Citrus Sinensis ID: 008934


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55
MITEPLLINKNPKGGLRTLPFIIANEAFERMATVGFTPNMILYLCREYNMETTAATNIIFIWTAATNFLPIVGALLADSYVGRYRMIGFGCFTCLLGMVLLWSTTILPGAKPPACDQLRNGCESATWSQLMPLYFAFGLMSLGSGGIRSSSLAFGAEQLDKGDGTKSKGALQSYFSWYYVFVSASSIVAVTCIVYIQDNLGWKVGFGVPAVIMLLSALSFFLASPFYVKSKANTSLLPGLTQVLVASFKNRRTKLPTQATEEMYHHGKGSMRLMPSENLRFLNKACMAKHPEQDLTPDGRASNPNSLCTVEQVEELKALIKASSMDRHVTPNFEIPSGSFNIFAILTLTIWIGLYDRAVLPLASKIKGKPCQLSLKLRMGIGLLFSTASMTAWAIVEAARRSIAINEGISDDLRAVVQMSAMWQLPYLVLSGLAMAFNMIGQTEFYYTELPKSMSSIASTLSGAGLSAANLVASLIMNAVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPFKGRVGTAFDDKDGMEEEC
ccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHEEEEEEEEEcccccHccHHHHHHHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHccccccccccHHHcccccccccccccccccccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccCCcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccccccc
************KGGLRTLPFIIANEAFERMATVGFTPNMILYLCREYNMETTAATNIIFIWTAATNFLPIVGALLADSYVGRYRMIGFGCFTCLLGMVLLWSTTILPGAKPPACDQLRNGCESATWSQLMPLYFAFGLMSLGSGGIRSSSLAFGAEQLDK*******GALQSYFSWYYVFVSASSIVAVTCIVYIQDNLGWKVGFGVPAVIMLLSALSFFLASPFYVKSKANTSLLPGLTQVLVASFKNRRT***********************ENLRFLNKACMAKHPEQDLTPDGRASNPNSLCTVEQVEELKALIKASSMDRHVTPNFEIPSGSFNIFAILTLTIWIGLYDRAVLPLASKIKGKPCQLSLKLRMGIGLLFSTASMTAWAIVEAARRSIAINEGISDDLRAVVQMSAMWQLPYLVLSGLAMAFNMIGQTEFYYTELPKSMSSIASTLSGAGLSAANLVASLIMNAVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPFKG****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITEPLLINKNPKGGLRTLPFIIANEAFERMATVGFTPNMILYLCREYNMETTAATNIIFIWTAATNFLPIVGALLADSYVGRYRMIGFGCFTCLLGMVLLWSTTILPGAKPPACDQLRNGCESATWSQLMPLYFAFGLMSLGSGGIRSSSLAFGAEQLDKGDGTKSKGALQSYFSWYYVFVSASSIVAVTCIVYIQDNLGWKVGFGVPAVIMLLSALSFFLASPFYVKSKANTSLLPGLTQVLVASFKNRRTKLPTQATEEMYHHGKGSMRLMPSENLRFLNKACMAKHPEQDLTPDGRASNPNSLCTVEQVEELKALIKASSMDRHVTPNFEIPSGSFNIFAILTLTIWIGLYDRAVLPLASKIKGKPCQLSLKLRMGIGLLFSTASMTAWAIVEAARRSIAINEGISDDLRAVVQMSAMWQLPYLVLSGLAMAFNMIGQTEFYYTELPKSMSSIASTLSGAGLSAANLVASLIMNAVDDITKRGGNGGWIPSNINKGHYDYYYWLLTALSMANFLYYLACCKAYGPFKGRVGTAFDDKDGMEEEC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable peptide transporter At1g52190 probableQ9M817

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XUT, chain A
Confidence level:very confident
Coverage over the Query: 18-105,128-231,252-288,302-358,374-399,410-506
View the alignment between query and template
View the model in PyMOL
Template: 4APS, chain A
Confidence level:confident
Coverage over the Query: 15-105,129-289,303-483,501-508
View the alignment between query and template
View the model in PyMOL
Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 51-285,307-398,417-539
View the alignment between query and template
View the model in PyMOL