Citrus Sinensis ID: 008955

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------

MATSATGQPQFIASTGGNRSFSNAPLIKNEDADQIVVPDKTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAANLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIGVLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKSICKEACRFYMIESGFALAVAFLINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASMILSFELPFALVPLLKFTSSKVKMGMHANSIAITAITWIIGSLIMIINVYYLATSFIKFLFHGNLKLVEVVFLGIFGFSAMAVYLAGVAYLVLRKNKEASHLLALTTHENQHSTNESGNASLYSLPREDIASMQLPSRSGTVDID

ccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHEEECcccHHHHHccccccccccccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccccccccccccccccccccccccccccccccccccccc

*******************************ADQIVVPDKTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAANLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIGVLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKSICKEACRFYMIESGFALAVAFLINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASMILSFELPFALVPLLKFTSSKVKMGMHANSIAITAITWIIGSLIMIINVYYLATSFIKFLFHGNLKLVEVVFLGIFGFSAMAVYLAGVAYLVLRKNKEASHLLAL*********************REDIAS*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Metal transporter Nramp1	High affinity manganese (Mn) transporter involved in Mn acquisition from the soil. Required for Mn uptake into the root in conditions of low Mn availability. Can transport iron (Fe), cadmium (Cd) and cobalt (Co).	confident	Q9SAH8
Metal transporter Nramp3	Probable metal transporter.	confident	Q653V6
Metal transporter Nramp6	Probable intracellular cadmium (Cd) transporter that participates in the distribution or availability of Cd within the cell.	probable	Q9S9N8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JLN, chain A
Confidence level:confident
Coverage over the Query: 24-189
View the alignment between query and template
View the model in PyMOL

Template: 3GIA, chain A
Confidence level:probable
Coverage over the Query: 318-356
View the alignment between query and template
View the model in PyMOL