Citrus Sinensis ID: 008876

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550
MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLTACRA
cEEEccccccccccccEEccccccccEEcccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccEEEEcccccccccccccEEEccccEEcccccHHHcccccccEEEcccccccccccccccccccccEEEccccEEEEcccccccccccccccEEEcccccccccccHHHHHcccccEEEccccEEEEEccccccccccccEEEcccccccccccHHHHcccccccEEcccccccccccccccccccccEEEccccccccccccHHccccccccEEEccccccEEEccHHHHcccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccEEcccccccccccHHHHcccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHcccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEccccccEEEccccHHHcccccccEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEcccccEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccccccEEEEcccccccccccHHHHHccHcccEEEcccccccccccHHHccccccEEEEcccccccccccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccc
mkgslspsislltslevldlgglvdltgiippsigclqnLKKLYLYGnklsgsvpESISKLLKLEELHLhenrlsgtlssslgnlKNINQLLMHTnqftgvipdsftnltnlvrLDLHCNYlngyipekiGELQLLEQLdfsnnllrgklppslcnlTVISVLYldnnklegaipfpsspgqmpslgflrlqdnnltgkipptfgylASLRRVSLANnklegaiptslgnlqDLTELYlngnqlsgqipkSISQLSQLIFLSISrnqiegplpsgmfslqnlqtldlsfnllnlssipmwmaelpsLSRVYLAGcgikgkipeffrttpsplqeldlsvnhlsgsipawIGSLTQLYSLNlsrnslvssipetiTNLQDLVLLdlhsnkltgsISQVFKigqrfpdgsltyidlsdngfssgieltggggqtgiRFLNLSRNvlegqipvsvgrlrslrsldlsynklgyvlpgslanessLETLKLQnnrftgripseYLKLKklkeldlshnllvgeipagkplsdfpessfsgnrglcgkpltacra
MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETlklqnnrftgriPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESsfsgnrglcgkpltacra
MKGslspsislltslEvldlgglvdlTGIIPPSIGClqnlkklylygnklSGSVPESISkllkleelhlheNRlsgtlssslgnlKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKsisqlsqliflsisRNQIEGPLPSGMFSLQnlqtldlsfnllnlssIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQlyslnlsrnslvssIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNgfssgieltggggqtgirflNLSRNVLEGQIPVSVGrlrslrsldlsYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYlklkklkeldlSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLTACRA
*********SLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPF*********LGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEI******************************
MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLTAC**
MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLTACRA
*KGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLT*C**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLTACRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query550 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ yes no 0.970 0.427 0.387 3e-79
Q8VZG8 1045 Probable LRR receptor-lik no no 0.970 0.511 0.366 1e-78
O49318 1124 Probable leucine-rich rep no no 0.941 0.460 0.366 4e-71
Q9LP24 1120 Probable leucine-rich rep no no 0.96 0.471 0.350 9e-71
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.970 0.426 0.36 7e-69
Q9FL28 1173 LRR receptor-like serine/ no no 0.892 0.418 0.360 4e-68
Q9SHI2 1101 Leucine-rich repeat recep no no 0.932 0.465 0.337 1e-67
C0LGR3 1091 Probable LRR receptor-lik no no 0.956 0.482 0.361 7e-65
Q9LYN8 1192 Leucine-rich repeat recep no no 0.965 0.445 0.340 7e-65
Q9LVP0 1102 Probable leucine-rich rep no no 0.925 0.461 0.363 9e-64
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  296 bits (758), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 213/550 (38%), Positives = 310/550 (56%), Gaps = 16/550 (2%)

Query: 1   MKGSLSPSI-SLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESIS 59
           + GSL  SI S  T+LE L L G   L+G IP  +   Q+LK+L L  N L+GS+PE++ 
Sbjct: 323 LSGSLPKSICSNNTNLEQLVLSG-TQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALF 381

Query: 60  KLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHC 119
           +L++L +L+LH N L GTLS S+ NL N+  L+++ N   G +P   + L  L  L L+ 
Sbjct: 382 ELVELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYE 441

Query: 120 NYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSS 179
           N  +G IP++IG    L+ +D   N   G++PPS+  L  +++L+L  N+L G +  P+S
Sbjct: 442 NRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGL--PAS 499

Query: 180 PGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYL 239
            G    L  L L DN L+G IP +FG+L  L ++ L NN L+G +P SL +L++LT + L
Sbjct: 500 LGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINL 559

Query: 240 NGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPM 299
           + N+L+G I       S L F  ++ N  E  +P  + + QNL  L L  N L    IP 
Sbjct: 560 SHNRLNGTIHPLCGSSSYLSF-DVTNNGFEDEIPLELGNSQNLDRLRLGKNQLT-GKIPW 617

Query: 300 WMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSL 359
            + ++  LS + ++   + G IP         L  +DL+ N LSG IP W+G L+QL  L
Sbjct: 618 TLGKIRELSLLDMSSNALTGTIP-LQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGEL 676

Query: 360 NLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGF 419
            LS N  V S+P  + N   L++L L  N L GSI Q  +IG     G+L  ++L  N F
Sbjct: 677 KLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQ--EIGNL---GALNVLNLDKNQF 731

Query: 420 SSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRS-LDLSYNKLGYVLPGSLAN 478
           S  +     G  + +  L LSRN L G+IPV +G+L+ L+S LDLSYN     +P ++  
Sbjct: 732 SGSLP-QAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGT 790

Query: 479 ESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNR 538
            S LETL L +N+ TG +P     +K L  L++S N L G++   K  S +P  SF GN 
Sbjct: 791 LSKLETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLGGKLK--KQFSRWPADSFLGNT 848

Query: 539 GLCGKPLTAC 548
           GLCG PL+ C
Sbjct: 849 GLCGSPLSRC 858
Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query550
224107849 657 predicted protein [Populus trichocarpa] 1.0 0.837 0.689 0.0
255558292 653 serine-threonine protein kinase, plant-t 1.0 0.842 0.722 0.0
449435370638 PREDICTED: LRR receptor-like serine/thre 0.996 0.858 0.655 0.0
359807163638 probable leucine-rich repeat receptor-li 0.990 0.854 0.652 1e-178
147776686613 hypothetical protein VITISV_015032 [Viti 0.94 0.843 0.611 1e-168
356561181640 PREDICTED: probable leucine-rich repeat 0.985 0.846 0.431 1e-107
449464558637 PREDICTED: probable leucine-rich repeat 0.983 0.849 0.431 1e-103
225431221643 PREDICTED: probable leucine-rich repeat 0.985 0.842 0.413 1e-102
224094905640 predicted protein [Populus trichocarpa] 0.985 0.846 0.402 6e-97
255585197637 serine-threonine protein kinase, plant-t 0.985 0.850 0.413 2e-94
>gi|224107849|ref|XP_002314624.1| predicted protein [Populus trichocarpa] gi|222863664|gb|EEF00795.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/551 (68%), Positives = 456/551 (82%), Gaps = 1/551 (0%)

Query: 1   MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIGC-LQNLKKLYLYGNKLSGSVPESIS 59
           M+G LSPSI+L++ L+V+DLGGL+ L G IPPSIG  L NL+KLYLYGNKL G VP+SI 
Sbjct: 94  MRGLLSPSITLVSCLQVIDLGGLIGLAGRIPPSIGLRLPNLRKLYLYGNKLIGPVPDSIG 153

Query: 60  KLLKLEELHLHENRLSGTLSSSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHC 119
           KL KLEELHL+ENRLSG+L S++GNLKN+NQLL+++N+  G IPDSFTNLTN+V++DLH 
Sbjct: 154 KLSKLEELHLYENRLSGSLPSTMGNLKNLNQLLLYSNELAGTIPDSFTNLTNIVQMDLHS 213

Query: 120 NYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKLEGAIPFPSS 179
           N L G+IPE+IGE+Q+LE+LD S NLL GK+P SL NL  IS LYLD N LEG IPFPSS
Sbjct: 214 NILTGHIPERIGEMQVLEKLDLSENLLTGKIPLSLANLNSISELYLDTNHLEGEIPFPSS 273

Query: 180 PGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYL 239
            GQ+ SLGFLRL DN+LTG+IP +FG + SL+RVSLANNK EG IP+SLGNL  L ELYL
Sbjct: 274 FGQLSSLGFLRLDDNHLTGRIPASFGNMVSLQRVSLANNKFEGVIPSSLGNLSALKELYL 333

Query: 240 NGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPM 299
           +GN LSGQIP+S+ QLSQLI  ++S NQI+GPLP  + SL+NLQTLDLSFN LNL S P 
Sbjct: 334 SGNLLSGQIPESVGQLSQLIMFNVSHNQIQGPLPHELSSLENLQTLDLSFNHLNLISFPQ 393

Query: 300 WMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSL 359
           W+AELPSLSR+Y A CGI+G+IP+F + TPSP+QELDLS NHL+GS+PAW+G LTQLY L
Sbjct: 394 WLAELPSLSRIYCARCGIQGEIPDFLQATPSPIQELDLSSNHLTGSLPAWLGRLTQLYKL 453

Query: 360 NLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGF 419
           N SRNSLVS IP ++ NLQ L +LDLHSNKLTG I+ VF+IG  F DGSLTYIDLSDN F
Sbjct: 454 NFSRNSLVSRIPVSVRNLQYLGVLDLHSNKLTGPINNVFQIGNAFSDGSLTYIDLSDNYF 513

Query: 420 SSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANE 479
           S+GI   G G QTGI++LNLS N L G+I  ++GRL+SL++LDLS NKLG+ LP +LAN 
Sbjct: 514 STGIIQAGVGSQTGIQYLNLSHNFLGGRITTTIGRLKSLQTLDLSCNKLGFNLPEALANV 573

Query: 480 SSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRG 539
           SSLE LKLQ N FTGRIP  +LKLK+LKELDLS NLL GEIPAGKPL+DFP+SS+SGN+G
Sbjct: 574 SSLEKLKLQKNHFTGRIPVGFLKLKRLKELDLSDNLLAGEIPAGKPLTDFPQSSYSGNKG 633

Query: 540 LCGKPLTACRA 550
           LCGKPL+ C+ 
Sbjct: 634 LCGKPLSPCKV 644

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255558292|ref|XP_002520173.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223540665|gb|EEF42228.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449435370|ref|XP_004135468.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Cucumis sativus] gi|449516447|ref|XP_004165258.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359807163|ref|NP_001241099.1| probable leucine-rich repeat receptor-like protein kinase At1g35710-like precursor [Glycine max] gi|223452544|gb|ACM89599.1| receptor-kinase like protein [Glycine max] Back     alignment and taxonomy information
>gi|147776686|emb|CAN65727.1| hypothetical protein VITISV_015032 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356561181|ref|XP_003548863.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Glycine max] Back     alignment and taxonomy information
>gi|449464558|ref|XP_004149996.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] gi|449528593|ref|XP_004171288.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225431221|ref|XP_002267269.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224094905|ref|XP_002310286.1| predicted protein [Populus trichocarpa] gi|222853189|gb|EEE90736.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255585197|ref|XP_002533301.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526866|gb|EEF29078.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query550
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.881 0.388 0.294 1.8e-50
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.918 0.483 0.279 2.6e-48
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.925 0.461 0.288 3.6e-47
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.930 0.455 0.279 1.7e-46
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.930 0.457 0.280 2e-45
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.94 0.469 0.283 6.5e-45
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.918 0.430 0.280 8.9e-44
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.925 0.406 0.261 1e-43
TAIR|locus:2154463589 AT5G23400 [Arabidopsis thalian 0.821 0.767 0.286 1.7e-43
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.470 0.274 0.324 1.3e-41
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 536 (193.7 bits), Expect = 1.8e-50, P = 1.8e-50
 Identities = 147/499 (29%), Positives = 221/499 (44%)

Query:    51 SGSVPESISXXXXXXXXXXXXNRXXXXXXXXXXXXKNINQLLMHTNQFTGVIPDSFTNLT 110
             +GS+PE++             N              N+  L+++ N   G +P   + L 
Sbjct:   373 AGSIPEALFELVELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALR 432

Query:   111 NLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVLYLDNNKL 170
              L  L L+ N  +G IP++IG    L+ +D   N   G++PPS+  L  +++L+L  N+L
Sbjct:   433 KLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNEL 492

Query:   171 EGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGN 230
              G +P  +S G    L  L L DN L+G IP +FG+L  L ++ L NN L+G +P SL +
Sbjct:   493 VGGLP--ASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLIS 550

Query:   231 LQDLTELYLNGNQLSGQIPKXXXXXXXXXXXXXXRNQIEGPLPSGMFSLQXXXXXXXXXX 290
             L++LT + L+ N+L+G I                 N  E  +P  + + Q          
Sbjct:   551 LRNLTRINLSHNRLNGTIHPLCGSSSYLSFDVT-NNGFEDEIPLELGNSQNLDRLRLGKN 609

Query:   291 XXXXXXIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWI 350
                   IP  + ++  LS + ++   + G IP         L  +DL+ N LSG IP W+
Sbjct:   610 QLTGK-IPWTLGKIRELSLLDMSSNALTGTIP-LQLVLCKKLTHIDLNNNFLSGPIPPWL 667

Query:   351 GSLTQXXXXXXXXXXXXXXIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLT 410
             G L+Q              +P  + N   L++L L  N L GSI Q  +IG     G+L 
Sbjct:   668 GKLSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQ--EIGNL---GALN 722

Query:   411 YIDLSDNXXXXXXXXXXXXXXXXXXXXNLSRNVLEGQIPVSVGXXXXXXXXXX-XYNKLG 469
              ++L  N                     LSRN L G+IPV +G            YN   
Sbjct:   723 VLNLDKNQFSGSLPQAMGKLSKLYEL-RLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFT 781

Query:   470 YVLPGSLANESSLETLKLQNNRFTGRIPSEYXXXXXXXXXXXSHNLLVGEIPAGKPLSDF 529
               +P ++   S LETL L +N+ TG +P              S N L G++   K  S +
Sbjct:   782 GDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLGGKLK--KQFSRW 839

Query:   530 PESSFSGNRGLCGKPLTAC 548
             P  SF GN GLCG PL+ C
Sbjct:   840 PADSFLGNTGLCGSPLSRC 858
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0008544 "epidermis development" evidence=IGI
GO:0009790 "embryo development" evidence=IGI
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154463 AT5G23400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00100641
hypothetical protein (657 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query550
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-76
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-70
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-63
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-50
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN032101153 PLN03210, PLN03210, Resistant to P 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  259 bits (664), Expect = 2e-76
 Identities = 190/498 (38%), Positives = 262/498 (52%), Gaps = 28/498 (5%)

Query: 40  LKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSG-------TLSSSLGNLKNINQLL 92
           +  + L G  +SG +  +I +L  ++ ++L  N+LSG       T SSSL  L   N   
Sbjct: 71  VVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSN--- 127

Query: 93  MHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPP 152
              N FTG IP     + NL  LDL  N L+G IP  IG    L+ LD   N+L GK+P 
Sbjct: 128 ---NNFTGSIPRGS--IPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN 182

Query: 153 SLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRR 212
           SL NLT +  L L +N+L G I  P   GQM SL ++ L  NNL+G+IP   G L SL  
Sbjct: 183 SLTNLTSLEFLTLASNQLVGQI--PRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNH 240

Query: 213 VSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPL 272
           + L  N L G IP+SLGNL++L  L+L  N+LSG IP SI  L +LI L +S N + G +
Sbjct: 241 LDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEI 300

Query: 273 PSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPL 332
           P  +  LQNL+ L L  N      IP+ +  LP L  + L      G+IP+      + L
Sbjct: 301 PELVIQLQNLEILHLFSNNFT-GKIPVALTSLPRLQVLQLWSNKFSGEIPKNL-GKHNNL 358

Query: 333 QELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTG 392
             LDLS N+L+G IP  + S   L+ L L  NSL   IP+++   + L  + L  N  +G
Sbjct: 359 TVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSG 418

Query: 393 SISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSV 452
            +   F    + P   + ++D+S+N     I  +       ++ L+L+RN   G +P S 
Sbjct: 419 ELPSEF---TKLP--LVYFLDISNNNLQGRIN-SRKWDMPSLQMLSLARNKFFGGLPDSF 472

Query: 453 GRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLS 512
           G  R L +LDLS N+    +P  L + S L  LKL  N+ +G IP E    KKL  LDLS
Sbjct: 473 GSKR-LENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLS 531

Query: 513 HNLLVGEIPAGKPLSDFP 530
           HN L G+IPA    S+ P
Sbjct: 532 HNQLSGQIPAS--FSEMP 547

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 550
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.82
KOG4237498 consensus Extracellular matrix protein slit, conta 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
KOG0617264 consensus Ras suppressor protein (contains leucine 99.44
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.22
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
PLN03150623 hypothetical protein; Provisional 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.92
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.87
KOG4341483 consensus F-box protein containing LRR [General fu 98.76
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.75
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.72
PLN03150623 hypothetical protein; Provisional 98.72
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.69
KOG4341483 consensus F-box protein containing LRR [General fu 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.55
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.52
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.5
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.44
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.26
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.15
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.12
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.02
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.94
PRK15386 426 type III secretion protein GogB; Provisional 97.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.82
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.79
PRK15386 426 type III secretion protein GogB; Provisional 97.76
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.72
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.71
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.69
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.31
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.29
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.12
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.77
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.28
KOG4308 478 consensus LRR-containing protein [Function unknown 95.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.02
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.84
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.37
KOG4308 478 consensus LRR-containing protein [Function unknown 94.32
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.65
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.58
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.68
smart0037026 LRR Leucine-rich repeats, outliers. 88.68
KOG0473 326 consensus Leucine-rich repeat protein [Function un 84.65
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.83
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.53
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.87
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.26
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1e-54  Score=475.34  Aligned_cols=530  Identities=33%  Similarity=0.516  Sum_probs=461.4

Q ss_pred             CCCCCCccccccCcccEeeCCCCCCCCcCCCCCcc-CCCCCcEEeCCCccCCCCCchhhhhccCCcEEEcCCCcCCCccc
Q 008876            1 MKGSLSPSISLLTSLEVLDLGGLVDLTGIIPPSIG-CLQNLKKLYLYGNKLSGSVPESISKLLKLEELHLHENRLSGTLS   79 (550)
Q Consensus         1 ~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~-~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~   79 (550)
                      ++|.+|.+|..+++|++|++++| .+.+.+|..+. .+++|++|++++|.+++.+|.  ..+++|++|++++|.+....|
T Consensus        81 i~~~~~~~~~~l~~L~~L~Ls~n-~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p  157 (968)
T PLN00113         81 ISGKISSAIFRLPYIQTINLSNN-QLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIP  157 (968)
T ss_pred             ccccCChHHhCCCCCCEEECCCC-ccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCC
Confidence            35677888999999999999984 56666777654 899999999999988866664  457899999999998876778


Q ss_pred             ccccCCcccchhhccccccCccCchhccCCCCCCEEEcccccCccccchhhcCCCCcCeEeccCccccCcCCcccCCCCC
Q 008876           80 SSLGNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTV  159 (550)
Q Consensus        80 ~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~~~~  159 (550)
                      ..+..+++|++|++++|.+....|..+.++++|++|++++|.+....+..+..+++|+.|++++|.+.+..|..+..+++
T Consensus       158 ~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~  237 (968)
T PLN00113        158 NDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTS  237 (968)
T ss_pred             hHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCC
Confidence            88999999999999999988788888999999999999999888778888999999999999999888788888999999


Q ss_pred             CCEEEccCCcccccccCCCCCCCCCCccEEEcCCCcccccCCCCccCCCCCcEEEcccCcccCcchhhccCCCCCcEEEe
Q 008876          160 ISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYL  239 (550)
Q Consensus       160 L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l  239 (550)
                      |+.|++++|.+.+..  +..+..+++|+.|++++|.+....+..+..+++|++|++++|.+....+..+..+++|+.|++
T Consensus       238 L~~L~L~~n~l~~~~--p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l  315 (968)
T PLN00113        238 LNHLDLVYNNLTGPI--PSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHL  315 (968)
T ss_pred             CCEEECcCceecccc--ChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEEC
Confidence            999999999876543  367888999999999999888777778888999999999999988788888889999999999


Q ss_pred             cCccccCCCcccccCCCcccEEEccCCcccCCCCCcccCCCCccEEEccCCcccCCccchhcccCCCCcEEEeecccccc
Q 008876          240 NGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKG  319 (550)
Q Consensus       240 ~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  319 (550)
                      ++|.+....+..+..+++|+.|++++|.+....+..+..+++|+.|++++|.+... ++..+..+++|+.+++.+|.+.+
T Consensus       316 ~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~-~p~~~~~~~~L~~L~l~~n~l~~  394 (968)
T PLN00113        316 FSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGE-IPEGLCSSGNLFKLILFSNSLEG  394 (968)
T ss_pred             CCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEee-CChhHhCcCCCCEEECcCCEecc
Confidence            99988877777888899999999999998877888888889999999998876543 56677778899999999998887


Q ss_pred             cCCccccCCCCCccEEEcccccCCCCchhhhhccccccEEEccCCeeeccCCccccCCCCCcEEEccCCccccccccccc
Q 008876          320 KIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFK  399 (550)
Q Consensus       320 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~i~~~~~~~~~  399 (550)
                      ..+..+..... |+.|++++|.+++..+..+..+++|+.+++++|.+....+..+..+++|+.|++++|++....+..+.
T Consensus       395 ~~p~~~~~~~~-L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~  473 (968)
T PLN00113        395 EIPKSLGACRS-LRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG  473 (968)
T ss_pred             cCCHHHhCCCC-CCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccc
Confidence            77766665554 99999999999888888888999999999999999887777777899999999999988755444332


Q ss_pred             cCCCCCCCCeEEEeccCCCCCCCCCCCCCCCcccccEEeccCCcccCcCCcccccccccceeeCCCCccceeCCCcCCCC
Q 008876          400 IGQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANE  479 (550)
Q Consensus       400 ~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~l~~l~~L~~L~l~~n~i~~~~~~~l~~l  479 (550)
                            .++|+.|++++|.+.+..+. .+..+++|+.|++++|.+.+..|..+..+++|+.|+|++|.+++..|..+.++
T Consensus       474 ------~~~L~~L~ls~n~l~~~~~~-~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l  546 (968)
T PLN00113        474 ------SKRLENLDLSRNQFSGAVPR-KLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEM  546 (968)
T ss_pred             ------cccceEEECcCCccCCccCh-hhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCc
Confidence                  26899999999999876654 57789999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEEECcCccccccCCCcccCCCcCceeecCCccccccCCCCCCCCCccccCCCCCCCCCCCC
Q 008876          480 SSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKP  544 (550)
Q Consensus       480 ~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  544 (550)
                      ++|++|++++|.+.+.+|..+.++++|+.+++++|++.+.+|...++.++....+.|||.+|+-+
T Consensus       547 ~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        547 PVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             ccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            99999999999999999999999999999999999999999999888889999999999999854

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query550
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-27
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-27
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-27
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-27
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-17
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 2e-08
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 7e-08
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 7e-08
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 7e-07
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-06
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 4e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 5e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 5e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 5e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 104/337 (30%), Positives = 145/337 (43%), Gaps = 25/337 (7%)
Query: 88  INQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLR 147
           + +L +  N FTG IP + +N + LV L L  NYL+G IP  +G L  L  L    N+L 
Sbjct: 393 LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE 452
Query: 148 GKLPPSLCNLTVISVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYL 207
           G++P  L  +  +  L LD N L G I  PS      +L ++ L +N LTG+IP   G L
Sbjct: 453 GEIPQELMYVKTLETLILDFNDLTGEI--PSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 510
Query: 208 ASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQLSGQIPKXXXXXXXXXXXXXXRNQ 267
            +L  + L+NN   G IP  LG+ + L  L LN N  +G IP                 +
Sbjct: 511 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPA---------AMFKQSGK 561
Query: 268 IEGPLPSGMFSLQXXXXXXXXXXXXXXXXIPMWMAELPSLSRVYLAG-CGIKGKI----- 321
           I     +G   +                 +         L+R+     C I  ++     
Sbjct: 562 IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHT 621
Query: 322 -PEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQXXXXXXXXXXXXXXIPETITNLQDL 380
            P F       +  LD+S N LSG IP  IGS+                IP+ + +L+ L
Sbjct: 622 SPTF--DNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGL 679
Query: 381 VLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDN 417
            +LDL SNKL G I Q            LT IDLS+N
Sbjct: 680 NILDLSSNKLDGRIPQAMSALTM-----LTEIDLSNN 711
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query550
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-139
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-119
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-115
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-104
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-78
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-87
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-55
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-74
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-42
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-81
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-81
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-55
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-79
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-78
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-71
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-63
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-75
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-66
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-59
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-73
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-65
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-49
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-67
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-67
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-67
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-36
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-58
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-53
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-39
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-55
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-55
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-52
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-48
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-54
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-51
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-46
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-50
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-49
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-35
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-49
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-46
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-42
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-38
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-47
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-45
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-40
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-40
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-41
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-40
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-38
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-37
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-36
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-41
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-38
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-37
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-39
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-39
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-37
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-34
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-37
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-34
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-37
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-30
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-23
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-36
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-32
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-34
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-33
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-30
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-30
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-30
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-27
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-30
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-29
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-28
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-28
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-26
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-28
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-27
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-27
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-26
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-26
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-22
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-17
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-17
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-18
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-15
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-17
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  419 bits (1080), Expect = e-139
 Identities = 165/545 (30%), Positives = 253/545 (46%), Gaps = 16/545 (2%)

Query: 7   PSISLLTSLEVLDLGGLVDLTGIIPPSIGCLQNLKKLYLYGNKLSGSVPESISKLLKLEE 66
           P +   ++L+ LD+ G   L+G    +I     LK L +  N+  G +P     L  L+ 
Sbjct: 217 PFLGDCSALQHLDISGN-KLSGDFSRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQY 273

Query: 67  LHLHENRLSGTLSSSL-GNLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGY 125
           L L EN+ +G +   L G    +  L +  N F G +P  F + + L  L L  N  +G 
Sbjct: 274 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGE 333

Query: 126 IP-EKIGELQLLEQLDFSNNLLRGKLPPSLCNLTV-ISVLYLDNNKLEGAIPFPSSPGQM 183
           +P + + +++ L+ LD S N   G+LP SL NL+  +  L L +N   G I         
Sbjct: 334 LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 393

Query: 184 PSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPTSLGNLQDLTELYLNGNQ 243
            +L  L LQ+N  TGKIPPT    + L  + L+ N L G IP+SLG+L  L +L L  N 
Sbjct: 394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 453

Query: 244 LSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNLSSIPMWMAE 303
           L G+IP+ +  +  L  L +  N + G +PSG+ +  NL  + LS N L    IP W+  
Sbjct: 454 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLT-GEIPKWIGR 512

Query: 304 LPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSR 363
           L +L+ + L+     G IP       S L  LDL+ N  +G+IPA +   +      ++ 
Sbjct: 513 LENLAILKLSNNSFSGNIPAELGDCRS-LIWLDLNTNLFNGTIPAAMFKQSGK----IAA 567

Query: 364 NSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGI 423
           N +       I N           N L     +  ++ +     +    +++   +  G 
Sbjct: 568 NFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNR---LSTRNPCNITSRVY-GGH 623

Query: 424 ELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLE 483
                     + FL++S N+L G IP  +G +  L  L+L +N +   +P  + +   L 
Sbjct: 624 TSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLN 683

Query: 484 TLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGK 543
            L L +N+  GRIP     L  L E+DLS+N L G IP       FP + F  N GLCG 
Sbjct: 684 ILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGY 743

Query: 544 PLTAC 548
           PL  C
Sbjct: 744 PLPRC 748
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query550
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.5
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.35
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.3
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.13
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.48
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.46
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.33
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.84
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.43
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.24
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 83.37
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-59  Score=500.45  Aligned_cols=528  Identities=31%  Similarity=0.464  Sum_probs=394.2

Q ss_pred             cccccCcccEeeCCCCCCCCcCCCCCc-cCCCCCcEEeCCCccCCCCCchh---hhhccCCcEEEcCCCcCCCccccccc
Q 008876            8 SISLLTSLEVLDLGGLVDLTGIIPPSI-GCLQNLKKLYLYGNKLSGSVPES---ISKLLKLEELHLHENRLSGTLSSSLG   83 (550)
Q Consensus         8 ~~~~~~~L~~L~l~~~~~~~~~~~~~l-~~l~~L~~L~l~~~~~~~~~~~~---~~~l~~L~~L~l~~~~~~~~~~~~~~   83 (550)
                      .++++++|++|++++| .+.+..|..+ .++++|++|++++|.+++..+..   +.++++|++|++++|.+....+  +.
T Consensus       121 ~l~~l~~L~~L~Ls~n-~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~  197 (768)
T 3rgz_A          121 SLGSCSGLKFLNVSSN-TLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VS  197 (768)
T ss_dssp             GGGGCTTCCEEECCSS-EEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--CT
T ss_pred             HHhCCCCCCEEECcCC-ccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC--cc
Confidence            4444444444444442 2222333322 44445555555555444333333   3445555555555555432222  36


Q ss_pred             CCcccchhhccccccCccCchhccCCCCCCEEEcccccCccccchhhcCCCCcCeEeccCccccCcCCcccCCCCCCCEE
Q 008876           84 NLKNINQLLMHTNQFTGVIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVISVL  163 (550)
Q Consensus        84 ~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L  163 (550)
                      .+++|++|++++|.+....|. +..+++|++|++++|.+....+..+..+++|++|++++|.+.+..|..  .+++|++|
T Consensus       198 ~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L  274 (768)
T 3rgz_A          198 RCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYL  274 (768)
T ss_dssp             TCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEE
T ss_pred             cCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEE
Confidence            778888888888888766665 888999999999999888777888889999999999988877555543  77888888


Q ss_pred             EccCCcccccccCCCCCCC-CCCccEEEcCCCcccccCCCCccCCCCCcEEEcccCcccCcchh-hccCCCCCcEEEecC
Q 008876          164 YLDNNKLEGAIPFPSSPGQ-MPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKLEGAIPT-SLGNLQDLTELYLNG  241 (550)
Q Consensus       164 ~l~~~~~~~~~~~~~~~~~-~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~-~l~~~~~L~~L~l~~  241 (550)
                      ++++|.+.+..+  ..+.. +++|++|++++|.+....+..++.+++|++|++++|.+.+..+. .+..+++|++|++++
T Consensus       275 ~L~~n~l~~~ip--~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~  352 (768)
T 3rgz_A          275 SLAENKFTGEIP--DFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF  352 (768)
T ss_dssp             ECCSSEEEESCC--CCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCS
T ss_pred             ECcCCccCCccC--HHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcC
Confidence            888887764433  44444 47888888888887767777777788888888888877644443 367777777777777


Q ss_pred             ccccCCCcccccC---------------------------CCcccEEEccCCcccCCCCCcccCCCCccEEEccCCcccC
Q 008876          242 NQLSGQIPKSISQ---------------------------LSQLIFLSISRNQIEGPLPSGMFSLQNLQTLDLSFNLLNL  294 (550)
Q Consensus       242 ~~~~~~~~~~l~~---------------------------~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  294 (550)
                      |.+....+..+..                           +++|+.|++++|.++...+..+..+++|+.|++++|.+..
T Consensus       353 n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~  432 (768)
T 3rgz_A          353 NEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG  432 (768)
T ss_dssp             SEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEES
T ss_pred             CccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccC
Confidence            7665333333333                           3455666666665555556666667777777777776543


Q ss_pred             CccchhcccCCCCcEEEeecccccccCCccccCCCCCccEEEcccccCCCCchhhhhccccccEEEccCCeeeccCCccc
Q 008876          295 SSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETI  374 (550)
Q Consensus       295 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l  374 (550)
                      . .+..+..+++|+.|++++|.+.+..+..+..... |+.|++++|.+.+..+..+..+++|+.|++++|.+.+..+..+
T Consensus       433 ~-~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~-L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~  510 (768)
T 3rgz_A          433 T-IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT-LETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWI  510 (768)
T ss_dssp             C-CCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTT-CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG
T ss_pred             c-ccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCC-ceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHH
Confidence            3 5666777778888888888777666666655544 8888888888887777788888888888888888887778888


Q ss_pred             cCCCCCcEEEccCCccccccccccccCCCCCCCCeEEEeccCCCCCCCCCCC----------------------------
Q 008876          375 TNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYIDLSDNGFSSGIELT----------------------------  426 (550)
Q Consensus       375 ~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~----------------------------  426 (550)
                      ..+++|++|++++|++....+..+...     ++|+.|++++|.+.+.++..                            
T Consensus       511 ~~l~~L~~L~L~~N~l~~~~p~~l~~l-----~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  585 (768)
T 3rgz_A          511 GRLENLAILKLSNNSFSGNIPAELGDC-----RSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKK  585 (768)
T ss_dssp             GGCTTCCEEECCSSCCEEECCGGGGGC-----TTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCT
T ss_pred             hcCCCCCEEECCCCcccCcCCHHHcCC-----CCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccc
Confidence            888888888888888876666655544     78999999988876544421                            


Q ss_pred             -----------------------------------------CCCCcccccEEeccCCcccCcCCcccccccccceeeCCC
Q 008876          427 -----------------------------------------GGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSY  465 (550)
Q Consensus       427 -----------------------------------------~~~~~~~L~~L~l~~~~i~~~~~~~l~~l~~L~~L~l~~  465 (550)
                                                               .+..+++|+.|++++|.+++.+|..+..+++|+.|+|++
T Consensus       586 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~  665 (768)
T 3rgz_A          586 ECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGH  665 (768)
T ss_dssp             TCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCS
T ss_pred             cccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcC
Confidence                                                     234467899999999999999999999999999999999


Q ss_pred             CccceeCCCcCCCCCCCcEEECcCccccccCCCcccCCCcCceeecCCccccccCCCCCCCCCccccCCCCCCCCCCCCC
Q 008876          466 NKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPL  545 (550)
Q Consensus       466 n~i~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~  545 (550)
                      |.+++.+|..+.++++|++|++++|.+++.+|..+.++++|++|++++|++++.+|.+.++..++...+.|||++|+.++
T Consensus       666 N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l  745 (768)
T 3rgz_A          666 NDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPL  745 (768)
T ss_dssp             SCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTS
T ss_pred             CccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCC
Q 008876          546 TACRA  550 (550)
Q Consensus       546 ~~~~~  550 (550)
                      ..|.+
T Consensus       746 ~~C~~  750 (768)
T 3rgz_A          746 PRCDP  750 (768)
T ss_dssp             CCCCS
T ss_pred             cCCCC
Confidence            99974
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 550
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-24
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-23
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-09
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-08
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-08
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score =  102 bits (253), Expect = 4e-24
 Identities = 76/414 (18%), Positives = 143/414 (34%), Gaps = 45/414 (10%)

Query: 101 VIPDSFTNLTNLVRLDLHCNYLNGYIPEKIGELQLLEQLDFSNNLLRGKLPPSLCNLTVI 160
           +  D+   L   ++  L    +   + +   +L  +  L      +  K    +  L  +
Sbjct: 15  IFTDT--ALAEKMKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGI--KSIDGVEYLNNL 68

Query: 161 SVLYLDNNKLEGAIPFPSSPGQMPSLGFLRLQDNNLTGKIPPTFGYLASLRRVSLANNKL 220
           + +   NN+L    P       +  L  + + +N +    P       +   +       
Sbjct: 69  TQINFSNNQLTDITPL----KNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQIT- 123

Query: 221 EGAIPTSLGNLQDLTELYLNGNQLSGQIPKSISQLSQLIFLSISRNQIEGPLPSGMFSLQ 280
                             L           +IS +S L  L+  +    G   + +  L 
Sbjct: 124 -----------DIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLA 172

Query: 281 NLQTLDLSFNLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQELDLSVN 340
           NL TL+      N  S    +A+L +L  +      I    P    T    L EL L+ N
Sbjct: 173 NLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTN---LDELSLNGN 229

Query: 341 HLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKI 400
            L       + SLT L  L+L+ N + +  P  ++ L  L  L L +N+++         
Sbjct: 230 QLKD--IGTLASLTNLTDLDLANNQISNLAP--LSGLTKLTELKLGANQISNIS------ 279

Query: 401 GQRFPDGSLTYIDLSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRS 460
               P   LT +   +   +   +++       + +L L  N +    PV    L  L+ 
Sbjct: 280 ----PLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPV--SSLTKLQR 333

Query: 461 LDLSYNKLGYVLPGSLANESSLETLKLQNNRFTGRIPSEYLKLKKLKELDLSHN 514
           L  + NK+      SLAN +++  L   +N+ +   P     L ++ +L L+  
Sbjct: 334 LFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTPLA--NLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query550
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.05
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.95
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.78
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.12
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.94  E-value=5.7e-26  Score=213.12  Aligned_cols=260  Identities=31%  Similarity=0.520  Sum_probs=170.7

Q ss_pred             cccEEEccCCcccC--CCCCcccCCCCccEEEccC-CcccCCccchhcccCCCCcEEEeecccccccCCccccCCCCCcc
Q 008876          257 QLIFLSISRNQIEG--PLPSGMFSLQNLQTLDLSF-NLLNLSSIPMWMAELPSLSRVYLAGCGIKGKIPEFFRTTPSPLQ  333 (550)
Q Consensus       257 ~L~~L~l~~~~~~~--~~~~~~~~~~~L~~L~l~~-~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~  333 (550)
                      .++.|+++++.+..  .++..+..+++|++|++++ |.+.. .++..+..+++|++|++++|.+.+..+           
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g-~iP~~i~~L~~L~~L~Ls~N~l~~~~~-----------  118 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVG-PIPPAIAKLTQLHYLYITHTNVSGAIP-----------  118 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEES-CCCGGGGGCTTCSEEEEEEECCEEECC-----------
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCcccccccccccccccc-ccccccccccccchhhhcccccccccc-----------
Confidence            45556666555443  2444555555555555554 22222 244555555555555555555444333           


Q ss_pred             EEEcccccCCCCchhhhhccccccEEEccCCeeeccCCccccCCCCCcEEEccCCccccccccccccCCCCCCCCeEEEe
Q 008876          334 ELDLSVNHLSGSIPAWIGSLTQLYSLNLSRNSLVSSIPETITNLQDLVLLDLHSNKLTGSISQVFKIGQRFPDGSLTYID  413 (550)
Q Consensus       334 ~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~~~~~L~~L~  413 (550)
                                    ..+..++.|+.++++.|.+....+..+..++.++++++++|.+....+..+....    ..++.+.
T Consensus       119 --------------~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~----~l~~~l~  180 (313)
T d1ogqa_         119 --------------DFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFS----KLFTSMT  180 (313)
T ss_dssp             --------------GGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCC----TTCCEEE
T ss_pred             --------------ccccchhhhcccccccccccccCchhhccCcccceeecccccccccccccccccc----ccccccc
Confidence                          3444444455555555544444444444555555555555544433222222110    1234455


Q ss_pred             ccCCCCCCCCCCCCCCCcccccEEeccCCcccCcCCcccccccccceeeCCCCccceeCCCcCCCCCCCcEEECcCcccc
Q 008876          414 LSDNGFSSGIELTGGGGQTGIRFLNLSRNVLEGQIPVSVGRLRSLRSLDLSYNKLGYVLPGSLANESSLETLKLQNNRFT  493 (550)
Q Consensus       414 l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~l~~l~~L~~L~l~~n~i~~~~~~~l~~l~~L~~L~l~~~~~~  493 (550)
                      +++|++.+..+. .+..+ ....+++.++...+..+..+..+++++.+++++|.+....+ .+..+++|+.|++++|.++
T Consensus       181 ~~~n~l~~~~~~-~~~~l-~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~  257 (313)
T d1ogqa_         181 ISRNRLTGKIPP-TFANL-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIY  257 (313)
T ss_dssp             CCSSEEEEECCG-GGGGC-CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCE
T ss_pred             cccccccccccc-ccccc-ccccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeec
Confidence            555544432221 22222 34468888888888888888999999999999999986554 5778899999999999999


Q ss_pred             ccCCCcccCCCcCceeecCCccccccCCCCCCCCCccccCCCCCCCCCCCCCCCCC
Q 008876          494 GRIPSEYLKLKKLKELDLSHNLLVGEIPAGKPLSDFPESSFSGNRGLCGKPLTACR  549 (550)
Q Consensus       494 ~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~  549 (550)
                      +.+|..+.++++|++|++++|.+++++|....+.+++.+++.||+.+|+.|+-+||
T Consensus       258 g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         258 GTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             ECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSSCCC
T ss_pred             ccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCCCCC
Confidence            99999999999999999999999999999888999999999999999999999997
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure