Citrus Sinensis ID: 008882


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550
MSRRGGGGRRPDSRRDQPTQAPAPSFQRGGGGAAGPPGRGRQGQRGGTGRGLHSGSDAAPSSPHTASTSTSPAPSSPSVSASSPSSSSVSTLVEETEQKLALAAPAAATLPPSSSQAMRLPVRPGFGTVGRKCVVRANHFMVQLAERDIHHYDVFNPRPVIPISSSNPNQIEKALVDVHNRTTQQGKQLQLLIIILPDVSGSYGRIKRVCETELGIVSQCCQPRQASRLNIPYFENVALKINVKVGGRNTVLVDAVQKRIPLVTDRPTIIFGSDVTHPQPGEDSSPSIAAVVASMDWPEVTKYRGLVSAQAHNQEIIQDLYKSTQDPFGGSVHGGMIRELLIAFRRSTNLKPHRIIFYRDGVGEGQFSQVLLHEMSAIRQACASLEEGYAPPVTFVVVQKRHHTRLFPAEHNNRDLTDRSGNILPGTVVDTQICHPTQFDFYLNSHAGIRGTSRPIHYHVLYDENRFSADDLQVLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIEDETSAGGSTGGSRSTADRNLAIRPLPVIKDNVKDVMFYC
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccEEccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHcccccccEECcccccccccHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEECcccccccccccccEEEEEEECccccccEEEEEEEEcccccHHHHcHHccccccccccccHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccccccccccccccccccccCEEcccccccccccEEEEcccccccccccccEEEEEccccccHHHHHHHHHHHHHccccccccCCccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEc
*********************************************************************************************************************MRLPVRPGFGTVGRKCVVRANHFMVQLAERDIHHYDVFNPRPVIPISSSNPNQIEKALVDVHNRTTQQGKQLQLLIIILPDVSGSYGRIKRVCETELGIVSQCCQPRQASRLNIPYFENVALKINVKVGGRNTVLVDAVQKRIPLVTDRPTIIFGSDVTHPQPGEDSSPSIAAVVASMDWPEVTKYRGLVSAQAHNQEIIQDLYKSTQDPFGGSVHGGMIRELLIAFRRSTNLKPHRIIFYRDGVGEGQFSQVLLHEMSAIRQACASLEEGYAPPVTFVVVQKRHHTRLFPAE*********SGNILPGTVVDTQICHPTQFDFYLNSHAGIRGTSRPIHYHVLYDENRFSADDLQVLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIE**************************VIKDNVKDVMFYC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRGGGGRRPDSRRDQPTQAPAPSFQRGGGGAAGPPGRGRQGQRGGTGRGLHSGSDAAPSSPHTASTSTSPAPSSPSVSASSPSSSSVSTLVEETEQKLALAAPAAATLPPSSSQAMRLPVRPGFGTVGRKCVVRANHFMVQLAERDIHHYDVFNPRPVIPISSSNPNQIEKALVDVHNRTTQQGKQLQLLIIILPDVSGSYGRIKRVCETELGIVSQCCQPRQASRLNIPYFENVALKINVKVGGRNTVLVDAVQKRIPLVTDRPTIIFGSDVTHPQPGEDSSPSIAAVVASMDWPEVTKYRGLVSAQAHNQEIIQDLYKSTQDPFGGSVHGGMIRELLIAFRRSTNLKPHRIIFYRDGVGEGQFSQVLLHEMSAIRQACASLEEGYAPPVTFVVVQKRHHTRLFPAEHNNRDLTDRSGNILPGTVVDTQICHPTQFDFYLNSHAGIRGTSRPIHYHVLYDENRFSADDLQVLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARYYIEDETSAGGSTGGSRSTADRNLAIRPLPVIKDNVKDVMFYC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein argonaute 5 Involved in RNA-mediated post-transcriptional gene silencing (PTGS). Main component of the RNA-induced silencing complex (RISC) that binds to a short guide RNA such as a microRNA (miRNA) or small interfering RNA (siRNA). RISC uses the mature miRNA or siRNA as a guide for slicer-directed cleavage of homologous mRNAs to repress gene expression. Associates with siRNAs of various sizes, from 21-24 nucleotide in length and preferentially recruits small RNAs with a 5' terminal cytosine. Probably involved in antiviral RNA silencing. Associates with siRNAs derived from cucumber mosaic virus (CMV). Targeted by the turnip yellows virus (TuYV) protein P0 (via F-box-like domain) for probable proteasome degradation and thereby inactivating AGO5 function in RNA silencing.probableQ9SJK3
Protein argonaute MEL1 Essential for the progression of premeiotic mitosis and meiosis during sporogenesis. Regulates the cell division of premeiotic germ cells, the proper modification of meiotic chromosomes, and the faithful progression of meiosis, probably via small RNA-mediated gene silencing. May be involved in histone H3 'Lys-9' demethylation in the pericentromeric region.probableQ851R2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F3T, chain A
Confidence level:very confident
Coverage over the Query: 137-320,334-513,527-550
View the alignment between query and template
View the model in PyMOL
Template: 4F3T, chain A
Confidence level:confident
Coverage over the Query: 118-158
View the alignment between query and template
View the model in PyMOL