92 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 95.9 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 95.9 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 95.89 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 95.88 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 95.88 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 95.88 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 95.88 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 95.88 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 95.87 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 95.86 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 95.85 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 95.82 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 95.81 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 95.8 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 95.79 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 95.78 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 95.77 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 95.77 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 95.76 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 95.76 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 95.76 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 95.76 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 95.74 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 95.74 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 95.73 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 95.72 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 95.72 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 95.72 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 95.7 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 95.67 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 95.64 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 95.64 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 95.63 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 95.62 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 95.61 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 95.6 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 95.59 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 95.57 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 95.56 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 95.56 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 95.53 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 95.51 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 95.49 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 95.49 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 95.47 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 95.42 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 95.42 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 95.41 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 95.4 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 95.4 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 95.4 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 95.4 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 95.33 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 95.32 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 95.32 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 95.29 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 95.28 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 95.21 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 95.2 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 95.19 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 95.18 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 95.11 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 94.9 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 94.88 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 94.74 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 94.64 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 94.64 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 94.62 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 94.52 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 94.38 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 94.23 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 94.22 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 94.17 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 94.11 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 94.04 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 94.03 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 92.93 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 91.94 | |
| 3d1u_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 90.79 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 84.52 |
| >3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-42 Score=344.68 Aligned_cols=236 Identities=17% Similarity=0.189 Sum_probs=180.3
Q ss_pred cccccceecCCCcccCCCeEEeCCCeEEEeeecCCCCCCccEEEEEeecCCCCCceEEEEeCCCCCCCCC----CceEEE
Q 008872 20 TATATDTITSSQFIRDPESIISSGSKFKLGFFSPDGNFTNRYIGIWYNKGGSANKTVVWVANRNKPLIDS----SGIFTI 95 (550)
Q Consensus 20 ~~~~~~~l~~g~~l~~~~~l~S~~g~F~~gf~~~~~~~~~~~l~i~~~~~~~~~~~~vW~anr~~p~~~~----~~~l~l 95 (550)
++++.|+|.+|++|..+++|+|++|.|+||||+++ ++|| |+ +.+ +||+|||++|+.++ +++|+|
T Consensus 10 ~~~~~~~l~~g~~l~~~~~l~S~~g~F~lgf~~~~----~~~l---y~----~~~-vvW~Anr~~p~~~~~~~~~~~l~l 77 (276)
T 3m7h_A 10 NGVGTSVLPAYQTLSAGQYLLSPNQRFKLLLQGDG----NLVI---QD----NGA-TVWVANEQQPFSSTIPLRNKKAPL 77 (276)
T ss_dssp CCTTSSEECTTEEBCTTCEEECTTSSEEEEECTTS----CEEE---EE----TTE-EEEECSTTSTTEEEEECCCTTCCS
T ss_pred ccccCCEecCCCEecCCCEEEcCCCcEEEEEECCC----CeEE---EC----CCC-eEEECCCCCCcCCcccccceEEEE
Confidence 45668999999999999999999999999999543 4566 54 356 99999999999764 689999
Q ss_pred eeCCcEEE--EcCCccEEEeeccccCc---CCCCceEEEecCCCeEEEeCCCCceeeeecCCCCccccCCCeeccccCCC
Q 008872 96 SEDGNLVV--LNGKKQVHWSSNVSSLA---NNSNTRAQLLDSGNLVLHDNISQVSIWDSFQEPTDTFYSEMKVSTDLRTG 170 (550)
Q Consensus 96 ~~~G~L~l--~~~~~~~~W~s~~~~~~---~~~~~~~~l~d~GNlvl~~~~~~~~~WqSFd~PTDtlLpgq~l~~~~~tg 170 (550)
+.||+|+| .|+++.+||++++.... ..+++.|+|+|+|||||++ +.+|||| ||||||||||+++.++++|
T Consensus 78 ~~~G~Lvl~~~~~~~~~vWst~~~~~~~~~~~~~~~a~L~d~GNlVl~~---~~~lWqS--~ptdtlLpg~~~~~~l~~g 152 (276)
T 3m7h_A 78 AFYVQYGAFLDDYSRRRVWLTDNSTFTSNDQWNRTHLVLQDDGNIVLVD---SLALWNG--TPAIPLVPGAIDSLLLAPG 152 (276)
T ss_dssp EEEESSSEEEEEGGGTEEEEECCCCCCCTTHHHHEEEEECTTSCEEEEE---EEEEEES--CTTSCCCCSCTTCEEECSS
T ss_pred eCCCcEEEEEeCCCCCEEEEeCCCcccccccCCceEEEEeCCCCEEecC---CceeeCc--ccccccccccccccccccC
Confidence 99999999 78889999999976421 0136799999999999998 5689999 9999999999999988888
Q ss_pred cceEEeeccCCCCCCCceeEEeeccCCCCeEEEEEcCCcceeecCCCCCceeeceeccceeeeceeEeeeeCcCC-eEEE
Q 008872 171 KKVQLTSWRSLSNPSIGSFSAGLDSFTIPEVFIWINGTRPYWRSGPWNGRYFIGIPDMNSVYLDGFNLGEDHQKG-TRYL 249 (550)
Q Consensus 171 ~~~~L~S~~s~~~~s~G~y~l~~~~~~~~~~~~~~~~~~~yw~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~ 249 (550)
++ | ++..||++|.|+++|+++|. ++++..+..+||++|+|+.... .+.......+.+.+ ..+ ..++
T Consensus 153 ~~--L---~S~~dps~G~fsl~l~~dGn--lvLy~~~~~~yW~Sgt~~~~~~----~l~l~~dGnLvl~d--~~~~~vWs 219 (276)
T 3m7h_A 153 SE--L---VQGVVYGAGASKLVFQGDGN--LVAYGPNGAATWNAGTQGKGAV----RAVFQGDGNLVVYG--AGNAVLWH 219 (276)
T ss_dssp EE--E---CTTCEEEETTEEEEECTTSC--EEEECTTSSEEEECCCTTTTCC----EEEECTTSCEEEEC--TTSCEEEE
T ss_pred cc--c---ccCCCCCCceEEEeecCCce--EEEEeCCCeEEEECCCCCCccE----EEEEcCCCeEEEEe--CCCcEEEE
Confidence 75 6 46789999999999999985 4455234689999999875321 11111122344444 333 4444
Q ss_pred EEEEcCCceEEEEecCCCeEEEEEeCCCCceEEEEeecC
Q 008872 250 TFAFADNDVFFALTPQGNLEERAWVDGKAHLKIYFFYPT 288 (550)
Q Consensus 250 ~~~~~~~~~~~~l~~~G~l~~y~~~~~~~~W~~~~~~p~ 288 (550)
++.......+++|+.||+|++|.| ...|...+.+|.
T Consensus 220 S~t~~~~~~rl~Ld~dGnLvly~~---~~~Wqsf~~~P~ 255 (276)
T 3m7h_A 220 SHTGGHASAVLRLQANGSIAILDE---KPVWARFGFQPT 255 (276)
T ss_dssp CSCTTCTTCEEEECTTSCEEEEEE---EEEEESSSCCTT
T ss_pred ecCCCCCCEEEEEcCCccEEEEcC---CCeEEccCccCC
Confidence 433322333599999999999998 345666666664
|
| >1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 | Back alignment and structure |
|---|
| >4h3o_A Lectin; cadmium, plant protein; 2.17A {Allium sativum} PDB: 1kj1_A* 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* | Back alignment and structure |
|---|
| >3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* | Back alignment and structure |
|---|
| >1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 | Back alignment and structure |
|---|
| >2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* | Back alignment and structure |
|---|
| >1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A | Back alignment and structure |
|---|
| >3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} SCOP: b.78.1.1 PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* | Back alignment and structure |
|---|
| >3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 | Back alignment and structure |
|---|
| >3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} | Back alignment and structure |
|---|
| >1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A | Back alignment and structure |
|---|
| >3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} | Back alignment and structure |
|---|
| >3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* | Back alignment and structure |
|---|
| >3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 | Back alignment and structure |
|---|
| >1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 | Back alignment and structure |
|---|
| >2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* | Back alignment and structure |
|---|
| >3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 | Back alignment and structure |
|---|
| >3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 | Back alignment and structure |
|---|
| >3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* | Back alignment and structure |
|---|
| >3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} SCOP: b.78.1.1 PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* | Back alignment and structure |
|---|
| >3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} | Back alignment and structure |
|---|
| >3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} | Back alignment and structure |
|---|
| >4h3o_A Lectin; cadmium, plant protein; 2.17A {Allium sativum} PDB: 1kj1_A* 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* | Back alignment and structure |
|---|
| >1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 550 | ||||
| d1kj1a_ | 109 | b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium | 4e-18 | |
| d1dlpa2 | 120 | b.78.1.1 (A:116-235) Fetuin-binding protein Scafet | 4e-14 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 2e-13 | |
| d1b2pa_ | 119 | b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scill | 3e-13 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 3e-13 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 4e-13 | |
| d1dlpa1 | 115 | b.78.1.1 (A:1-115) Fetuin-binding protein Scafet p | 7e-13 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 7e-13 | |
| d1jpca_ | 108 | b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galan | 1e-12 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 2e-12 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 7e-12 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 2e-11 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 4e-11 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 5e-11 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 2e-10 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 2e-10 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 2e-10 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 3e-10 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 3e-10 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 4e-10 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 6e-10 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 8e-10 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 9e-10 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 9e-10 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 1e-09 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 1e-09 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 1e-09 | |
| d1xd5a_ | 112 | b.78.1.1 (A:) Gastrodianin (antifungal protein) {G | 1e-09 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 2e-09 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 2e-09 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 3e-09 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 3e-09 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 3e-09 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 3e-09 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 4e-09 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 5e-09 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 6e-09 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 7e-09 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 1e-08 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 1e-08 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 1e-08 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 2e-08 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 2e-08 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 2e-08 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 3e-08 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 3e-08 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 3e-08 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 4e-08 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 4e-08 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 4e-08 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 4e-08 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 5e-08 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 5e-08 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 6e-08 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 6e-08 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 8e-08 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 9e-08 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 9e-08 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 1e-07 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 2e-07 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 2e-07 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 2e-07 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 3e-07 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 5e-07 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 5e-07 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 5e-07 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 6e-07 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 9e-06 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 1e-05 |
| >d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Length = 109 | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-Prism II superfamily: alpha-D-mannose-specific plant lectins family: alpha-D-mannose-specific plant lectins domain: Lectin (agglutinin) species: Garlic (Allium sativum) [TaxId: 4682]
Score = 77.7 bits (191), Expect = 4e-18
Identities = 20/115 (17%), Positives = 42/115 (36%), Gaps = 14/115 (12%)
Query: 36 PESIISSGSKFKLGFFSPDGNFTNRYIGIWYNKGGSANKTVVWVANRNKPLIDSSGIFTI 95
+ +G + + + + ++ + T VW +N +
Sbjct: 6 NGEGLYAGQSLDVEPYHF-IMQEDCNLVLYDHS------TSVWASNTGILGKKGCKA-VL 57
Query: 96 SEDGNLVVLNGKKQVHWSSNVSSLANNSNTRAQLLDSGNLVLHDNISQVSIWDSF 150
DGN VV + + + W+S+ N N L + GN+V++ + IW +
Sbjct: 58 QSDGNFVVYDAEGRSLWASHSVR--GNGNYVLVLQEDGNVVIYGS----DIWSTG 106
|
| >d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 120 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 119 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 115 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Length = 108 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Length = 112 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 550 | |||
| d1xd5a_ | 112 | Gastrodianin (antifungal protein) {Gastrodia elata | 99.86 | |
| d1jpca_ | 108 | Lectin (agglutinin) {Snowdrop (Galanthus nivalis) | 99.85 | |
| d1kj1a_ | 109 | Lectin (agglutinin) {Garlic (Allium sativum) [TaxI | 99.83 | |
| d1dlpa2 | 120 | Fetuin-binding protein Scafet precursor {Bluebell | 99.69 | |
| d1b2pa_ | 119 | Lectin (agglutinin) {Bluebell (Scilla campanulata) | 99.67 | |
| d1dlpa1 | 115 | Fetuin-binding protein Scafet precursor {Bluebell | 99.62 | |
| d1dlpa1 | 115 | Fetuin-binding protein Scafet precursor {Bluebell | 99.45 | |
| d1dlpa2 | 120 | Fetuin-binding protein Scafet precursor {Bluebell | 99.29 | |
| d1b2pa_ | 119 | Lectin (agglutinin) {Bluebell (Scilla campanulata) | 99.2 | |
| d1jpca_ | 108 | Lectin (agglutinin) {Snowdrop (Galanthus nivalis) | 99.14 | |
| d1kj1a_ | 109 | Lectin (agglutinin) {Garlic (Allium sativum) [TaxI | 99.11 | |
| d1xd5a_ | 112 | Gastrodianin (antifungal protein) {Gastrodia elata | 98.89 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 98.27 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 98.18 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 98.06 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 98.02 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 98.02 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 97.93 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 97.9 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 97.81 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 97.75 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 97.73 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 97.7 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 97.67 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 97.62 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 97.61 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 97.6 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 97.6 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 97.6 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 97.55 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 97.53 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 97.52 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 97.5 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 97.48 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 97.48 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 97.45 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 97.44 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 97.44 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 97.43 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 97.41 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 97.33 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 97.32 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 97.31 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 97.27 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 97.24 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 97.23 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 97.21 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 97.19 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 97.19 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 97.17 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 97.17 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 97.12 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 97.1 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 97.05 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 97.05 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 97.03 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 96.96 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 96.93 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 96.82 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 96.73 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 96.45 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 96.21 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.3 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 91.18 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 91.06 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 88.06 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 87.75 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 86.29 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 83.65 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 83.48 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 82.83 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 82.32 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 81.47 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 81.08 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 80.37 |
| >d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-Prism II superfamily: alpha-D-mannose-specific plant lectins family: alpha-D-mannose-specific plant lectins domain: Gastrodianin (antifungal protein) species: Gastrodia elata [TaxId: 91201]
Probab=99.86 E-value=1.2e-21 Score=165.95 Aligned_cols=112 Identities=23% Similarity=0.410 Sum_probs=93.7
Q ss_pred cceecCCCcccCCCeEEeCCCeEEEeeecCCCCCCccEEEEEeecCCCCCceEEEEeCCCCCCCCCCceEEEeeCCcEEE
Q 008872 24 TDTITSSQFIRDPESIISSGSKFKLGFFSPDGNFTNRYIGIWYNKGGSANKTVVWVANRNKPLIDSSGIFTISEDGNLVV 103 (550)
Q Consensus 24 ~~~l~~g~~l~~~~~l~S~~g~F~~gf~~~~~~~~~~~l~i~~~~~~~~~~~~vW~anr~~p~~~~~~~l~l~~~G~L~l 103 (550)
+|+|.+||.|..|++|+ +|.|+|.||.+| + |.++. ..++||.|+++.|. ..+.|.|+.||+|+|
T Consensus 1 tDtL~~gq~L~~g~~l~--~g~~~l~~q~DG-N-----Lvly~------~~~~vW~s~~~~~~--~~~~l~l~~dGnLvl 64 (112)
T d1xd5a_ 1 SDRLNSGHQLDTGGSLA--EGGYLFIIQNDC-N-----LVLYD------NNRAVWASGTNGKA--SGCVLKMQNDGNLVI 64 (112)
T ss_dssp CCEEETTEEECTTCEEE--ETTEEEEECTTS-C-----EEEEE------TTEEEEECCCTTSC--SSEEEEECTTSCEEE
T ss_pred CCEecCCCEecCCCEEE--ECCEEEEEcCCC-C-----EEEEc------CCcEEEEccCccCC--CCcEEEEeccccEEE
Confidence 58999999999999997 599999999998 3 44433 34799999999874 357899999999999
Q ss_pred EcCCccEEEeeccccCcCCCCceEEEecCCCeEEEeCCCCceeeeecCCCCc
Q 008872 104 LNGKKQVHWSSNVSSLANNSNTRAQLLDSGNLVLHDNISQVSIWDSFQEPTD 155 (550)
Q Consensus 104 ~~~~~~~~W~s~~~~~~~~~~~~~~l~d~GNlvl~~~~~~~~~WqSFd~PTD 155 (550)
+|. +.++|++++.... +..+|+|+|+|||||++.+ +.++|||+.+|+|
T Consensus 65 ~~~-~~~~w~s~t~~~~--~~~~l~L~ddGNlvly~~~-~~~~W~S~t~~~n 112 (112)
T d1xd5a_ 65 YSG-SRAIWASNTNRQN--GNYYLILQRDRNVVIYDNS-NNAIWATHTNVGN 112 (112)
T ss_dssp EET-TEEEEECCCCCSC--CCCEEEECTTSCEEEECTT-SCEEEECCCCCCC
T ss_pred Eec-CCeEEEEeeccCC--CceEEEEcCCCCEEEECCC-CcEEecCCCccCC
Confidence 997 5677877765443 4679999999999999986 7789999999985
|
| >d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} | Back information, alignment and structure |
|---|
| >d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} | Back information, alignment and structure |
|---|
| >d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} | Back information, alignment and structure |
|---|
| >d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} | Back information, alignment and structure |
|---|
| >d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} | Back information, alignment and structure |
|---|
| >d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|