Citrus Sinensis ID: 008876


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550
MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLTACRA
cCECccccccccccccEEccccccccCCcccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccCEEEcccccccccccccEEEccccECccccccHccccccccEEEcccccccccccccccccccccEEEccccCEEEcccccccccccccccEEEcccccccccccHHHHHcccccEEEccccCEEEEccccccccccccEEEcccccccccccHHHHcccccccEEcccccccccccccccccccccCEEccccccccccccHHccccccccEEEccccccCECccHHHHcccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccEEcccccccccccHHHHcccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccccccccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccc
MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLTAC**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLTACRA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EZG, chain A
Confidence level:very confident
Coverage over the Query: 58-218
View the alignment between query and template
View the model in PyMOL
Template: 4EZG, chain A
Confidence level:very confident
Coverage over the Query: 34-194
View the alignment between query and template
View the model in PyMOL
Template: 1XEU, chain A
Confidence level:very confident
Coverage over the Query: 85-269
View the alignment between query and template
View the model in PyMOL
Template: 1XEU, chain A
Confidence level:very confident
Coverage over the Query: 332-519
View the alignment between query and template
View the model in PyMOL
Template: 2V9T, chain B
Confidence level:very confident
Coverage over the Query: 408-545
View the alignment between query and template
View the model in PyMOL
Template: 3ZYJ, chain A
Confidence level:very confident
Coverage over the Query: 39-300
View the alignment between query and template
View the model in PyMOL
Template: 3ZYJ, chain A
Confidence level:very confident
Coverage over the Query: 307-545
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 8-550
View the alignment between query and template
View the model in PyMOL