Citrus Sinensis ID: 009009

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540------
MAGQRNSYGKRSHSQTDYADHGPNKRRYTGDDRDQFIIGPEDTVYRYLCPIRKIGSIIGRGGEIVKQLRIDTKSKIRIGETVPGSEERVVTVYSASDETNAFEDGDKFVSPAQDALFKVHDRVIAEELRGDEDSDGGHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIASRLHDNPSRSQHLLASAISNSHSSSGSLVGPTAATPIVGIAPLMGPYGGYKGDTAGDWSRSLYSAPRDDLSSKEFSLRLVCPVANIGGVIGKGGAIINQIRQESGAAIKVDSSSTEGDDCLITVSSKEFFEDTLSATIEAVVRLQPRCSEKIERDSGLISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRANLFDREGAVSTFVPVLPYIPVSENGSDGLNYESRDSKRHGRGPPYGGYGSSDLAAGDSYGSYGSSQLGGTGSAYGSYGSYSSGRSGSGLSSHAPVSRRKSYY
ccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccEEEEEccccHHHHHHHHHccccEEEcccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEcccEEEEcccccHHHHHHHHHHcccEEEEccccccccccccccEEEEEccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccHHHHHHHHcccEEEcccccccccccEEEEcccHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEcccEEEEEcccccHHHHHHHHHccEEEEEcccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEccccHHHHHHHHHcccEEEEccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccccEEEEEccccHHHHHHHHHcccEEEEEccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEcccccHHHHHHHHcccEEEEccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccEEEEEcccccHHHHHHHHcccEEEEEcccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHHHHHccccc
magqrnsygkrshsqtdyadhgpnkrrytgddrdqfiigpedtvyrylcpirkigsiigrggEIVKQLRIdtkskirigetvpgseeRVVTVYsasdetnafedgdkfvspaQDALFKVHDRVIAeelrgdedsdgghqvtakllvpsdqigcvigkggqiVQNIRSETGAQIRIlkdehlpscalrsdeLVQISGEASVVKKALCQIAsrlhdnpsrSQHLLASAIsnshsssgslvgptaatpivgiaplmgpyggykgdtagdwsrslysaprddlsskefslrlvcpvaniggvigkggAIINQIRQEsgaaikvdssstegddclitvsskefFEDTLSATIEAVVRLQprcsekierdsglisfttrllvptsrigcligkggsIITEMRRLTKANIrilpkenlpkiaseddemvQISGDLDLAKDALIQVMTRLRANLfdregavstfvpvlpyipvsengsdglnyesrdskrhgrgppyggygssdlaagdsygsygssqlggtgsaygsygsyssgrsgsglsshapvsrrksyy
magqrnsygkrshsqtdyadhgpnkrrytgddrdqfiigpedtvyryLCPIRKigsiigrggeivkqlridtkskirigetvpgseervvTVYSASDETNAFEDGDKFVSPAQDALFKVHDRVIAEElrgdedsdggHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIASRLHDNPSRSQHLLASAISNSHSSSGSLVGPTAATPIVGIAPLMGPYGGYKGDTAGDWSRSLYSAPRDDLSSKEFSLRLVCPVANIGGVIGKGGAIINQIRQESGAaikvdssstegdDCLITVSSKEFFEDTLSATIEAVVrlqprcsekierdsglisfttrllvptsrigcligkggsiiTEMRRLTKAnirilpkenlpkiaseddEMVQISGDLDLAKDALIQVMTRLRANLFDREGAVstfvpvlpyipvsengsdglNYESRDSKRHGRGPPYGGYGSSDLAAGDSYGSYGSSQLGGTGSAYGSYGSYssgrsgsglsshapvsrrksyy
MAGQRNSYGKRSHSQTDYADHGPNKRRYTGDDRDQFIIGPEDTVYRYLCPirkigsiigrggeiVKQLRIDTKSKIRIGETVPGSEERVVTVYSASDETNAFEDGDKFVSPAQDALFKVHDRVIAEELRGDEDSDGGHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIASRLHDNPSRSQHLLAsaisnshsssgsLVGPTAATPIVGIAPLMGPYGGYKGDTAGDWSRSLYSAPRDDLSSKEFSLRLVCPvaniggvigkggaiinQIRQESGAAIKVDSSSTEGDDCLITVSSKEFFEDTLSATIEAVVRLQPRCSEKIERDSGLISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRANLFDREGAVSTFVPVLPYIPVSENGSDGLNYESRDSKrhgrgppyggygssDLAAgdsygsygssqlggtgsaygsygsyssgrsgsglssHAPVSRRKSYY
*********************************DQFIIGPEDTVYRYLCPIRKIGSIIGRGGEIVKQLRIDTKSKIRIGETVP***ERVVTVYS*******************DALFKVHDRV******************AKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIA*******************************TAATPIVGIAPLMGPYGGYKGDTAGDWSRSLYS********KEFSLRLVCPVANIGGVIGKGGAIINQIRQESGAAI*********DDCLITVSSKEFFEDTLSATIEAVVRLQPRCSEKIERDSGLISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRILPKENLP*I******MVQISGDLDLAKDALIQVMTRLRANLFDREGAVSTFVPVLPYIPV*********************************************************************************
*******************************************VYRYLCPIRKIGSIIGRGGEIVKQLRIDTKSKIRIGETVPGSEERVVTVYSASDETNAFEDGDKFVSPAQDALFKV**********************AKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIASRLHDNPSRSQHLLASAISNSHSSSGSLV*******************************************KEFSLRLVCPVANIGGVIGKGGAIIN************************************SA*************************TTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRIL*KE****IASEDDEMVQISGDLDLAKDALIQVMTRLRA******************************************************************************************************
*******************DHGPNKRRYTGDDRDQFIIGPEDTVYRYLCPIRKIGSIIGRGGEIVKQLRIDTKSKIRIGETVPGSEERVVTVYSASDETNAFEDGDKFVSPAQDALFKVHDRVIAEELR********HQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIASRLHDNPSRSQHLLASAI***********GPTAATPIVGIAPLMGPYGGYKGDTAGDWSRSLYSAPRDDLSSKEFSLRLVCPVANIGGVIGKGGAIINQIRQESG***********GDDCLITVSSKEFFEDTLSATIEAVVRLQPRCSEKIERDSGLISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRANLFDREGAVSTFVPVLPYIPVSENGSDGLNYESRDSKRHGRGPPYGGYGSSDLAAGDSYGSYGSSQLGGTGSAYGSYGS***********************
***************************************PEDTVYRYLCPIRKIGSIIGRGGEIVKQLRIDTKSKIRIGETVPGSEERVVTVYSASDETNAFEDGDKFVSPAQDALFKVHDRVIAEEL********GHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIASRLHDNPS*SQHLLASAISNSHSSSGSLVGPTAATPIVGIAPLMGPYGGYKGDTAG***************SKEFSLRLVCPVANIGGVIGKGGAIINQIRQESGAAIKVDSSSTEGDDCLITVSSKEFFEDTLSATIEAVVRLQPRCSEKIERDSGLISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRANLFDREGAVSTFVPVLPYIPVSENGSDGLNYESRDSKRHGRGPPYGGYGSSDLAAGDSYGSYGSSQLGGTGSAYGSYGSYSSGRSGSGLSSHAPVSRRK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGQRNSYGKRSHSQTDYADHGPNKRRYTGDDRDQFIIGPEDTVYRYLCPIRKIGSIIGRGGEIVKQLRIDTKSKIRIGETVPGSEERVVTVYSASDETNAFEDGDKFVSPAQDALFKVHDRVIAEELRGDEDSDGGHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIASRLHDNPSRSQHLLASAISNSHSSSGSLVGPTAATPIVGIAPLMGPYGGYKGDTAGDWSRSLYSAPRDDLSSKEFSLRLVCPVANIGGVIGKGGAIINQIRQESGAAIKVDSSSTEGDDCLITVSSKEFFEDTLSATIEAVVRLQPRCSEKIERDSGLISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRANLFDREGAVSTFVPVLPYIPVSENGSDGLNYESRDSKRHGRGPPYGGYGSSDLAAGDSYGSYGSSQLGGTGSAYGSYGSYSSGRSGSGLSSHAPVSRRKSYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query546 2.2.26 [Sep-21-2011]
P58223606 KH domain-containing prot no no 0.895 0.806 0.321 1e-55
O00425579 Insulin-like growth facto yes no 0.652 0.614 0.227 4e-16
Q5RB68556 Insulin-like growth facto no no 0.578 0.568 0.242 4e-15
Q5SF07592 Insulin-like growth facto yes no 0.637 0.587 0.243 1e-14
Q9PW80582 Insulin-like growth facto no no 0.644 0.604 0.235 4e-14
P57721371 Poly(rC)-binding protein no no 0.481 0.708 0.275 5e-14
Q9CPN8579 Insulin-like growth facto no no 0.650 0.613 0.227 6e-14
P57722371 Poly(rC)-binding protein no no 0.481 0.708 0.275 7e-14
Q9UNW9492 RNA-binding protein Nova- no no 0.380 0.422 0.254 2e-13
Q9Y6M1599 Insulin-like growth facto no no 0.637 0.580 0.235 4e-13
>sp|P58223|Y4837_ARATH KH domain-containing protein At4g18375 OS=Arabidopsis thaliana GN=At4g18375 PE=2 SV=1 Back     alignment and function desciption
 Score =  218 bits (554), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 179/556 (32%), Positives = 286/556 (51%), Gaps = 67/556 (12%)

Query: 10  KRSHSQTDYADHGPNKRRYTGDDRDQFIIGPEDTVYRYLCPIRKIGSIIGRGGEIVKQLR 69
           KR   Q + ++   N++R    D+   I   E  VYR LCPI  +G +IG+ G+++  +R
Sbjct: 6   KRKQIQRNNSESNRNQKRRISHDK---INRDELVVYRILCPIDVVGGVIGKSGKVINAIR 62

Query: 70  IDTKSKIRIGETVPGSEERVVTVYSA----SDETNAFEDGDKFVSPAQDALFKVHDRVIA 125
            +TK+KI++ + + G  +RV+T+Y +     +E    +  ++ +  AQDAL KV+D ++A
Sbjct: 63  HNTKAKIKVFDQLHGCSQRVITIYCSVKEKQEEIGFTKSENEPLCCAQDALLKVYDAIVA 122

Query: 126 --EELRGDEDSDGGHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRIL-KDEHLP 182
             EE     + D       +LLVP  Q   +IGK G+ ++ IR  T A ++++ KD   P
Sbjct: 123 SDEENNTKTNVDRDDNKECRLLVPFSQSSSLIGKAGENIKRIRRRTRASVKVVSKDVSDP 182

Query: 183 S--CALRSDELVQISGEASVVKKALCQIASRLHD-NP-------SRSQHLLASAI----- 227
           S  CA+  D +V ISGE   VK+AL  +++ ++  NP       S SQ + A+++     
Sbjct: 183 SHVCAMEYDNVVVISGEPESVKQALFAVSAIMYKINPRENIPLDSTSQDVPAASVIVPSD 242

Query: 228 -SNS-------HSSSGSLVGPTAATPIVGIAPLMGPYGGYKGDTAGDWSRSLYSAPRD-- 277
            SNS       +S+   ++   A  P    A  +  + GY    A        S P    
Sbjct: 243 LSNSVYPQTGFYSNQDHILQQGAGVPSYFNALSVSDFQGYAETAANPVPVFASSLPVTHG 302

Query: 278 ---DLSSKEFSLRLVCPVANIGGVIGKGGAIINQIRQESGAAIKVDSSSTE-GDD-CLIT 332
                 S+E   +++CP+ NI  VIGKGG+ I +IR+ SG+ I+V+ S T+ GDD C+I 
Sbjct: 303 FGGSSRSEELVFKVLCPLCNIMRVIGKGGSTIKRIREASGSCIEVNDSRTKCGDDECVII 362

Query: 333 VSSKEFFEDTLSATIEAVVRLQPRCSEKIERDSGLISFTTRLLVPTSRIGCLIGKGGSII 392
           V++ E  +D  S  +EAV+ LQ    E I  D    +   +LLV +  IGC+IGK GS+I
Sbjct: 363 VTATESPDDMKSMAVEAVLLLQ----EYIN-DEDAENVKMQLLVSSKVIGCVIGKSGSVI 417

Query: 393 TEMRRLTKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRANLFDREGA 452
            E+R+ T ANI I           + D++V++SG++   +DALIQ++ RLR ++   + +
Sbjct: 418 NEIRKRTNANICIS--------KGKKDDLVEVSGEVSSVRDALIQIVLRLREDVLGDKDS 469

Query: 453 VSTFVPVLPYIPVSENGSDGLNYESRDSKRHGRGPPYGGYGSSDLAAGDSYGSYGSSQLG 512
           V+T  P     P     +D  ++ S  S      P +     S +A+   +  YGS   G
Sbjct: 470 VATRKP-----PAR---TDNCSFLSGSSNAGYTLPSF----MSSMASTSGFHGYGSFPAG 517

Query: 513 GTGSAYGSYGSYSSGR 528
              +  GS G YS GR
Sbjct: 518 --DNVLGSTGPYSYGR 531

Arabidopsis thaliana (taxid: 3702)
>sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2 Back     alignment and function description
>sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 Back     alignment and function description
>sp|Q5SF07|IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus GN=Igf2bp2 PE=1 SV=1 Back     alignment and function description
>sp|Q9PW80|IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio GN=igf2bp3 PE=1 SV=1 Back     alignment and function description
>sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 Back     alignment and function description
>sp|Q9CPN8|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus GN=Igf2bp3 PE=1 SV=1 Back     alignment and function description
>sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=2 SV=3 Back     alignment and function description
>sp|Q9UNW9|NOVA2_HUMAN RNA-binding protein Nova-2 OS=Homo sapiens GN=NOVA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y6M1|IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens GN=IGF2BP2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query546
356572762548 PREDICTED: KH domain-containing protein 0.992 0.989 0.785 0.0
224141011531 predicted protein [Populus trichocarpa] 0.967 0.994 0.781 0.0
356550877561 PREDICTED: KH domain-containing protein 0.963 0.937 0.783 0.0
225452863548 PREDICTED: KH domain-containing protein 0.994 0.990 0.773 0.0
449527609546 PREDICTED: KH domain-containing protein 0.888 0.888 0.748 0.0
449447377545 PREDICTED: KH domain-containing protein 0.888 0.889 0.748 0.0
357496471553 Poly(rC)-binding protein [Medicago trunc 0.992 0.980 0.734 0.0
356531744540 PREDICTED: KH domain-containing protein 0.981 0.992 0.712 0.0
357496469569 Poly(rC)-binding protein [Medicago trunc 0.963 0.924 0.746 0.0
356568682543 PREDICTED: KH domain-containing protein 0.987 0.992 0.720 0.0
>gi|356572762|ref|XP_003554535.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Back     alignment and taxonomy information
 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/549 (78%), Positives = 483/549 (87%), Gaps = 7/549 (1%)

Query: 1   MAGQRNSYGKRSHSQTDYADHGPNKRRYTGDDRDQFIIGPEDTVYRYLCPIRKIGSIIGR 60
           M GQR+ YGKR HSQ+D+ D+GPNKRR  GDDR+QF+I  EDTVYRY+CP RKIGS+IGR
Sbjct: 1   MGGQRSGYGKRPHSQSDH-DNGPNKRRNHGDDREQFVIDLEDTVYRYVCPGRKIGSVIGR 59

Query: 61  GGEIVKQLRIDTKSKIRIGETVPGSEERVVTVYSASDETNAFEDGDKFVSPAQDALFKVH 120
           GGEIVKQLR++TK+KIRIGETVPG EERVVT+YS SDETNA E G  +VSPAQDALFKVH
Sbjct: 60  GGEIVKQLRVETKAKIRIGETVPGCEERVVTIYSPSDETNAVEGGGNYVSPAQDALFKVH 119

Query: 121 DRVIAEELRGDEDSDGGHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEH 180
           DRV+AE+  GD+D DGG QVTAKLLVPSDQIGCVIGKGG IVQNIRSETGAQIRILKD+H
Sbjct: 120 DRVVAEDFHGDQDDDGGQQVTAKLLVPSDQIGCVIGKGGSIVQNIRSETGAQIRILKDDH 179

Query: 181 LPSCALRSDELVQISGEASVVKKALCQIASRLHDNPSRSQHLLASAISNSHSSSGSLVGP 240
           LP CAL SDELVQI+G+ASVVKKALCQIASRLHDNPSRSQHLL SA+   + + GSL+GP
Sbjct: 180 LPLCALSSDELVQITGDASVVKKALCQIASRLHDNPSRSQHLLTSAVPGVYPAGGSLIGP 239

Query: 241 TAATPIVGIAPLMGPYGGYKGDTAGDW-SRSLYSAPRDDLSSKEFSLRLVCPVANIGGVI 299
            A  PIVGIAPL+G YGGYKGDT GDW  RS+YSAPRD+ S+KEFS+RLVCP  NIGGVI
Sbjct: 240 GAGAPIVGIAPLVGAYGGYKGDT-GDWPPRSMYSAPRDEASTKEFSVRLVCPTGNIGGVI 298

Query: 300 GKGGAIINQIRQESGAAIKVDSSSTEGDDCLITVSSKEFFEDTLSATIEAVVRLQPRCSE 359
           GKGG IINQIRQESGA IKVDSS+TEGD+CLI +S+KEFFE+T S TIEA VRLQPRCSE
Sbjct: 299 GKGGMIINQIRQESGATIKVDSSTTEGDECLIAISTKEFFEETFSPTIEAAVRLQPRCSE 358

Query: 360 KIERDSGLISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRILPKENLPKIASEDD 419
           K+ERDSG+ISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRI+ KENLPKIASEDD
Sbjct: 359 KVERDSGIISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRIISKENLPKIASEDD 418

Query: 420 EMVQISGDLDLAKDALIQVMTRLRANLFDREGAVSTFVPVLPYIPVSENGSDGLNYESRD 479
           EMVQISGDLD+AKDAL+ V+TRLRANLFDREGA+S+F+PVLPY+PVS +GSDGLNY+ RD
Sbjct: 419 EMVQISGDLDIAKDALVHVLTRLRANLFDREGALSSFLPVLPYLPVSADGSDGLNYDGRD 478

Query: 480 SKRHGRG--PPYGGYGSSDLAAGDSYGSYGSSQLGGTGSAYGSYGSYSSGRSGS-GLSSH 536
            KRHGRG     G  GSSDLAAGD YGSYG SQL G+ SAYG+YGSYS GRS + GLSS 
Sbjct: 479 GKRHGRGHSYSSGYGGSSDLAAGDIYGSYGGSQL-GSNSAYGAYGSYSLGRSSTAGLSSQ 537

Query: 537 APVSRRKSY 545
           +  SRR+++
Sbjct: 538 SGASRRRNH 546

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224141011|ref|XP_002323868.1| predicted protein [Populus trichocarpa] gi|222866870|gb|EEF04001.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356550877|ref|XP_003543809.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Back     alignment and taxonomy information
>gi|225452863|ref|XP_002283766.1| PREDICTED: KH domain-containing protein At4g18375 [Vitis vinifera] gi|296082939|emb|CBI22240.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449527609|ref|XP_004170802.1| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449447377|ref|XP_004141445.1| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357496471|ref|XP_003618524.1| Poly(rC)-binding protein [Medicago truncatula] gi|355493539|gb|AES74742.1| Poly(rC)-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356531744|ref|XP_003534436.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Back     alignment and taxonomy information
>gi|357496469|ref|XP_003618523.1| Poly(rC)-binding protein [Medicago truncatula] gi|355493538|gb|AES74741.1| Poly(rC)-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356568682|ref|XP_003552539.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query546
TAIR|locus:2150956548 AT5G15270 "AT5G15270" [Arabido 0.860 0.857 0.624 7.7e-158
TAIR|locus:2035807479 AT1G14170 "AT1G14170" [Arabido 0.591 0.674 0.444 4.9e-69
TAIR|locus:2161413644 AT5G46190 "AT5G46190" [Arabido 0.300 0.254 0.404 1.4e-47
TAIR|locus:2168367652 RCF3 "AT5G53060" [Arabidopsis 0.785 0.657 0.301 1.8e-46
TAIR|locus:2017612621 AT1G51580 "AT1G51580" [Arabido 0.298 0.262 0.353 1e-38
TAIR|locus:2831364606 AT4G18375 "AT4G18375" [Arabido 0.373 0.336 0.313 3e-38
TAIR|locus:2056951153 AT2G03110 "AT2G03110" [Arabido 0.260 0.928 0.522 1.3e-34
TAIR|locus:2066020632 AT2G22600 "AT2G22600" [Arabido 0.316 0.273 0.309 1.6e-18
TAIR|locus:2084908577 FLK "AT3G04610" [Arabidopsis t 0.333 0.315 0.303 4.3e-18
TAIR|locus:2120755495 PEP "AT4G26000" [Arabidopsis t 0.324 0.357 0.288 3.6e-12
TAIR|locus:2150956 AT5G15270 "AT5G15270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1538 (546.5 bits), Expect = 7.7e-158, P = 7.7e-158
 Identities = 298/477 (62%), Positives = 369/477 (77%)

Query:     5 RNSYGKRSHSQTDYADHGPNKRRYTGDDRDQFIIGPEDTVYRYLCPXXXXXXXXXXXXXX 64
             R+S+ KRS  Q+DY D+G +KRRY GDDRD  +I  +DTV+RYLCP              
Sbjct:    12 RDSHRKRSRPQSDYDDNGGSKRRYRGDDRDSLVIDRDDTVFRYLCPVKKIGSVIGRGGDI 71

Query:    65 VKQLRIDTKSKIRIGETVPGSEERVVTVYSASDETNAFEDGDKFVSPAQDALFKVHDRVI 124
             VKQLR DT+SKIRIGE +PG +ERV+T+YS SDETNAF DG+K +SPAQDALF++HDRV+
Sbjct:    72 VKQLRNDTRSKIRIGEAIPGCDERVITIYSPSDETNAFGDGEKVLSPAQDALFRIHDRVV 131

Query:   125 AEELRGDEDSDGGHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSC 184
             A++ R ++  +G  QVTAKLLVPSDQIGC++G+GGQIVQNIRSETGAQIRI+KD ++P C
Sbjct:   132 ADDARSEDSPEGEKQVTAKLLVPSDQIGCILGRGGQIVQNIRSETGAQIRIVKDRNMPLC 191

Query:   185 ALRSDELVQISGEASVVKKALCQIASRLHDNPSRSQHLLAXXXXXXXXXXXXLVGPTAAT 244
             AL SDEL+QISGE  +VKKAL QIASRLH+NPSRSQ+LL+            L+      
Sbjct:   192 ALNSDELIQISGEVLIVKKALLQIASRLHENPSRSQNLLSSSGGYPAGS---LMSHAGGP 248

Query:   245 PIVGIAPLMGPYGGYKGDTAGDWSRSLYSAPRDDLSSKEFSLRLVCPXXXXXXXXXXXXX 304
              +VG+APLMG YG      AGDWSR LY  PR+D  + EF +RLV P             
Sbjct:   249 RLVGLAPLMGSYGR----DAGDWSRPLYQPPRNDPPATEFFIRLVSPVENIASVIGKGGA 304

Query:   305 XXXQIRQESGAAIKVDSSSTEGDDCLITVSSKEFFEDTLSATIEAVVRLQPRCSEKIERD 364
                Q+RQE+ A IKVDSS TEG+DCLIT+S++E FED  S TIEAV+RLQP+CS+K+ERD
Sbjct:   305 LINQLRQETRATIKVDSSRTEGNDCLITISAREVFEDAYSPTIEAVMRLQPKCSDKVERD 364

Query:   365 SGLISFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRILPKENLPKIASEDDEMVQI 424
             SGL+SFTTRLLVP+SRIGC++GKGG+IITEMRR+TKANIRIL KENLPK+AS+DDEMVQI
Sbjct:   365 SGLVSFTTRLLVPSSRIGCILGKGGAIITEMRRMTKANIRILGKENLPKVASDDDEMVQI 424

Query:   425 SGDLDLAKDALIQVMTRLRANLFDREGAVSTFVPVLPYIPVSENGSDGLNYESRDSK 481
             SG+LD+AK+ALIQ+ +RLRAN+FDREGAVS  +PVLPY+PV+ +  D  +Y+SRDS+
Sbjct:   425 SGELDVAKEALIQITSRLRANVFDREGAVSALMPVLPYVPVAPDAGDRFDYDSRDSR 481
GO:0003676 "nucleic acid binding" evidence=ISS
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2035807 AT1G14170 "AT1G14170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161413 AT5G46190 "AT5G46190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168367 RCF3 "AT5G53060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017612 AT1G51580 "AT1G51580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2831364 AT4G18375 "AT4G18375" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056951 AT2G03110 "AT2G03110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066020 AT2G22600 "AT2G22600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084908 FLK "AT3G04610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120755 PEP "AT4G26000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query546
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 2e-19
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 9e-18
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 3e-14
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 4e-14
pfam0001359 pfam00013, KH_1, KH domain 5e-13
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 1e-12
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 5e-11
pfam0001359 pfam00013, KH_1, KH domain 9e-11
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 2e-10
smart0032268 smart00322, KH, K homology RNA-binding domain 2e-10
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 2e-09
smart0032268 smart00322, KH, K homology RNA-binding domain 4e-08
pfam0001359 pfam00013, KH_1, KH domain 8e-08
pfam1301442 pfam13014, KH_3, KH domain 8e-08
pfam1301442 pfam13014, KH_3, KH domain 2e-07
pfam0001359 pfam00013, KH_1, KH domain 3e-07
pfam1301442 pfam13014, KH_3, KH domain 4e-07
smart0032268 smart00322, KH, K homology RNA-binding domain 9e-07
smart0032268 smart00322, KH, K homology RNA-binding domain 1e-06
pfam1301442 pfam13014, KH_3, KH domain 2e-06
PRK11824693 PRK11824, PRK11824, polynucleotide phosphorylase/p 7e-06
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 4e-05
TIGR03591684 TIGR03591, polynuc_phos, polyribonucleotide nucleo 1e-04
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 3e-04
COG0195190 COG0195, NusA, Transcription elongation factor [Tr 4e-04
cd0213461 cd02134, NusA_KH, NusA_K homology RNA-binding doma 5e-04
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 7e-04
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 0.001
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 0.001
TIGR03591684 TIGR03591, polynuc_phos, polyribonucleotide nucleo 0.001
TIGR02696719 TIGR02696, pppGpp_PNP, guanosine pentaphosphate sy 0.002
COG1185692 COG1185, Pnp, Polyribonucleotide nucleotidyltransf 0.002
PRK11824693 PRK11824, PRK11824, polynucleotide phosphorylase/p 0.003
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information 
 Score = 81.8 bits (203), Expect = 2e-19
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 4/69 (5%)

Query: 141 TAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASV 200
           T +LLVPS Q G +IGKGG  ++ IR ETGA+IR+ K   LP     ++ +V ISG+ S 
Sbjct: 1   TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKS-VLPGS---TERVVTISGKPSA 56

Query: 201 VKKALCQIA 209
           V+KAL  I 
Sbjct: 57  VQKALLLIL 65

Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|223273 COG0195, NusA, Transcription elongation factor [Transcription] Back     alignment and domain information
>gnl|CDD|239049 cd02134, NusA_KH, NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>gnl|CDD|131743 TIGR02696, pppGpp_PNP, guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 546
KOG2190485 consensus PolyC-binding proteins alphaCP-1 and rel 100.0
KOG1676 600 consensus K-homology type RNA binding proteins [RN 100.0
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 100.0
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 100.0
KOG1676600 consensus K-homology type RNA binding proteins [RN 99.96
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 99.95
KOG2191402 consensus RNA-binding protein NOVA1/PASILLA and re 99.94
KOG2192 390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 99.91
KOG2190 485 consensus PolyC-binding proteins alphaCP-1 and rel 99.87
KOG2191402 consensus RNA-binding protein NOVA1/PASILLA and re 99.86
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.54
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.53
PRK13763180 putative RNA-processing protein; Provisional 99.5
PRK13763180 putative RNA-processing protein; Provisional 99.5
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.38
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.28
KOG2279608 consensus Kinase anchor protein AKAP149, contains 99.27
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.24
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 99.21
KOG2208753 consensus Vigilin [Lipid transport and metabolism] 99.2
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.2
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.18
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.14
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.04
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.04
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.02
PF1301443 KH_3: KH domain 98.96
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.96
KOG2208753 consensus Vigilin [Lipid transport and metabolism] 98.92
COG1094194 Predicted RNA-binding protein (contains KH domains 98.9
PF1301443 KH_3: KH domain 98.89
smart0032269 KH K homology RNA-binding domain. 98.86
smart0032269 KH K homology RNA-binding domain. 98.68
COG1094194 Predicted RNA-binding protein (contains KH domains 98.66
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.44
KOG2113 394 consensus Predicted RNA binding protein, contains 98.25
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.22
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 98.07
KOG0119 554 consensus Splicing factor 1/branch point binding p 98.04
PRK08406140 transcription elongation factor NusA-like protein; 98.03
KOG2113394 consensus Predicted RNA binding protein, contains 97.98
PRK08406140 transcription elongation factor NusA-like protein; 97.97
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.78
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 97.58
KOG0119554 consensus Splicing factor 1/branch point binding p 97.58
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 97.57
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 97.52
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 97.51
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 97.5
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 97.47
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 97.19
COG0195190 NusA Transcription elongation factor [Transcriptio 96.97
COG0195190 NusA Transcription elongation factor [Transcriptio 96.95
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 96.93
KOG1588259 consensus RNA-binding protein Sam68 and related KH 96.85
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 96.84
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 96.81
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 96.78
KOG1588259 consensus RNA-binding protein Sam68 and related KH 96.66
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.56
COG5176269 MSL5 Splicing factor (branch point binding protein 96.42
KOG2814345 consensus Transcription coactivator complex, P50 c 96.37
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.36
KOG2814345 consensus Transcription coactivator complex, P50 c 96.22
PRK12328374 nusA transcription elongation factor NusA; Provisi 96.16
TIGR01953341 NusA transcription termination factor NusA. This m 96.16
TIGR01953341 NusA transcription termination factor NusA. This m 96.11
PRK12328374 nusA transcription elongation factor NusA; Provisi 96.0
PRK12327362 nusA transcription elongation factor NusA; Provisi 95.96
PRK00106 535 hypothetical protein; Provisional 95.96
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 95.94
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 95.89
PRK12327362 nusA transcription elongation factor NusA; Provisi 95.86
PRK12704 520 phosphodiesterase; Provisional 95.82
PRK0046875 hypothetical protein; Provisional 95.74
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 95.69
PRK12329449 nusA transcription elongation factor NusA; Provisi 95.63
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 95.63
PRK12329449 nusA transcription elongation factor NusA; Provisi 95.53
PRK09202470 nusA transcription elongation factor NusA; Validat 95.41
PRK0282177 hypothetical protein; Provisional 95.33
COG5176269 MSL5 Splicing factor (branch point binding protein 95.23
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 95.19
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 95.1
PRK0282177 hypothetical protein; Provisional 95.1
PRK0046875 hypothetical protein; Provisional 95.04
COG183776 Predicted RNA-binding protein (contains KH domain) 95.03
PRK12704520 phosphodiesterase; Provisional 94.99
KOG1067760 consensus Predicted RNA-binding polyribonucleotide 94.97
PRK09202470 nusA transcription elongation factor NusA; Validat 94.94
PRK0106478 hypothetical protein; Provisional 94.78
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 94.78
PRK00106535 hypothetical protein; Provisional 94.77
COG183776 Predicted RNA-binding protein (contains KH domain) 94.43
PRK0106478 hypothetical protein; Provisional 94.1
PRK12705 508 hypothetical protein; Provisional 93.21
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 93.15
KOG09211282 consensus Dosage compensation complex, subunit MLE 93.14
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 90.87
PRK12705508 hypothetical protein; Provisional 90.72
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 90.42
KOG3273252 consensus Predicted RNA-binding protein Pno1p inte 89.47
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 88.77
KOG09211282 consensus Dosage compensation complex, subunit MLE 88.65
KOG1067760 consensus Predicted RNA-binding polyribonucleotide 88.13
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 87.37
PRK13764602 ATPase; Provisional 87.27
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 86.81
COG1855604 ATPase (PilT family) [General function prediction 86.67
KOG2874356 consensus rRNA processing protein [Translation, ri 86.12
COG5166657 Uncharacterized conserved protein [Function unknow 85.96
KOG3273252 consensus Predicted RNA-binding protein Pno1p inte 85.03
cd02410145 archeal_CPSF_KH The archaeal cleavage and polyaden 84.52
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 84.18
cd0241381 40S_S3_KH K homology RNA-binding (KH) domain of th 83.34
COG1855604 ATPase (PilT family) [General function prediction 83.27
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 83.24
KOG3875 362 consensus Peroxisomal biogenesis protein peroxin [ 83.2
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 82.94
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 82.73
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 81.66
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 81.62
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 81.23
COG1782 637 Predicted metal-dependent RNase, consists of a met 81.14
KOG2874356 consensus rRNA processing protein [Translation, ri 81.03
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 80.73
PRK06418166 transcription elongation factor NusA-like protein; 80.26
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=7.7e-46  Score=389.33  Aligned_cols=403  Identities=40%  Similarity=0.605  Sum_probs=314.2

Q ss_pred             cCcCCCCCCCCCCCCCCCCCccccCCCCCCCcccCCCceEEEEEecCCccceEecCCcHHHHHHHHHhCCeEEEcCCCCC
Q 009009            5 RNSYGKRSHSQTDYADHGPNKRRYTGDDRDQFIIGPEDTVYRYLCPIRKIGSIIGRGGEIVKQLRIDTKSKIRIGETVPG   84 (546)
Q Consensus         5 ~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rilip~~~~g~IIGk~G~~Ik~i~~~tga~I~i~~~~~~   84 (546)
                      |....++....+...+++..+++...++... ...+...++||||+.+.+|.||||+|.+||+||.+|.++|+|.+..++
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~p~~t~~~RlL~~~kevG~IIGk~G~~vkkir~~t~s~i~i~~~~~~   84 (485)
T KOG2190|consen    6 RGLPRPKNSTTSNVGDNGSIKRPSLGDPVIS-TGPDETLTYRLLCHVKEVGSIIGKKGDIVKKIRKETESKIRVNESLPG   84 (485)
T ss_pred             ccCccccCCCcccccCCCcccccCCCCCccc-CCCCCcceEEEEeccccceeEEccCcHHHHHHhhcccccceeecCCCC
Confidence            4455556666666655666666555554333 333444449999999999999999999999999999999999999999


Q ss_pred             CCceEEEEecCCccccccccCcccCCHHHHHHHHHHHHHHHhhh---cCCCC---CCCCCceEEEEEecCCceeEEeecC
Q 009009           85 SEERVVTVYSASDETNAFEDGDKFVSPAQDALFKVHDRVIAEEL---RGDED---SDGGHQVTAKLLVPSDQIGCVIGKG  158 (546)
Q Consensus        85 ~~ervv~I~G~~~~~~~~~~~~~~v~~a~~a~~~i~~~i~~~~~---~~~~~---~~~~~~~~~~l~Vp~~~vg~iIGk~  158 (546)
                      |+||+|+|+|...+        ..++++++|++++++.|.....   ....+   +.....++++|+||..++|+||||+
T Consensus        85 c~eRIiti~g~~~~--------~~~~~~~~al~ka~~~iv~~~~~d~~~~~d~~~~~~~~~v~~RLlVp~sq~GslIGK~  156 (485)
T KOG2190|consen   85 CPERIITITGNRVE--------LNLSPATDALFKAFDMIVFKLEEDDEAAEDNGEDASGPEVTCRLLVPSSQVGSLIGKG  156 (485)
T ss_pred             CCcceEEEeccccc--------ccCCchHHHHHHHHHHHhhcccccccccccCCccccCCceEEEEEechhheeeeeccC
Confidence            99999999997222        1688899999999999886321   11111   1122268999999999999999999


Q ss_pred             chHHHHHHhhcCceEEEecCCCCCcccCCCCceEEEEcCHHHHHHHHHHHHHHHhcCCCCccccccccccCCCCCCCCCC
Q 009009          159 GQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIASRLHDNPSRSQHLLASAISNSHSSSGSLV  238 (546)
Q Consensus       159 G~~Ik~I~~~tga~I~i~~~~~~p~~~~~~dr~v~I~G~~~~v~~A~~~I~~~l~~~~~~~~~~~~s~~~~~~~~~g~~~  238 (546)
                      |+.||+|+++|||+|.|.++ .+|.   +++|.|+|.|.+++|.+|+..|...|++++.+....+.+..+  |..    .
T Consensus       157 G~~Ik~Ire~TgA~I~v~~~-~lP~---ster~V~IsG~~~av~~al~~Is~~L~~~~~~~~~~~~st~~--y~P----~  226 (485)
T KOG2190|consen  157 GSLIKEIREETGAKIRVSSD-MLPN---STERAVTISGEPDAVKKALVQISSRLLENPPRSPPPLVSTIP--YRP----S  226 (485)
T ss_pred             cHHHHHHHHhcCceEEecCC-CCCc---ccceeEEEcCchHHHHHHHHHHHHHHHhcCCcCCCCCCCccc--CCC----c
Confidence            99999999999999999987 8887   588999999999999999999999999976553222221111  100    0


Q ss_pred             CCCCCCCcccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccEEEEEEeecCcccccccCCchhHHHHHhhhCCeEE
Q 009009          239 GPTAATPIVGIAPLMGPYGGYKGDTAGDWSRSLYSAPRDDLSSKEFSLRLVCPVANIGGVIGKGGAIINQIRQESGAAIK  318 (546)
Q Consensus       239 ~p~~g~~~~~~~p~~~~~gg~~~d~~~~~~~~~~~~p~~~~~~~~~~~~v~vp~~~~g~IIGk~G~~Ik~i~~~sga~I~  318 (546)
                      -+..++       +...++.       ..+  .+.++.....+.++.+++.+|...++.|||+++..|+.|+.++++.|.
T Consensus       227 ~~~~~~-------~~~s~~~-------~~~--~~~~~~~~~~~~e~~~~~~~p~~~~~~v~g~~~~~i~~l~~~~~~~i~  290 (485)
T KOG2190|consen  227 ASQGGP-------VLPSTAQ-------TSP--DAHPFGGIVPEEELVFKLICPSDKVGSVIGKGGLVIRALRNETGASIS  290 (485)
T ss_pred             ccccCc-------ccccccc-------CCc--ccccccccccchhhhhhhcCchhhceeeecCCCccchhhhhhcCCceE
Confidence            000000       0000000       000  111222334567788899999999999999999999999999999999


Q ss_pred             ecCCCCCCCceEEEEecCcchhhhhhHHHHHHHHhcCccccccccccCCcceeEEEEEccCcceeEEcCCChhHHHHHHh
Q 009009          319 VDSSSTEGDDCLITVSSKEFFEDTLSATIEAVVRLQPRCSEKIERDSGLISFTTRLLVPTSRIGCLIGKGGSIITEMRRL  398 (546)
Q Consensus       319 i~~~~~~~~erii~i~g~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~l~VP~~~vG~IIGkgG~~Ik~I~~~  398 (546)
                      +.+..+.   |+++++..+..++..+++++++++.++++.+....+. ...++.+|+||.+++||||||+|.+|.+||+.
T Consensus       291 v~~~~~~---~~i~~s~~e~~~~~~s~a~~a~~~~~~~~~~~~~~~~-~~~v~~~l~vps~~igciiGk~G~~iseir~~  366 (485)
T KOG2190|consen  291 VGDSRTD---RIVTISARENPEDRYSMAQEALLLVQPRISENAGDDL-TQTVTQRLLVPSDLIGCIIGKGGAKISEIRQR  366 (485)
T ss_pred             eccccCc---ceeeeccccCcccccccchhhhhhccccccccccccc-cceeeeeeccCccccceeecccccchHHHHHh
Confidence            9987654   9999999999999999999999999999988777655 77899999999999999999999999999999


Q ss_pred             hCceEEEecCCCCCCCCCCCCceEEEEcCHHHHHHHHHHHHHHHHhccccc
Q 009009          399 TKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRANLFDR  449 (546)
Q Consensus       399 Tga~I~i~~~~~~P~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i~~~~~~~  449 (546)
                      |||.|+|..+++.   ...++++++|+|+..+...|..+|..++.......
T Consensus       367 tgA~I~I~~~~~~---~~~~e~~~~I~~~~~~~~~~~~~~~~~~~~~~~~~  414 (485)
T KOG2190|consen  367 TGASISILNKEEV---SGVREALVQITGMLREDLLAQYLIRARLSAPKSSM  414 (485)
T ss_pred             cCCceEEcccccc---CCcceeEEEecchhHHHHhhhhhcccccccCccCC
Confidence            9999999887653   24678999999999999999999988887765433

>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2208 consensus Vigilin [Lipid transport and metabolism] Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>KOG2208 consensus Vigilin [Lipid transport and metabolism] Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5166 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>KOG3875 consensus Peroxisomal biogenesis protein peroxin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PRK06418 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query546
1j5k_A89 Complex Of The Kh3 Domain Of Hnrnp K With A Single_ 1e-04
2jzx_A160 Pcbp2 Kh1-Kh2 Domains Length = 160 1e-04
2anr_A178 Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND 2e-04
2ann_A178 Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE 2e-04
3vke_A76 Contribution Of The First K-Homology Domain Of Poly 3e-04
1wvn_A82 Crsytal Structure Of Domain 3 Of Human Alpha Polyc 3e-04
1zzi_A82 Crystal Structure Analysis Of The Third Kh Domain O 3e-04
1khm_A89 C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 8e-04
>pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 5/69 (7%)
Query: 136 GGHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQIS 195
           GG  +T ++ +P D  G +IGKGGQ ++ IR E+GA I+I  DE L       D ++ I+
Sbjct: 10  GGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI--DEPLEGS---EDRIITIT 64
Query: 196 GEASVVKKA 204
           G    ++ A
Sbjct: 65  GTQDQIQNA 73
>pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 Back     alignment and structure
>pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|3VKE|A Chain A, Contribution Of The First K-Homology Domain Of Poly(C)-Binding Protein 1 To Its Affinity And Specificity For C-Rich Oligonucleotides Length = 76 Back     alignment and structure
>pdb|1WVN|A Chain A, Crsytal Structure Of Domain 3 Of Human Alpha Polyc Binding Protein Length = 82 Back     alignment and structure
>pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 Back     alignment and structure
>pdb|1KHM|A Chain A, C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query546
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 7e-42
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-31
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-22
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-38
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-33
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 9e-08
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 7e-07
1j4w_A174 FUSE binding protein; single-stranded DNA binding 1e-38
1j4w_A174 FUSE binding protein; single-stranded DNA binding 9e-30
1j4w_A174 FUSE binding protein; single-stranded DNA binding 2e-08
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 8e-37
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 2e-32
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 3e-18
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 1e-08
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 1e-33
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-25
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-22
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-08
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 1e-17
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 5e-11
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 6e-11
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 5e-10
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 3e-17
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 4e-14
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 1e-11
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 2e-10
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 5e-17
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 1e-11
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 3e-09
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 2e-08
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 7e-17
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 6e-12
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 4e-09
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 2e-08
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 1e-16
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 2e-11
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 9e-11
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 2e-10
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 4e-16
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 9e-10
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 1e-08
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 3e-08
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 7e-16
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 4e-10
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 4e-10
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 1e-09
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 3e-15
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 3e-10
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 4e-10
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 7e-10
1x4m_A94 FAR upstream element binding protein 1; KH domain, 3e-15
1x4m_A94 FAR upstream element binding protein 1; KH domain, 1e-08
1x4m_A94 FAR upstream element binding protein 1; KH domain, 8e-08
1x4m_A94 FAR upstream element binding protein 1; KH domain, 7e-07
1we8_A104 Tudor and KH domain containing protein; structural 9e-13
1we8_A104 Tudor and KH domain containing protein; structural 1e-07
1we8_A104 Tudor and KH domain containing protein; structural 5e-07
1we8_A104 Tudor and KH domain containing protein; structural 2e-06
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 2e-12
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 4e-09
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 5e-07
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 4e-06
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 3e-11
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 3e-08
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 3e-07
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 3e-06
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 3e-10
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 3e-08
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 4e-04
1x4n_A92 FAR upstream element binding protein 1; KH domain, 3e-10
1x4n_A92 FAR upstream element binding protein 1; KH domain, 2e-08
1x4n_A92 FAR upstream element binding protein 1; KH domain, 4e-08
1x4n_A92 FAR upstream element binding protein 1; KH domain, 7e-08
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 5e-10
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 4e-06
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 6e-06
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 3e-05
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 7e-09
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 4e-07
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 3e-04
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 6e-04
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 3e-08
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 2e-07
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 2e-04
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 3e-04
1tua_A191 Hypothetical protein APE0754; structural genomics, 2e-07
1tua_A191 Hypothetical protein APE0754; structural genomics, 3e-06
1tua_A191 Hypothetical protein APE0754; structural genomics, 4e-04
1tua_A191 Hypothetical protein APE0754; structural genomics, 9e-04
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 2e-07
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 6e-04
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 5e-07
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 4e-05
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 1e-04
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 5e-07
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 7e-07
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 9e-06
3n89_A376 Defective in GERM LINE development protein 3, ISO; 1e-06
2dgr_A83 Ring finger and KH domain-containing protein 1; st 1e-06
2dgr_A83 Ring finger and KH domain-containing protein 1; st 7e-04
2cxc_A144 NUSA; transcription termination, RNA binding prote 2e-06
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 7e-06
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 3e-04
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 8e-06
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 3e-04
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 2e-05
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 2e-04
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 3e-05
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 9e-05
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 7e-04
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
 Score =  147 bits (372), Expect = 7e-42
 Identities = 43/185 (23%), Positives = 83/185 (44%), Gaps = 16/185 (8%)

Query: 39  GPEDTVYRYLCPIRKIGSIIGRGGEIVKQLRIDTKSKIRI---GETVPGSEERVVTVYSA 95
                  + L P    GSIIG+GG+ + QL+ +T + I++    +  PG+ ERV  +   
Sbjct: 2   LGSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGT 61

Query: 96  SDETNAFEDGDKFVSPAQDALFKVHDRVIAEE----LRGDEDSDGGHQVTAKLLVPSDQI 151
            +        +       + + ++   V   E    L+     +       K++VP+   
Sbjct: 62  IEAL------NAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRANQVKIIVPNSTA 115

Query: 152 GCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASVVKKALCQIASR 211
           G +IGKGG  V+ I  ++GA +++ +    P      + +V +SGE    +KA+  I  +
Sbjct: 116 GLIIGKGGATVKAIMEQSGAWVQLSQK---PDGINLQNRVVTVSGEPEQNRKAVELIIQK 172

Query: 212 LHDNP 216
           + ++P
Sbjct: 173 IQEDP 177
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Length = 144 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query546
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.92
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.92
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.91
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.9
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.9
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.89
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.89
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.88
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.88
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.87
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.87
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.83
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.74
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.7
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.58
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.54
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.52
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.52
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.5
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.5
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.5
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.48
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.47
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.45
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.45
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.44
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.44
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.43
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.42
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.41
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.39
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.39
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.37
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.37
1we8_A104 Tudor and KH domain containing protein; structural 99.37
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.37
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.34
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.33
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.33
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.31
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.31
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.3
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.3
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.3
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.29
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.29
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.29
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.26
1we8_A104 Tudor and KH domain containing protein; structural 99.26
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.24
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.21
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.2
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.17
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.17
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.16
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.11
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.06
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.03
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.97
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 98.93
2cpq_A91 FragIle X mental retardation syndrome related prot 98.88
2cpq_A91 FragIle X mental retardation syndrome related prot 98.65
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.59
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.55
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.39
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.3
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.2
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 98.08
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.02
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.72
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.68
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 97.52
2cxc_A144 NUSA; transcription termination, RNA binding prote 97.5
2cxc_A144 NUSA; transcription termination, RNA binding prote 97.39
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 97.07
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.0
2asb_A251 Transcription elongation protein NUSA; protein-RNA 95.9
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 95.83
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 95.77
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 95.75
2asb_A251 Transcription elongation protein NUSA; protein-RNA 95.72
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 95.23
1hh2_P344 NUSA, N utilization substance protein A; transcrip 94.38
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 93.97
1hh2_P344 NUSA, N utilization substance protein A; transcrip 93.54
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 92.67
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
Probab=99.92  E-value=4e-25  Score=203.27  Aligned_cols=155  Identities=24%  Similarity=0.393  Sum_probs=129.8

Q ss_pred             ceEEEEEecCCccceEecCCcHHHHHHHHHhCCeEEEcCC-CCCCCceEEEEecCCccccccccCcccCCHHHHHHHHHH
Q 009009           42 DTVYRYLCPIRKIGSIIGRGGEIVKQLRIDTKSKIRIGET-VPGSEERVVTVYSASDETNAFEDGDKFVSPAQDALFKVH  120 (546)
Q Consensus        42 ~~~~rilip~~~~g~IIGk~G~~Ik~i~~~tga~I~i~~~-~~~~~ervv~I~G~~~~~~~~~~~~~~v~~a~~a~~~i~  120 (546)
                      .-+++|+||.+++|.||||+|++|++|+++|+|+|+|++. .+++.+|+|+|+|.++.             +.+|..+++
T Consensus         2 ~~~~~~~ip~~~~g~iIGk~G~~Ik~i~~~tg~~I~i~~~~~~~~~~r~v~I~G~~e~-------------v~~A~~~I~   68 (163)
T 3krm_A            2 QEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEA-------------QFKAQGRIY   68 (163)
T ss_dssp             CEEEEEEEEGGGHHHHHCGGGHHHHHHHHHHTCEEEECCCSSTTCSEEEEEEEECHHH-------------HHHHHHHHH
T ss_pred             ceEEEEEechhhcceeECCCcHHHHHHHHHHCCeEEEcCCCCCCCCceEEEEEcCHHH-------------HHHHHHHHH
Confidence            4578999999999999999999999999999999999875 67889999999998765             567777787


Q ss_pred             HHHHHhhhcCCCCCCCCCceEEEEEecCCceeEEeecCchHHHHHHhhcCceEEEecCCCCCcccCCCCceEEEEcCHHH
Q 009009          121 DRVIAEELRGDEDSDGGHQVTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEASV  200 (546)
Q Consensus       121 ~~i~~~~~~~~~~~~~~~~~~~~l~Vp~~~vg~iIGk~G~~Ik~I~~~tga~I~i~~~~~~p~~~~~~dr~v~I~G~~~~  200 (546)
                      +.+.+....   .......++++|+||.+++|+||||+|++|++|+++|||+|.|.++ ..|.  ...++.|+|+|++++
T Consensus        69 ~~~~e~~~~---~~~~~~~~~~~i~vp~~~~g~iIGkgG~~I~~i~~~tga~I~i~~~-~~~~--~~~~~~v~I~G~~~~  142 (163)
T 3krm_A           69 GKLKEENFF---GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRD-QTPD--ENDQVIVKIIGHFYA  142 (163)
T ss_dssp             HHHHHTTSS---CSSCCCCEEEEEEEETTTHHHHHCGGGHHHHHHHHHHCCEEECCTT-CCCC--TTSEEEEEEEECHHH
T ss_pred             HHHhccccc---ccccCCceEEEEEcChhheeeEEcCCChHHHHHHHHhCCeEEECCC-CCCC--CCCceEEEEEeCHHH
Confidence            766554322   1123456788999999999999999999999999999999999764 3343  134458999999999


Q ss_pred             HHHHHHHHHHHHhcC
Q 009009          201 VKKALCQIASRLHDN  215 (546)
Q Consensus       201 v~~A~~~I~~~l~~~  215 (546)
                      |.+|+.+|.+++.+.
T Consensus       143 v~~A~~~I~~~i~~~  157 (163)
T 3krm_A          143 SQMAQRKIRDILAQV  157 (163)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
Confidence            999999999999763
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 546
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 2e-15
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 2e-13
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 3e-09
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 4e-08
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 5e-15
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 2e-11
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 8e-09
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 4e-08
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 9e-15
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 2e-09
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 4e-05
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 1e-04
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-14
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 3e-12
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 2e-08
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-06
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 4e-14
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 1e-10
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 3e-07
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 6e-06
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 8e-14
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 1e-10
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 3e-09
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 8e-09
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 5e-13
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 1e-10
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 1e-07
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 3e-07
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 3e-12
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 4e-10
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 2e-08
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 9e-06
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 7e-12
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 6e-08
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-07
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 5e-06
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 9e-11
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 1e-09
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 2e-06
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 2e-05
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 1e-10
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 5e-10
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 5e-08
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 7e-05
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 4e-10
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 4e-09
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 1e-07
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 2e-07
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 4e-09
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 7e-06
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 4e-05
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 3e-04
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 7e-09
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 5e-06
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 9e-06
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 8e-04
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 3e-08
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 2e-04
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 6e-04
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 3e-08
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 1e-07
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 2e-06
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 9e-06
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 1e-06
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 2e-05
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 0.002
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 2e-06
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 7e-06
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 2e-05
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 3e-06
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 1e-05
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 1e-05
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 0.004
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 2e-05
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 6e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 0.003
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 4e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 5e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 8e-04
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Poly(RC)-binding protein 2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.0 bits (169), Expect = 2e-15
 Identities = 20/75 (26%), Positives = 41/75 (54%), Gaps = 7/75 (9%)

Query: 140 VTAKLLVPSDQIGCVIGKGGQIVQNIRSETGAQIRILKDEHLPSCALRSDELVQISGEAS 199
           +T +LL+   ++G +IGK G+ V+ +R E+GA+I I +           + ++ ++G  +
Sbjct: 4   LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGN-------CPERIITLAGPTN 56

Query: 200 VVKKALCQIASRLHD 214
            + KA   I  +L +
Sbjct: 57  AIFKAFAMIIDKLEE 71
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query546
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.56
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.56
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.55
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.55
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.54
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.53
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.48
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.46
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.46
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.45
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.45
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.43
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.42
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.39
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.37
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.35
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.31
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.29
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2cpqa178 Fragile X mental retardation syndrome related prot 99.22
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.2
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.2
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.19
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.14
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.01
d2cpqa178 Fragile X mental retardation syndrome related prot 98.98
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.78
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.78
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.69
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.63
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.59
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.55
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.54
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.52
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.44
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 98.3
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.22
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.93
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.87
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.38
d1hh2p368 Transcription factor NusA, C-terminal domains {The 94.94
d2asba367 Transcription factor NusA, C-terminal domains {Myc 94.76
d2asba367 Transcription factor NusA, C-terminal domains {Myc 94.65
d1hh2p368 Transcription factor NusA, C-terminal domains {The 94.36
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 83.02
d1wh9a_92 Ribosomal protein S3 N-terminal domain {Mouse (Mus 80.77
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: HnRNP K, KH3
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.56  E-value=2.3e-15  Score=117.24  Aligned_cols=72  Identities=26%  Similarity=0.460  Sum_probs=65.0

Q ss_pred             ceeEEEEEccCcceeEEcCCChhHHHHHHhhCceEEEecCCCCCCCCCCCCceEEEEcCHHHHHHHHHHHHHHHHhc
Q 009009          369 SFTTRLLVPTSRIGCLIGKGGSIITEMRRLTKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRAN  445 (546)
Q Consensus       369 ~~~~~l~VP~~~vG~IIGkgG~~Ik~I~~~Tga~I~i~~~~~~P~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i~~~  445 (546)
                      .+|.+|.||.+++|+||||+|++|++|+++|||+|+|....     +.+++++|+|+|++++|+.|+.+|.++|++.
T Consensus         3 ~~t~~i~VP~~~vg~iIG~~G~~I~~I~~~sga~I~i~~~~-----~~~~~r~i~I~G~~~~v~~A~~~I~~~i~e~   74 (75)
T d1zzka1           3 IITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL-----EGSEDRIITITGTQDQIQNAQYLLQNSVKQY   74 (75)
T ss_dssp             CEEEEEEEETTTGGGGTCGGGHHHHHHHHHHCCEEEECCTT-----SCSSEEEEEEEECHHHHHHHHHHHHHHHHHH
T ss_pred             cEEEEEEEChHhcCeeECCCCchHHHHHhhcCCeEEEccCC-----CCCCceEEEEEeCHHHHHHHHHHHHHHHHhc
Confidence            47899999999999999999999999999999999996432     2467889999999999999999999999874
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure