Citrus Sinensis ID: 009010


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540------
MLVGLFALQHFGTHRVGFLFAPVLLAWLLCISIVGFYNTVRWNPGVVRALSPYYVYIFFKKAGKDGWSSLGGVVLCVTGAEAMFADLGHFSHLPIRIAFATVVYPCLILAYMGEAAFYTKHKEDLERSFFKAIPEAVFWPVFIIATLATAVASQAIISATFSIISQCRALSCFPRVKIMHTSNQIHGQIYIPEMNWILMIFCLGVVVGFRDTDMIANAYGLAVITVMFVTTCLMFLIIVMVWKRKVLVAIAFVVVFGSLELLYLSACLAKVHKGGWLPLVFSLVTLSIMCIWQYGTLKKHSYESHNKVCLDMLLTVGQNHGVTRVPGICLIYSNVISGVPPMFAHFVTNFPAFHQILIFVTLQSLTVPYVPLNQQFHVSRIGPQEFHFFHCIVRYGYKDARKEIYAFESHLIDTVAEFLHTSSNDWDTGASGGEMIVNHQQSSPQVDAVVPRVENGNGGGAMQKKVRFRGVGCNNRELEELEEARESGLAYMMGNTCVLASETSSYLKKFVINIVYGFLRRNCRRPATALGVPNASLIEVGMVYRV
cEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHccccCEEECccHHHHcccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccEECcHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccccccEEEEEcccccccHHHHHHHHccccccEEEEEEEEEECcccccccccEEEEEECccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHcccEEEEEccEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEEc
MLVGLFALQHFGTHRVGFLFAPVLLAWLLCISIVGFYNTVRWNPGVVRALSPYYVYIFFKKAGKDGWSSLGGVVLCVTGAEAMFADLGHFSHLPIRIAFATVVYPCLILAYMGEAAFYTKHKEDLERSFFKAIPEAVFWPVFIIATLATAVASQAIISATFSIISQCRALSCFPRVKIMHTSNQIHGQIYIPEMNWILMIFCLGVVVGFRDTDMIANAYGLAVITVMFVTTCLMFLIIVMVWKRKVLVAIAFVVVFGSLELLYLSACLAKVHKGGWLPLVFSLVTLSIMCIWQYGTLKKHSYESHNKVCLDMLLTVGQNHGVTRVPGICLIYSNVISGVPPMFAHFVTNFPAFHQILIFVTLQSLTVPYVPLNQQFHVSRIGPQEFHFFHCIVRYGYKDARKEIYAFESHLIDTVAEFLHTSSND*****************************************RFRGVGCN*****ELEEARESGLAYMMGNTCVLASETSSYLKKFVINIVYGFLRRNCRRPATALGVPNASLIEVGMVYRV
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVGLFALQHFGTHRVGFLFAPVLLAWLLCISIVGFYNTVRWNPGVVRALSPYYVYIFFKKAGKDGWSSLGGVVLCVTGAEAMFADLGHFSHLPIRIAFATVVYPCLILAYMGEAAFYTKHKEDLERSFFKAIPEAVFWPVFIIATLATAVASQAIISATFSIISQCRALSCFPRVKIMHTSNQIHGQIYIPEMNWILMIFCLGVVVGFRDTDMIANAYGLAVITVMFVTTCLMFLIIVMVWKRKVLVAIAFVVVFGSLELLYLSACLAKVHKGGWLPLVFSLVTLSIMCIWQYGTLKKHSYESHNKVCLDMLLTVGQNHGVTRVPGICLIYSNVISGVPPMFAHFVTNFPAFHQILIFVTLQSLTVPYVPLNQQFHVSRIGPQEFHFFHCIVRYGYKDARKEIYAFESHLIDTVAEFLHTSSNDWDTGASGGEMIVNHQQSSPQVDAVVPRVENGNGGGAMQKKVRFRGVGCNNRELEELEEARESGLAYMMGNTCVLASETSSYLKKFVINIVYGFLRRNCRRPATALGVPNASLIEVGMVYRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium transporter 1 High-affinity potassium transporter that could play a major role in the uptake of potassium from the rhizosphere. May act as a low-affinity potassium transporter under high potassium concentrations. Could also transport rubidium.probableO22397
Probable potassium transporter 13 High-affinity potassium transporter.probableQ652J4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GIA, chain A
Confidence level:probable
Coverage over the Query: 155-233
View the alignment between query and template
View the model in PyMOL
Template: 3L1L, chain A
Confidence level:probable
Coverage over the Query: 125-175
View the alignment between query and template
View the model in PyMOL
Template: 4DJK, chain A
Confidence level:probable
Coverage over the Query: 65-101
View the alignment between query and template
View the model in PyMOL