Citrus Sinensis ID: 009019
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 546 | ||||||
| 32364696 | 705 | ABC transporter [Gossypium hirsutum] | 0.998 | 0.773 | 0.895 | 0.0 | |
| 255569405 | 705 | ATP-binding cassette transporter, putati | 1.0 | 0.774 | 0.902 | 0.0 | |
| 225454545 | 705 | PREDICTED: ABC transporter G family memb | 0.985 | 0.763 | 0.894 | 0.0 | |
| 147773147 | 716 | hypothetical protein VITISV_006943 [Viti | 0.985 | 0.751 | 0.894 | 0.0 | |
| 356559983 | 706 | PREDICTED: ABC transporter G family memb | 0.987 | 0.763 | 0.879 | 0.0 | |
| 356531001 | 707 | PREDICTED: ABC transporter G family memb | 0.987 | 0.762 | 0.875 | 0.0 | |
| 449469450 | 696 | PREDICTED: ABC transporter G family memb | 1.0 | 0.784 | 0.866 | 0.0 | |
| 224118648 | 698 | white-brown-complex ABC transporter fami | 0.970 | 0.759 | 0.881 | 0.0 | |
| 63054104 | 687 | white-brown complex protein 11 [Arabidop | 0.978 | 0.777 | 0.867 | 0.0 | |
| 22329638 | 703 | ABC transporter G family member 11 [Arab | 0.987 | 0.766 | 0.861 | 0.0 |
| >gi|32364696|gb|AAP80385.1| ABC transporter [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
Score = 1026 bits (2654), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 489/546 (89%), Positives = 517/546 (94%), Gaps = 1/546 (0%)
Query: 1 MPWSEKRTLVERTIIEMGLQDCADTVIGNWHLRGISGGERRRVSIALEILMRPRLLFLDE 60
MPWS KR LVE TIIEMGLQDCADTVIGNWHLRGISGGE+RRVSIALEILMRPRLLFLDE
Sbjct: 161 MPWSAKRDLVEGTIIEMGLQDCADTVIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDE 220
Query: 61 PTSGLDSAAAFFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGETS 120
PTSGLDSA+AFFVTQTLR LSRDGRTVIAS+HQPSSEVFELFD+LYLLS GKT+YFG+ S
Sbjct: 221 PTSGLDSASAFFVTQTLRGLSRDGRTVIASVHQPSSEVFELFDQLYLLSEGKTIYFGQAS 280
Query: 121 AAFEFFAQAGFPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLKFETSDDPLEKITTAE 180
A+EFFAQAGFPCPALRNPSDHFLRCINSDFDKVKATLKGSMKL+FE SDDPLEKITT E
Sbjct: 281 EAYEFFAQAGFPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLRFEASDDPLEKITTTE 340
Query: 181 AIKNLIDFYQTSQHSYAAKEKVEGISKVKGTVLDAGGSQASFLMQAFTLTKRSFVNMSRD 240
AI+ LI+FY+TS YAAKEKV+ ISKV+GTVLD+GGSQASFLMQ++TLTKRSFVNMSRD
Sbjct: 341 AIRTLINFYRTSHQCYAAKEKVDEISKVRGTVLDSGGSQASFLMQSYTLTKRSFVNMSRD 400
Query: 241 FGYYWLRLVIYVVVTICIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVED 300
FGYYWLRL+IYVVVT+CIGTIYLN+GT YNSILARG+CASFVFGFVTFMSIGGFPSFVED
Sbjct: 401 FGYYWLRLLIYVVVTVCIGTIYLNIGTSYNSILARGACASFVFGFVTFMSIGGFPSFVED 460
Query: 301 MKVFQRERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTICYFMVRLHPGFIHYLFFVLC 360
MKVFQRERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTICYFMVRLHPGF HY+FFVLC
Sbjct: 461 MKVFQRERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTICYFMVRLHPGFEHYMFFVLC 520
Query: 361 LYASVAVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSY 420
LYASV VVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSY
Sbjct: 521 LYASVTVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSY 580
Query: 421 LSFHYWALQGQYQNDLKGLWFDNQSPDLPKIPGEYVLENVFQIDVRRSKWIDLSVIFSMI 480
+SFH+WALQGQYQNDLKGL FDNQ P+LPKIPGEY+LENVFQIDV RSKWIDLSVIFSMI
Sbjct: 581 ISFHFWALQGQYQNDLKGLLFDNQPPELPKIPGEYILENVFQIDVGRSKWIDLSVIFSMI 640
Query: 481 ISYRIIFFVMIKISEDVTPWIRGCLARRRMQQKNGTQNTTVAPDRLTQSPSLRNYVANHA 540
I YRIIFF+MIKISEDVTPWIRG +ARRRMQQKNGTQNT VAP L+QSPSLRNYVAN A
Sbjct: 641 IIYRIIFFLMIKISEDVTPWIRGLVARRRMQQKNGTQNTMVAPS-LSQSPSLRNYVANRA 699
Query: 541 ARAGKR 546
GKR
Sbjct: 700 NGRGKR 705
|
Source: Gossypium hirsutum Species: Gossypium hirsutum Genus: Gossypium Family: Malvaceae Order: Malvales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255569405|ref|XP_002525670.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223535106|gb|EEF36788.1| ATP-binding cassette transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225454545|ref|XP_002262619.1| PREDICTED: ABC transporter G family member 11 [Vitis vinifera] gi|297737190|emb|CBI26391.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147773147|emb|CAN69297.1| hypothetical protein VITISV_006943 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356559983|ref|XP_003548275.1| PREDICTED: ABC transporter G family member 11-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531001|ref|XP_003534067.1| PREDICTED: ABC transporter G family member 11-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449469450|ref|XP_004152433.1| PREDICTED: ABC transporter G family member 11-like [Cucumis sativus] gi|449524820|ref|XP_004169419.1| PREDICTED: ABC transporter G family member 11-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224118648|ref|XP_002331414.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222873628|gb|EEF10759.1| white-brown-complex ABC transporter family [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|63054104|gb|AAY28856.1| white-brown complex protein 11 [Arabidopsis halleri subsp. gemmifera] | Back alignment and taxonomy information |
|---|
| >gi|22329638|ref|NP_173226.2| ABC transporter G family member 11 [Arabidopsis thaliana] gi|75330766|sp|Q8RXN0.1|AB11G_ARATH RecName: Full=ABC transporter G family member 11; Short=ABC transporter ABCG.11; Short=AtABCG11; AltName: Full=Protein CUTICULAR DEFECT AND ORGAN FUSION 1; AltName: Full=Protein DESPERADO; AltName: Full=Protein PERMEABLE LEAVES 1; AltName: Full=White-brown complex homolog protein 11; Short=AtWBC11 gi|19423992|gb|AAL87274.1| putative ABC transporter protein [Arabidopsis thaliana] gi|23297574|gb|AAN12898.1| putative ABC transporter protein [Arabidopsis thaliana] gi|332191521|gb|AEE29642.1| ABC transporter G family member 11 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 546 | ||||||
| TAIR|locus:2030898 | 703 | ABCG11 "ATP-binding cassette G | 0.976 | 0.758 | 0.868 | 6e-254 | |
| TAIR|locus:2033899 | 687 | ABCG12 "ATP-binding cassette G | 0.926 | 0.736 | 0.576 | 1.7e-160 | |
| TAIR|locus:2092960 | 691 | ABCG15 "ATP-binding cassette G | 0.934 | 0.738 | 0.564 | 3.6e-160 | |
| TAIR|locus:2033939 | 678 | ABCG13 "ATP-binding cassette G | 0.965 | 0.777 | 0.490 | 9.6e-144 | |
| TAIR|locus:2046203 | 730 | ABCG3 "ATP-binding cassette G3 | 0.880 | 0.658 | 0.376 | 7.5e-89 | |
| CGD|CAL0002254 | 579 | orf19.3120 [Candida albicans ( | 0.575 | 0.542 | 0.287 | 3.7e-61 | |
| UNIPROTKB|Q5A0X6 | 579 | CaO19.10632 "Putative uncharac | 0.575 | 0.542 | 0.287 | 3.7e-61 | |
| DICTYBASE|DDB_G0269214 | 793 | abcG1 "ABC transporter G famil | 0.278 | 0.191 | 0.467 | 8e-55 | |
| TAIR|locus:2039682 | 740 | ABCG1 "ATP-binding cassette G1 | 0.794 | 0.586 | 0.298 | 7.3e-53 | |
| WB|WBGene00015479 | 598 | wht-1 [Caenorhabditis elegans | 0.860 | 0.785 | 0.316 | 1.1e-50 |
| TAIR|locus:2030898 ABCG11 "ATP-binding cassette G11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2445 (865.7 bits), Expect = 6.0e-254, P = 6.0e-254
Identities = 464/534 (86%), Positives = 499/534 (93%)
Query: 4 SEKRTLVERTIIEMGLQDCADTVIGNWHLRGISGGERRRVSIALEILMRPRLLFLDEPTS 63
SEKR LVERTIIEMGLQDCADTVIGNWHLRGISGGE+RRVSIALEILMRPRLLFLDEPTS
Sbjct: 162 SEKRALVERTIIEMGLQDCADTVIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTS 221
Query: 64 GLDSAAAFFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGETSAAF 123
GLDSA+AFFVTQTLR LSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFG+ S A+
Sbjct: 222 GLDSASAFFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAY 281
Query: 124 EFFAQAGFPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLKFETSDDPLEKITTAEAIK 183
EFFAQAGFPCPALRNPSDHFLRCINSDFDKV+ATLKGSMKL+FE SDDPLEKITTAEAI+
Sbjct: 282 EFFAQAGFPCPALRNPSDHFLRCINSDFDKVRATLKGSMKLRFEASDDPLEKITTAEAIR 341
Query: 184 NLIDFYQTSQHSYAAKEKVEGISKVKGTVLDAGGSQASFLMQAFTLTKRSFVNMSRDFGY 243
L+D+Y TS + Y AK KVE IS+ KGT+LD+GGSQASFL+Q +TLTKRSF+NMSRDFGY
Sbjct: 342 LLVDYYHTSDYYYTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGY 401
Query: 244 YWLRLVIYVVVTICIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKV 303
YWLRL+IY++VT+CIGTIYLNVGT Y++ILARGSCASFVFGFVTFMSIGGFPSFVEDMKV
Sbjct: 402 YWLRLLIYILVTVCIGTIYLNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKV 461
Query: 304 FQRERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTICYFMVRLHPGFIHYLFFVLCLYA 363
FQRERLNGHYGV AFVI NTLSA PFLIMITFISGTICYFMV LHPGF HYLFFVLCLYA
Sbjct: 462 FQRERLNGHYGVAAFVIANTLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYA 521
Query: 364 SVAVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSF 423
SV VVESLMMAIASIVPNFLMGII GAGIQGIFMLVSG+FRLPNDIPKP WRYPMSY+SF
Sbjct: 522 SVTVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISF 581
Query: 424 HYWALQGQYQNDLKGLWFDNQSPDLPKIPGEYVLENVFQIDVRRSKWIDLSVIFSMIISY 483
H+WALQGQYQNDL+GL FD+Q KIPGEYVLENVFQID+ RSKWI+LSVI SMII Y
Sbjct: 582 HFWALQGQYQNDLRGLTFDSQGSAF-KIPGEYVLENVFQIDLHRSKWINLSVILSMIIIY 640
Query: 484 RIIFFVMIKISEDVTPWIRGCLARRRMQQKNGTQNTTVAPDRLTQSPSLRNYVA 537
RIIFF+MIK +EDVTPW+RG +ARRRM+QKNGTQNTTVAPD LTQSPSLRNY+A
Sbjct: 641 RIIFFIMIKTNEDVTPWVRGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNYIA 694
|
|
| TAIR|locus:2033899 ABCG12 "ATP-binding cassette G12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2092960 ABCG15 "ATP-binding cassette G15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033939 ABCG13 "ATP-binding cassette G13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046203 ABCG3 "ATP-binding cassette G3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0002254 orf19.3120 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5A0X6 CaO19.10632 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0269214 abcG1 "ABC transporter G family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039682 ABCG1 "ATP-binding cassette G1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00015479 wht-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 546 | |||
| TIGR00955 | 617 | TIGR00955, 3a01204, The Eye Pigment Precursor Tran | 4e-96 | |
| PLN03211 | 659 | PLN03211, PLN03211, ABC transporter G-25; Provisio | 5e-52 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 2e-47 | |
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 1e-45 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 7e-41 | |
| cd03234 | 226 | cd03234, ABCG_White, White pigment protein homolog | 1e-39 | |
| cd03232 | 192 | cd03232, ABCG_PDR_domain2, Second domain of the pl | 2e-35 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 3e-32 | |
| pfam01061 | 210 | pfam01061, ABC2_membrane, ABC-2 type transporter | 2e-28 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 2e-27 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 8e-25 | |
| cd03233 | 202 | cd03233, ABCG_PDR_domain1, First domain of the ple | 3e-24 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 1e-20 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 2e-20 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 1e-18 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 9e-18 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 2e-17 | |
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 2e-15 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 2e-15 | |
| TIGR01188 | 302 | TIGR01188, drrA, daunorubicin resistance ABC trans | 7e-15 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 7e-15 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 9e-15 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 1e-14 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 3e-14 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 4e-14 | |
| COG4555 | 245 | COG4555, NatA, ABC-type Na+ transport system, ATPa | 8e-14 | |
| cd03268 | 208 | cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c | 9e-14 | |
| cd03265 | 220 | cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist | 1e-13 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 2e-13 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 4e-13 | |
| TIGR03873 | 256 | TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra | 5e-13 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 5e-13 | |
| TIGR01166 | 190 | TIGR01166, cbiO, cobalt transport protein ATP-bind | 6e-13 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 6e-13 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 7e-13 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 8e-13 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 2e-12 | |
| COG1136 | 226 | COG1136, SalX, ABC-type antimicrobial peptide tran | 2e-12 | |
| PRK13639 | 275 | PRK13639, cbiO, cobalt transporter ATP-binding sub | 3e-12 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 6e-12 | |
| COG1127 | 263 | COG1127, Ttg2A, ABC-type transport system involved | 7e-12 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 9e-12 | |
| TIGR01184 | 230 | TIGR01184, ntrCD, nitrate transport ATP-binding su | 1e-11 | |
| cd03266 | 218 | cd03266, ABC_NatA_sodium_exporter, ATP-binding cas | 1e-11 | |
| cd03297 | 214 | cd03297, ABC_ModC_molybdenum_transporter, ATP-bind | 1e-11 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 2e-11 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 2e-11 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 2e-11 | |
| cd03215 | 182 | cd03215, ABC_Carb_Monos_II, Second domain of the A | 2e-11 | |
| COG4586 | 325 | COG4586, COG4586, ABC-type uncharacterized transpo | 5e-11 | |
| COG1118 | 345 | COG1118, CysA, ABC-type sulfate/molybdate transpor | 5e-11 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 6e-11 | |
| pfam00005 | 119 | pfam00005, ABC_tran, ABC transporter | 6e-11 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 7e-11 | |
| PRK13652 | 277 | PRK13652, cbiO, cobalt transporter ATP-binding sub | 8e-11 | |
| TIGR01288 | 303 | TIGR01288, nodI, ATP-binding ABC transporter famil | 9e-11 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 9e-11 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 1e-10 | |
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 1e-10 | |
| PRK13536 | 340 | PRK13536, PRK13536, nodulation factor exporter sub | 1e-10 | |
| PRK13638 | 271 | PRK13638, cbiO, cobalt transporter ATP-binding sub | 1e-10 | |
| PRK11264 | 250 | PRK11264, PRK11264, putative amino-acid ABC transp | 1e-10 | |
| TIGR03608 | 206 | TIGR03608, L_ocin_972_ABC, putative bacteriocin ex | 2e-10 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 2e-10 | |
| COG3840 | 231 | COG3840, ThiQ, ABC-type thiamine transport system, | 2e-10 | |
| COG0444 | 316 | COG0444, DppD, ABC-type dipeptide/oligopeptide/nic | 2e-10 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 2e-10 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 3e-10 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 4e-10 | |
| PRK13651 | 305 | PRK13651, PRK13651, cobalt transporter ATP-binding | 4e-10 | |
| COG4618 | 580 | COG4618, ArpD, ABC-type protease/lipase transport | 5e-10 | |
| cd03217 | 200 | cd03217, ABC_FeS_Assembly, ABC-type transport syst | 5e-10 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 6e-10 | |
| cd03216 | 163 | cd03216, ABC_Carb_Monos_I, First domain of the ATP | 6e-10 | |
| PRK13643 | 288 | PRK13643, cbiO, cobalt transporter ATP-binding sub | 8e-10 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 8e-10 | |
| cd03252 | 237 | cd03252, ABCC_Hemolysin, ATP-binding cassette doma | 8e-10 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 8e-10 | |
| cd03246 | 173 | cd03246, ABCC_Protease_Secretion, ATP-binding cass | 8e-10 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 8e-10 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 8e-10 | |
| COG1116 | 248 | COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon | 1e-09 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 1e-09 | |
| cd03218 | 232 | cd03218, ABC_YhbG, ATP-binding cassette component | 2e-09 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 2e-09 | |
| TIGR03771 | 223 | TIGR03771, anch_rpt_ABC, anchored repeat-type ABC | 2e-09 | |
| cd03223 | 166 | cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset | 2e-09 | |
| cd03299 | 235 | cd03299, ABC_ModC_like, ATP-binding cassette domai | 2e-09 | |
| PRK13631 | 320 | PRK13631, cbiO, cobalt transporter ATP-binding sub | 2e-09 | |
| PRK13649 | 280 | PRK13649, cbiO, cobalt transporter ATP-binding sub | 2e-09 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 3e-09 | |
| COG4525 | 259 | COG4525, TauB, ABC-type taurine transport system, | 3e-09 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 5e-09 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 5e-09 | |
| COG4559 | 259 | COG4559, COG4559, ABC-type hemin transport system, | 5e-09 | |
| TIGR02982 | 220 | TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi | 5e-09 | |
| PRK10575 | 265 | PRK10575, PRK10575, iron-hydroxamate transporter A | 7e-09 | |
| PRK13637 | 287 | PRK13637, cbiO, cobalt transporter ATP-binding sub | 7e-09 | |
| COG4148 | 352 | COG4148, ModC, ABC-type molybdate transport system | 7e-09 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 8e-09 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 8e-09 | |
| TIGR02868 | 530 | TIGR02868, CydC, thiol reductant ABC exporter, Cyd | 8e-09 | |
| TIGR01187 | 325 | TIGR01187, potA, spermidine/putrescine ABC transpo | 9e-09 | |
| PRK13537 | 306 | PRK13537, PRK13537, nodulation ABC transporter Nod | 9e-09 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 2e-08 | |
| COG2884 | 223 | COG2884, FtsE, Predicted ATPase involved in cell d | 2e-08 | |
| PRK09536 | 402 | PRK09536, btuD, corrinoid ABC transporter ATPase; | 2e-08 | |
| COG1119 | 257 | COG1119, ModF, ABC-type molybdenum transport syste | 2e-08 | |
| COG0396 | 251 | COG0396, sufC, Cysteine desulfurase activator ATPa | 2e-08 | |
| TIGR02142 | 354 | TIGR02142, modC_ABC, molybdenum ABC transporter, A | 2e-08 | |
| cd03293 | 220 | cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c | 2e-08 | |
| TIGR03258 | 362 | TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans | 2e-08 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 3e-08 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 3e-08 | |
| COG4598 | 256 | COG4598, HisP, ABC-type histidine transport system | 3e-08 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 3e-08 | |
| TIGR01842 | 544 | TIGR01842, type_I_sec_PrtD, type I secretion syste | 3e-08 | |
| PRK14269 | 246 | PRK14269, PRK14269, phosphate ABC transporter ATP- | 3e-08 | |
| PRK13539 | 207 | PRK13539, PRK13539, cytochrome c biogenesis protei | 3e-08 | |
| PRK10895 | 241 | PRK10895, PRK10895, lipopolysaccharide ABC transpo | 3e-08 | |
| TIGR03740 | 223 | TIGR03740, galliderm_ABC, gallidermin-class lantib | 4e-08 | |
| TIGR02324 | 224 | TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys | 4e-08 | |
| COG4181 | 228 | COG4181, COG4181, Predicted ABC-type transport sys | 4e-08 | |
| PRK14244 | 251 | PRK14244, PRK14244, phosphate ABC transporter ATP- | 6e-08 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 6e-08 | |
| PRK10619 | 257 | PRK10619, PRK10619, histidine/lysine/arginine/orni | 8e-08 | |
| COG4107 | 258 | COG4107, PhnK, ABC-type phosphonate transport syst | 9e-08 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 9e-08 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 9e-08 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 1e-07 | |
| TIGR02323 | 253 | TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys | 1e-07 | |
| PRK14239 | 252 | PRK14239, PRK14239, phosphate transporter ATP-bind | 1e-07 | |
| TIGR03797 | 686 | TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste | 1e-07 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 1e-07 | |
| PRK09473 | 330 | PRK09473, oppD, oligopeptide transporter ATP-bindi | 1e-07 | |
| PRK14253 | 249 | PRK14253, PRK14253, phosphate ABC transporter ATP- | 1e-07 | |
| cd03267 | 236 | cd03267, ABC_NatA_like, ATP-binding cassette domai | 1e-07 | |
| cd03292 | 214 | cd03292, ABC_FtsE_transporter, ATP-binding cassett | 1e-07 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 2e-07 | |
| PRK13650 | 279 | PRK13650, cbiO, cobalt transporter ATP-binding sub | 2e-07 | |
| COG4152 | 300 | COG4152, COG4152, ABC-type uncharacterized transpo | 2e-07 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 2e-07 | |
| COG1137 | 243 | COG1137, YhbG, ABC-type (unclassified) transport s | 2e-07 | |
| PRK09984 | 262 | PRK09984, PRK09984, phosphonate/organophosphate es | 2e-07 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 2e-07 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 2e-07 | |
| COG4604 | 252 | COG4604, CeuD, ABC-type enterochelin transport sys | 2e-07 | |
| PRK14264 | 305 | PRK14264, PRK14264, phosphate ABC transporter ATP- | 2e-07 | |
| PRK14271 | 276 | PRK14271, PRK14271, phosphate ABC transporter ATP- | 2e-07 | |
| TIGR01846 | 694 | TIGR01846, type_I_sec_HlyB, type I secretion syste | 2e-07 | |
| PRK14261 | 253 | PRK14261, PRK14261, phosphate ABC transporter ATP- | 2e-07 | |
| PRK14267 | 253 | PRK14267, PRK14267, phosphate ABC transporter ATP- | 2e-07 | |
| PRK13647 | 274 | PRK13647, cbiO, cobalt transporter ATP-binding sub | 2e-07 | |
| COG1101 | 263 | COG1101, PhnK, ABC-type uncharacterized transport | 2e-07 | |
| cd03231 | 201 | cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog | 2e-07 | |
| TIGR03522 | 301 | TIGR03522, GldA_ABC_ATP, gliding motility-associat | 2e-07 | |
| PRK13644 | 274 | PRK13644, cbiO, cobalt transporter ATP-binding sub | 3e-07 | |
| PRK03695 | 248 | PRK03695, PRK03695, vitamin B12-transporter ATPase | 3e-07 | |
| cd03298 | 211 | cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin | 3e-07 | |
| TIGR02770 | 230 | TIGR02770, nickel_nikD, nickel import ATP-binding | 3e-07 | |
| PRK13640 | 282 | PRK13640, cbiO, cobalt transporter ATP-binding sub | 4e-07 | |
| TIGR02633 | 500 | TIGR02633, xylG, D-xylose ABC transporter, ATP-bin | 4e-07 | |
| PRK11614 | 237 | PRK11614, livF, leucine/isoleucine/valine transpor | 4e-07 | |
| PRK10982 | 491 | PRK10982, PRK10982, galactose/methyl galaxtoside t | 4e-07 | |
| COG4161 | 242 | COG4161, ArtP, ABC-type arginine transport system, | 4e-07 | |
| TIGR02211 | 221 | TIGR02211, LolD_lipo_ex, lipoprotein releasing sys | 5e-07 | |
| PRK09493 | 240 | PRK09493, glnQ, glutamine ABC transporter ATP-bind | 5e-07 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 5e-07 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 6e-07 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 6e-07 | |
| COG4138 | 248 | COG4138, BtuD, ABC-type cobalamin transport system | 7e-07 | |
| PRK13636 | 283 | PRK13636, cbiO, cobalt transporter ATP-binding sub | 7e-07 | |
| PRK13635 | 279 | PRK13635, cbiO, cobalt transporter ATP-binding sub | 7e-07 | |
| TIGR03410 | 230 | TIGR03410, urea_trans_UrtE, urea ABC transporter, | 7e-07 | |
| COG4178 | 604 | COG4178, COG4178, ABC-type uncharacterized transpo | 7e-07 | |
| PRK14250 | 241 | PRK14250, PRK14250, phosphate ABC transporter ATP- | 7e-07 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 8e-07 | |
| PRK14254 | 285 | PRK14254, PRK14254, phosphate ABC transporter ATP- | 1e-06 | |
| PRK14251 | 251 | PRK14251, PRK14251, phosphate ABC transporter ATP- | 1e-06 | |
| PRK14270 | 251 | PRK14270, PRK14270, phosphate ABC transporter ATP- | 1e-06 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 1e-06 | |
| PRK14248 | 268 | PRK14248, PRK14248, phosphate ABC transporter ATP- | 1e-06 | |
| TIGR00972 | 247 | TIGR00972, 3a0107s01c2, phosphate ABC transporter, | 1e-06 | |
| PRK11248 | 255 | PRK11248, tauB, taurine transporter ATP-binding su | 2e-06 | |
| TIGR01186 | 363 | TIGR01186, proV, glycine betaine/L-proline transpo | 2e-06 | |
| PRK11701 | 258 | PRK11701, phnK, phosphonate C-P lyase system prote | 2e-06 | |
| PRK14246 | 257 | PRK14246, PRK14246, phosphate ABC transporter ATP- | 3e-06 | |
| PRK14262 | 250 | PRK14262, PRK14262, phosphate ABC transporter ATP- | 3e-06 | |
| PRK13633 | 280 | PRK13633, PRK13633, cobalt transporter ATP-binding | 3e-06 | |
| PRK13645 | 289 | PRK13645, cbiO, cobalt transporter ATP-binding sub | 3e-06 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 3e-06 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 4e-06 | |
| COG4619 | 223 | COG4619, COG4619, ABC-type uncharacterized transpo | 4e-06 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 4e-06 | |
| TIGR01189 | 198 | TIGR01189, ccmA, heme ABC exporter, ATP-binding pr | 4e-06 | |
| cd03250 | 204 | cd03250, ABCC_MRP_domain1, ATP-binding cassette do | 4e-06 | |
| PRK13634 | 290 | PRK13634, cbiO, cobalt transporter ATP-binding sub | 4e-06 | |
| PRK10584 | 228 | PRK10584, PRK10584, putative ABC transporter ATP-b | 5e-06 | |
| cd03222 | 177 | cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett | 5e-06 | |
| PRK11607 | 377 | PRK11607, potG, putrescine transporter ATP-binding | 5e-06 | |
| cd03221 | 144 | cd03221, ABCF_EF-3, ATP-binding cassette domain of | 5e-06 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 6e-06 | |
| PRK15439 | 510 | PRK15439, PRK15439, autoinducer 2 ABC transporter | 6e-06 | |
| TIGR00968 | 237 | TIGR00968, 3a0106s01, sulfate ABC transporter, ATP | 6e-06 | |
| PRK11174 | 588 | PRK11174, PRK11174, cysteine/glutathione ABC trans | 6e-06 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 6e-06 | |
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 6e-06 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 6e-06 | |
| COG1125 | 309 | COG1125, OpuBA, ABC-type proline/glycine betaine t | 7e-06 | |
| COG4608 | 268 | COG4608, AppF, ABC-type oligopeptide transport sys | 7e-06 | |
| PRK11247 | 257 | PRK11247, ssuB, aliphatic sulfonates transport ATP | 7e-06 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 7e-06 | |
| COG1117 | 253 | COG1117, PstB, ABC-type phosphate transport system | 8e-06 | |
| cd03295 | 242 | cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas | 9e-06 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 1e-05 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 1e-05 | |
| PRK14268 | 258 | PRK14268, PRK14268, phosphate ABC transporter ATP- | 1e-05 | |
| TIGR03005 | 252 | TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB | 1e-05 | |
| TIGR01978 | 243 | TIGR01978, sufC, FeS assembly ATPase SufC | 1e-05 | |
| PRK15056 | 272 | PRK15056, PRK15056, manganese/iron transporter ATP | 1e-05 | |
| PRK11819 | 556 | PRK11819, PRK11819, putative ABC transporter ATP-b | 1e-05 | |
| PRK11231 | 255 | PRK11231, fecE, iron-dicitrate transporter ATP-bin | 1e-05 | |
| PRK11300 | 255 | PRK11300, livG, leucine/isoleucine/valine transpor | 2e-05 | |
| PRK10535 | 648 | PRK10535, PRK10535, macrolide transporter ATP-bind | 2e-05 | |
| PRK13641 | 287 | PRK13641, cbiO, cobalt transporter ATP-binding sub | 2e-05 | |
| PRK14255 | 252 | PRK14255, PRK14255, phosphate ABC transporter ATP- | 2e-05 | |
| PRK10261 | 623 | PRK10261, PRK10261, glutathione transporter ATP-bi | 2e-05 | |
| COG4133 | 209 | COG4133, CcmA, ABC-type transport system involved | 2e-05 | |
| PRK11144 | 352 | PRK11144, modC, molybdate transporter ATP-binding | 2e-05 | |
| PRK13547 | 272 | PRK13547, hmuV, hemin importer ATP-binding subunit | 2e-05 | |
| PRK14237 | 267 | PRK14237, PRK14237, phosphate transporter ATP-bind | 2e-05 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 2e-05 | |
| PRK14256 | 252 | PRK14256, PRK14256, phosphate ABC transporter ATP- | 2e-05 | |
| PRK10908 | 222 | PRK10908, PRK10908, cell division protein FtsE; Pr | 2e-05 | |
| cd03236 | 255 | cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin | 2e-05 | |
| PRK10744 | 260 | PRK10744, pstB, phosphate transporter ATP-binding | 2e-05 | |
| PRK11629 | 233 | PRK11629, lolD, lipoprotein transporter ATP-bindin | 2e-05 | |
| TIGR02314 | 343 | TIGR02314, ABC_MetN, D-methionine ABC transporter, | 2e-05 | |
| cd03301 | 213 | cd03301, ABC_MalK_N, The N-terminal ATPase domain | 2e-05 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 3e-05 | |
| PRK10762 | 501 | PRK10762, PRK10762, D-ribose transporter ATP bindi | 3e-05 | |
| PRK14258 | 261 | PRK14258, PRK14258, phosphate ABC transporter ATP- | 3e-05 | |
| PRK11124 | 242 | PRK11124, artP, arginine transporter ATP-binding s | 3e-05 | |
| cd03296 | 239 | cd03296, ABC_CysA_sulfate_importer, ATP-binding ca | 4e-05 | |
| PRK14240 | 250 | PRK14240, PRK14240, phosphate transporter ATP-bind | 4e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-05 | |
| PRK09544 | 251 | PRK09544, znuC, high-affinity zinc transporter ATP | 4e-05 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 5e-05 | |
| PRK11308 | 327 | PRK11308, dppF, dipeptide transporter ATP-binding | 5e-05 | |
| PRK14274 | 259 | PRK14274, PRK14274, phosphate ABC transporter ATP- | 5e-05 | |
| PRK14260 | 259 | PRK14260, PRK14260, phosphate ABC transporter ATP- | 6e-05 | |
| PRK14252 | 265 | PRK14252, PRK14252, phosphate ABC transporter ATP- | 7e-05 | |
| PRK14272 | 252 | PRK14272, PRK14272, phosphate ABC transporter ATP- | 7e-05 | |
| PRK10636 | 638 | PRK10636, PRK10636, putative ABC transporter ATP-b | 7e-05 | |
| PRK10070 | 400 | PRK10070, PRK10070, glycine betaine transporter AT | 8e-05 | |
| PRK13632 | 271 | PRK13632, cbiO, cobalt transporter ATP-binding sub | 8e-05 | |
| PRK11153 | 343 | PRK11153, metN, DL-methionine transporter ATP-bind | 9e-05 | |
| PRK11022 | 326 | PRK11022, dppD, dipeptide transporter ATP-binding | 9e-05 | |
| TIGR02769 | 265 | TIGR02769, nickel_nikE, nickel import ATP-binding | 9e-05 | |
| PRK11000 | 369 | PRK11000, PRK11000, maltose/maltodextrin transport | 1e-04 | |
| COG4170 | 330 | COG4170, SapD, ABC-type antimicrobial peptide tran | 1e-04 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 1e-04 | |
| PRK14236 | 272 | PRK14236, PRK14236, phosphate transporter ATP-bind | 1e-04 | |
| PRK09452 | 375 | PRK09452, potA, putrescine/spermidine ABC transpor | 1e-04 | |
| TIGR03796 | 710 | TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste | 1e-04 | |
| PRK14275 | 286 | PRK14275, PRK14275, phosphate ABC transporter ATP- | 1e-04 | |
| PRK14249 | 251 | PRK14249, PRK14249, phosphate ABC transporter ATP- | 1e-04 | |
| TIGR01277 | 213 | TIGR01277, thiQ, thiamine ABC transporter, ATP-bin | 2e-04 | |
| COG4136 | 213 | COG4136, COG4136, ABC-type uncharacterized transpo | 2e-04 | |
| PRK14257 | 329 | PRK14257, PRK14257, phosphate ABC transporter ATP- | 2e-04 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 2e-04 | |
| cd03294 | 269 | cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette | 2e-04 | |
| PRK14238 | 271 | PRK14238, PRK14238, phosphate transporter ATP-bind | 2e-04 | |
| COG1245 | 591 | COG1245, COG1245, Predicted ATPase, RNase L inhibi | 2e-04 | |
| cd03290 | 218 | cd03290, ABCC_SUR1_N, ATP-binding cassette domain | 2e-04 | |
| PRK10789 | 569 | PRK10789, PRK10789, putative multidrug transporter | 2e-04 | |
| PRK11176 | 582 | PRK11176, PRK11176, lipid transporter ATP-binding/ | 2e-04 | |
| PRK14263 | 261 | PRK14263, PRK14263, phosphate ABC transporter ATP- | 2e-04 | |
| pfam13304 | 256 | pfam13304, AAA_21, AAA domain | 2e-04 | |
| PRK14241 | 258 | PRK14241, PRK14241, phosphate transporter ATP-bind | 2e-04 | |
| PRK13648 | 269 | PRK13648, cbiO, cobalt transporter ATP-binding sub | 3e-04 | |
| PRK13646 | 286 | PRK13646, cbiO, cobalt transporter ATP-binding sub | 3e-04 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 3e-04 | |
| PRK14265 | 274 | PRK14265, PRK14265, phosphate ABC transporter ATP- | 3e-04 | |
| CHL00131 | 252 | CHL00131, ycf16, sulfate ABC transporter protein; | 4e-04 | |
| PRK14259 | 269 | PRK14259, PRK14259, phosphate ABC transporter ATP- | 4e-04 | |
| COG1245 | 591 | COG1245, COG1245, Predicted ATPase, RNase L inhibi | 5e-04 | |
| PRK14242 | 253 | PRK14242, PRK14242, phosphate transporter ATP-bind | 5e-04 | |
| PRK10771 | 232 | PRK10771, thiQ, thiamine transporter ATP-binding s | 5e-04 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 6e-04 | |
| COG4175 | 386 | COG4175, ProV, ABC-type proline/glycine betaine tr | 6e-04 | |
| TIGR03415 | 382 | TIGR03415, ABC_choXWV_ATP, choline ABC transporter | 6e-04 | |
| PRK14247 | 250 | PRK14247, PRK14247, phosphate ABC transporter ATP- | 6e-04 | |
| PRK13642 | 277 | PRK13642, cbiO, cobalt transporter ATP-binding sub | 7e-04 | |
| PRK14266 | 250 | PRK14266, PRK14266, phosphate ABC transporter ATP- | 7e-04 | |
| TIGR03265 | 353 | TIGR03265, PhnT2, putative 2-aminoethylphosphonate | 7e-04 | |
| COG4674 | 249 | COG4674, COG4674, Uncharacterized ABC-type transpo | 8e-04 | |
| PRK11432 | 351 | PRK11432, fbpC, ferric transporter ATP-binding sub | 8e-04 | |
| COG4778 | 235 | COG4778, PhnL, ABC-type phosphonate transport syst | 8e-04 | |
| cd03369 | 207 | cd03369, ABCC_NFT1, ATP-binding cassette domain 2 | 0.001 | |
| PRK14245 | 250 | PRK14245, PRK14245, phosphate ABC transporter ATP- | 0.001 | |
| PRK13549 | 506 | PRK13549, PRK13549, xylose transporter ATP-binding | 0.001 | |
| PRK10247 | 225 | PRK10247, PRK10247, putative ABC transporter ATP-b | 0.001 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 0.002 | |
| PRK15093 | 330 | PRK15093, PRK15093, antimicrobial peptide ABC tran | 0.002 | |
| PRK00635 | 1809 | PRK00635, PRK00635, excinuclease ABC subunit A; Pr | 0.002 | |
| PRK14235 | 267 | PRK14235, PRK14235, phosphate transporter ATP-bind | 0.002 | |
| TIGR01193 | 708 | TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t | 0.002 | |
| TIGR03411 | 242 | TIGR03411, urea_trans_UrtD, urea ABC transporter, | 0.002 | |
| PRK10851 | 353 | PRK10851, PRK10851, sulfate/thiosulfate transporte | 0.002 | |
| PRK10938 | 490 | PRK10938, PRK10938, putative molybdenum transport | 0.003 | |
| PRK10253 | 265 | PRK10253, PRK10253, iron-enterobactin transporter | 0.003 | |
| PRK14273 | 254 | PRK14273, PRK14273, phosphate ABC transporter ATP- | 0.003 | |
| TIGR01194 | 555 | TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo | 0.003 | |
| PRK11819 | 556 | PRK11819, PRK11819, putative ABC transporter ATP-b | 0.004 | |
| PRK11147 | 635 | PRK11147, PRK11147, ABC transporter ATPase compone | 0.004 | |
| PRK09580 | 248 | PRK09580, sufC, cysteine desulfurase ATPase compon | 0.004 |
| >gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
Score = 304 bits (781), Expect = 4e-96
Identities = 145/509 (28%), Positives = 244/509 (47%), Gaps = 45/509 (8%)
Query: 1 MPWSEKRTLVERTIIEMGLQDCADTVIGN-WHLRGISGGERRRVSIALEILMRPRLLFLD 59
+ EKR V+ + +GL+ CA+T IG ++G+SGGER+R++ A E+L P LLF D
Sbjct: 132 VTKKEKRERVDEVLQALGLRKCANTRIGVPGRVKGLSGGERKRLAFASELLTDPPLLFCD 191
Query: 60 EPTSGLDSAAAFFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGET 119
EPTSGLDS A+ V Q L+ L++ G+T+I +IHQPSSE+FELFD++ L++ G+ Y G
Sbjct: 192 EPTSGLDSFMAYSVVQVLKGLAQKGKTIICTIHQPSSELFELFDKIILMAEGRVAYLGSP 251
Query: 120 SAAFEFFAQAGFPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLKFETSDDPLEKITTA 179
A FF+ G PCP NP+D +++ + + P + +
Sbjct: 252 DQAVPFFSDLGHPCPENYNPADFYVQVL---------------------AVIPGSENESR 290
Query: 180 EAIKNLIDFYQTSQHSYAAKEKVEGISKVKGTVLDAG------GSQASFLMQAFTLTKRS 233
E I+ + D + S S G ++ G AS+ Q + L KRS
Sbjct: 291 ERIEKICDSFAVSDIGRDMLVNTNLWSGKAGGLVKDSENMEGIGYNASWWTQFYALLKRS 350
Query: 234 FVNMSRDFGYYWLRLVIYVVVTICIGTIYLNVGTGYNSILARGSCASFVFGFVTFM---- 289
++++ RD +RL+ ++ I IG IYL G + +F F+T M
Sbjct: 351 WLSVLRDPLLLKVRLIQTMMTAILIGLIYLGQGLTQKGVQNIN---GALFLFLTNMTFQN 407
Query: 290 SIGGFPSFVEDMKVFQRERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTICYFMVRLHP 349
F ++ VF RE +G Y V+A+ + T++ +P I++ + +I Y+M+ L
Sbjct: 408 VFPVINVFTAELPVFLRETRSGLYRVSAYFLAKTIAELPLFIILPALFTSITYWMIGLRS 467
Query: 350 GFIHYLFFVLCLYASVAVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDI 409
G H+L F+ + V S I+ + M + G F+L G+F + I
Sbjct: 468 GATHFLTFLFLVTLVANVATSFGYLISCAFSSTSMALTVGPPFVIPFLLFGGFFINSDSI 527
Query: 410 PKPVWRYPMSYLSFHYWA----LQGQYQNDLKGLWFDNQSPDLPKIPGEYVLENVFQIDV 465
P +++ +SYLS+ + L Q+ + + GE +LE +
Sbjct: 528 PV-YFKW-LSYLSWFRYGNEGLLINQWSDVDNIECTSANTTGPCPSSGEVILE---TLSF 582
Query: 466 RRSK-WIDLSVIFSMIISYRIIFFVMIKI 493
R + ++DL + +I +R++ + ++I
Sbjct: 583 RNADLYLDLIGLVILIFFFRLLAYFALRI 611
|
[Transport and binding proteins, Other]. Length = 617 |
| >gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D | Back alignment and domain information |
|---|
| >gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters | Back alignment and domain information |
|---|
| >gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA | Back alignment and domain information |
|---|
| >gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein | Back alignment and domain information |
|---|
| >gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system | Back alignment and domain information |
|---|
| >gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system | Back alignment and domain information |
|---|
| >gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222036 pfam13304, AAA_21, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234806 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter | Back alignment and domain information |
|---|
| >gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 546 | |||
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 100.0 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 100.0 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 100.0 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 100.0 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 100.0 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 100.0 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 100.0 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 100.0 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 100.0 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.94 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.94 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.93 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.92 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.92 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.92 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.92 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.92 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.92 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.9 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 99.9 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.9 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.9 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.9 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 99.89 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.89 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.89 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.89 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.89 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.89 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.89 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.89 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.89 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.89 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.89 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.89 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.88 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.88 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.88 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.88 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.88 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.88 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.88 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.88 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.88 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.88 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.88 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.88 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.88 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.88 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.88 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.88 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.88 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.88 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.88 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.88 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.88 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.88 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.88 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.88 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.87 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.87 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.87 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 99.87 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.87 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.87 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.87 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 99.87 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.87 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.87 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 99.87 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.87 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.87 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.87 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.87 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.87 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.87 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.87 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.87 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.87 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.87 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 99.87 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.87 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.87 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.87 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 99.86 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.86 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.86 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.86 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.86 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 99.86 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.86 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.86 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.86 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.86 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.86 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.86 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.86 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 99.86 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.86 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.86 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.86 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.86 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.86 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.86 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.86 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.86 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.86 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.86 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.86 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.86 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.86 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.86 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.86 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.86 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 99.86 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.86 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.86 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 99.86 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 99.86 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.85 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 99.85 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.85 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.85 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.85 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.85 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.85 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.85 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.85 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.85 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.85 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.85 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 99.85 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.85 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.85 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.85 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.85 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.85 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.85 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.85 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.85 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.85 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.85 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.85 | |
| PF01061 | 210 | ABC2_membrane: ABC-2 type transporter; InterPro: I | 99.84 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.84 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.84 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.84 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.84 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.84 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.84 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.84 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.84 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.84 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.84 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 99.84 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.84 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.84 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.84 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.84 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.84 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.84 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.84 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.84 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.84 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.84 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.84 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.84 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.84 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.84 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.84 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.84 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.84 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.84 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.83 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.83 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.83 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.83 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.83 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.83 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.83 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.83 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.83 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.83 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.83 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.83 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.83 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.83 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.83 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.83 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.83 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.83 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.83 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.82 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.82 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.82 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.82 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.82 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.82 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.82 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.82 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 99.81 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 99.81 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.81 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 99.81 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 99.81 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.81 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 99.81 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.81 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.81 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.81 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 99.81 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.81 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 99.81 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.81 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.8 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.8 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.8 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 99.8 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.8 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.8 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 99.8 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.8 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 99.8 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.79 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.79 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.79 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 99.79 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 99.79 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 99.79 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 99.79 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 99.79 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 99.79 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.78 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.78 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 99.78 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.78 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.78 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 99.78 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 99.78 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.78 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 99.78 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 99.78 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.78 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.78 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.78 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 99.78 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 99.78 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 99.77 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.77 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.77 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.77 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 99.77 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.77 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 99.77 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.77 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 99.77 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.77 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.77 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.76 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 99.76 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.76 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.76 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.76 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 99.76 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.76 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.76 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 99.75 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 99.75 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.75 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 99.75 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.75 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 99.75 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 99.75 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.74 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.74 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.74 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.74 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.74 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.74 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.74 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.74 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.73 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.73 | |
| KOG0059 | 885 | consensus Lipid exporter ABCA1 and related protein | 99.73 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.73 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 99.73 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.72 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.72 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.72 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.72 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.72 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.72 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 99.72 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.72 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 99.71 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 99.71 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 99.71 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.71 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.71 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.7 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.7 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.7 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.7 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.69 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 99.69 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.69 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 99.69 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.69 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.69 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.69 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.68 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.68 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 99.68 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.67 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.67 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 99.67 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.67 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.67 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.67 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 99.66 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.66 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.66 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.65 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.64 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.63 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.63 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 99.63 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.62 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 99.61 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.61 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 99.61 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.6 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.6 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.6 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.6 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 99.59 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.59 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.58 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.58 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 99.57 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.57 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.55 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.52 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.52 | |
| COG4170 | 330 | SapD ABC-type antimicrobial peptide transport syst | 99.5 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 99.48 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 99.48 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.46 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 99.45 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 99.44 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.44 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.42 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.39 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.38 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.35 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.35 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 99.34 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 99.32 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 99.32 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 99.31 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.31 | |
| TIGR01247 | 236 | drrB daunorubicin resistance ABC transporter membr | 99.28 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.27 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 99.27 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 99.27 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.25 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.24 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 99.24 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 99.23 | |
| TIGR03062 | 208 | pip_yhgE_Cterm YhgE/Pip C-terminal domain. This fa | 99.19 | |
| TIGR01291 | 253 | nodJ ABC-2 type transporter, NodJ family. Nearly a | 99.17 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 99.14 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 99.13 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 99.12 | |
| TIGR00025 | 232 | Mtu_efflux ABC transporter efflux protein, DrrB fa | 99.11 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.09 | |
| TIGR03861 | 253 | phenyl_ABC_PedC alcohol ABC transporter, permease | 99.09 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.08 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 99.05 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 98.99 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.98 | |
| PRK15066 | 257 | inner membrane transport permease; Provisional | 98.96 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 98.92 | |
| KOG2355 | 291 | consensus Predicted ABC-type transport, ATPase com | 98.91 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.91 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 98.9 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.85 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 98.83 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 98.82 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 98.77 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.77 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 98.76 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.76 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 98.69 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 98.61 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 98.57 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 98.55 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 98.54 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 98.53 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 98.52 | |
| COG0842 | 286 | ABC-type multidrug transport system, permease comp | 98.48 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 98.44 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 98.42 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 98.4 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 98.33 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 98.31 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 98.27 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 98.26 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 98.24 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 98.22 | |
| PF13558 | 90 | SbcCD_C: Putative exonuclease SbcCD, C subunit; PD | 98.15 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 98.12 | |
| TIGR01248 | 152 | drrC daunorubicin resistance protein C. The model | 98.1 | |
| TIGR03518 | 240 | ABC_perm_GldF gliding motility-associated ABC tran | 98.1 | |
| PF06422 | 103 | PDR_CDR: CDR ABC transporter; InterPro: IPR010929 | 98.06 | |
| PRK13695 | 174 | putative NTPase; Provisional | 98.02 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 97.97 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 97.86 | |
| PF12679 | 277 | ABC2_membrane_2: ABC-2 family transporter protein | 97.78 | |
| PRK13830 | 818 | conjugal transfer protein TrbE; Provisional | 97.77 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 97.71 | |
| COG1682 | 263 | TagG ABC-type polysaccharide/polyol phosphate expo | 97.64 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 97.61 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 97.5 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.47 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.46 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.37 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 97.32 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.21 | |
| PRK13891 | 852 | conjugal transfer protein TrbE; Provisional | 97.07 | |
| PF13175 | 415 | AAA_15: AAA ATPase domain | 97.03 | |
| PF12698 | 344 | ABC2_membrane_3: ABC-2 family transporter protein; | 96.99 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 96.88 | |
| COG1277 | 278 | NosY ABC-type transport system involved in multi-c | 96.85 | |
| PRK15176 | 264 | Vi polysaccharide export inner membrane protein Ve | 96.85 | |
| PF03379 | 215 | CcmB: CcmB protein; InterPro: IPR003544 Within mit | 96.72 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 96.44 | |
| PF08370 | 65 | PDR_assoc: Plant PDR ABC transporter associated; I | 96.33 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 96.27 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.21 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.16 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.15 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.0 | |
| PRK13873 | 811 | conjugal transfer ATPase TrbE; Provisional | 95.93 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 95.8 | |
| PF13166 | 712 | AAA_13: AAA domain | 95.73 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 95.68 | |
| PRK05399 | 854 | DNA mismatch repair protein MutS; Provisional | 95.47 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 95.17 | |
| COG4587 | 268 | ABC-type uncharacterized transport system, permeas | 94.98 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 94.89 | |
| PRK13898 | 800 | type IV secretion system ATPase VirB4; Provisional | 94.67 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 94.4 | |
| PF12730 | 232 | ABC2_membrane_4: ABC-2 family transporter protein | 94.3 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 93.91 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 93.88 | |
| TIGR01190 | 211 | ccmB heme exporter protein CcmB. This model descri | 93.71 | |
| COG1195 | 363 | RecF Recombinational DNA repair ATPase (RecF pathw | 93.29 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 93.2 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 93.15 | |
| PF12051 | 382 | DUF3533: Protein of unknown function (DUF3533); In | 93.12 | |
| COG4694 | 758 | Uncharacterized protein conserved in bacteria [Fun | 92.73 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 92.68 |
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-87 Score=743.31 Aligned_cols=472 Identities=39% Similarity=0.643 Sum_probs=409.7
Q ss_pred CCHHHHHHHHHHHHHHcCCcccccccccCcccCCCCHHHHHHHHHHHHHHhCCCeEEEeCCCCCCCHHHHHHHHHHHHHH
Q 009019 1 MPWSEKRTLVERTIIEMGLQDCADTVIGNWHLRGISGGERRRVSIALEILMRPRLLFLDEPTSGLDSAAAFFVTQTLRCL 80 (546)
Q Consensus 1 ~~~~~~~~~v~~~l~~lgL~~~~~~~ig~~~~~~lSgGer~Rvsia~~l~~~P~il~LDEPtsgLD~~~~~~v~~~L~~l 80 (546)
+++++++++|++++++|||++|+||+||+...||+||||||||+||.+|++||+||||||||||||+.++.++++.||++
T Consensus 137 ~~~~~k~~~V~~vi~~LgL~~~~~t~ig~~~~rgiSGGErkRvsia~Ell~~P~iLflDEPTSGLDS~sA~~vv~~Lk~l 216 (613)
T KOG0061|consen 137 LSKEEKRERVEEVISELGLEKCADTLIGNPGIRGLSGGERKRVSIALELLTDPSILFLDEPTSGLDSFSALQVVQLLKRL 216 (613)
T ss_pred CCHHHHHHHHHHHHHHcCChhhccceecCCCCCccccchhhHHHHHHHHHcCCCEEEecCCCCCcchhhHHHHHHHHHHH
Confidence 46789999999999999999999999999888999999999999999999999999999999999999999999999999
Q ss_pred HhCCCEEEEEecCCchHHHhhcCeEEEEeCCeEEEecChhHHHHHHHHcCCCCCCCCCChhHHHHHhhcChhhHHHhhhc
Q 009019 81 SRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGETSAAFEFFAQAGFPCPALRNPSDHFLRCINSDFDKVKATLKG 160 (546)
Q Consensus 81 ~~~g~tvi~~~H~p~~~i~~~~D~v~lL~~G~~v~~G~~~~~~~~f~~~g~~~p~~~~p~d~~l~~~~~~~~~~~~~~~~ 160 (546)
|++|+|||+|+|||+++++++||++++|++|+++|+|+++++.+||++.|+|||++.||+||++++++.+ +.....
T Consensus 217 A~~grtVi~tIHQPss~lf~lFD~l~lLs~G~~vy~G~~~~~~~ff~~~G~~~P~~~Npadf~l~l~s~~-~~~~~~--- 292 (613)
T KOG0061|consen 217 ARSGRTVICTIHQPSSELFELFDKLLLLSEGEVVYSGSPRELLEFFSSLGFPCPELENPADFLLDLLSVD-SGTREL--- 292 (613)
T ss_pred HhCCCEEEEEEeCCcHHHHHHHhHhhhhcCCcEEEecCHHHHHHHHHhCCCCCCCcCChHHHHHHHHccC-CCchhH---
Confidence 9999999999999999999999999999999999999999999999999999999999999999998853 111000
Q ss_pred cccccccCCCCcccccchHHHHHHHHHHHhhchhhHHHHHHHH-hhhhccCccccCCCCCCCHHHHHHHHHHHHHHHhhc
Q 009019 161 SMKLKFETSDDPLEKITTAEAIKNLIDFYQTSQHSYAAKEKVE-GISKVKGTVLDAGGSQASFLMQAFTLTKRSFVNMSR 239 (546)
Q Consensus 161 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~s~~~~~~~~~~~-~~~~~~~~~~~~~~~~~s~~~Q~~~L~~R~~~~~~R 239 (546)
...+......+.++..+...+...... ...+ ....+ ....++|+.|++.|++|.+++++|
T Consensus 293 ----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~-~~~~~s~~~q~~~L~~R~~~~~~R 353 (613)
T KOG0061|consen 293 ----------------EEAVRIAKLINKFSQTDNLKKTLEALEKSLST--SKKVE-IGTSPSWWTQFKILLKRSLKNIRR 353 (613)
T ss_pred ----------------HhHHHHHHHhhhccccchhhhhHHHHhhhccc--ccccc-cccCCcHHHHHHHHHHHHhHHHhh
Confidence 001111112222221000000000000 0100 00110 112789999999999999999999
Q ss_pred chhHHHHHHHHHHHHHHHHHHHhccCCCChhhHHhhhhhHHHHHHHHHHHHhh-hhhhHHhhhHHHHHHhhCCCcchHHH
Q 009019 240 DFGYYWLRLVIYVVVTICIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIG-GFPSFVEDMKVFQRERLNGHYGVTAF 318 (546)
Q Consensus 240 d~~~~~~r~~~~i~~~l~iG~lf~~l~~~~~~i~~r~~~lf~~~~~~~f~~~~-~~p~~~~er~vf~RE~~~g~Y~~~~y 318 (546)
||.+.+.|+++.+++|+++|++||+++++..++++|.+++|+...++.|.++. +++.|+.||++|.||+.+|+|+.++|
T Consensus 354 ~~~~~~~r~~~~~~~~~~lg~~~~~~~~~~~~~~~~~g~~~~~~~~~~f~~~~~~i~~f~~e~~~f~rE~~~~~Y~~s~y 433 (613)
T KOG0061|consen 354 DPSLLLLRLIQSLVTGLLLGLLYLNLGNDAKGIQNRLGLFFFILSFMTFLSMFGAVPVFPQERPIFLRETSSGLYRLSSY 433 (613)
T ss_pred cHHHHHHHHHHHHHHHHHHHHHhhCCCCchHHHHHHHHHHHHHHHHHHHHHHHhHHHHhHHHHHHHHHHHhcCchhHHHH
Confidence 99999999999999999999999999999999999999999999999888765 69999999999999999999999999
Q ss_pred HHHHHHHHHhHHHHHHHHHhhhhhccccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHH
Q 009019 319 VIGNTLSAMPFLIMITFISGTICYFMVRLHPGFIHYLFFVLCLYASVAVVESLMMAIASIVPNFLMGIITGAGIQGIFML 398 (546)
Q Consensus 319 ~la~~l~~lP~~~l~~~if~~i~Y~m~Gl~~~~~~f~~f~l~l~l~~~~~~sl~~~i~~~~p~~~~a~~~~~~~~~~~~l 398 (546)
++|++++++|+.++.+++|++|+|||+|+++++.+|++|++++++..++++++++++++++||..+|+++++++.+.|++
T Consensus 434 ~la~~l~~lP~~~i~~~if~~i~Y~m~gl~~~~~~f~~~~l~~~~~~~~a~s~~~~i~~~~~~~~~a~~~~~~~~~~f~l 513 (613)
T KOG0061|consen 434 YLAKTLAELPFLLVLSIIFSSIVYWMVGLNPGLSRFLYFLLIILLSSLVAESLGLFISAIVPNLSLATSLGPVLLLPFLL 513 (613)
T ss_pred HHHHHHHHhHHHHHHHHHHHHHHHHhccCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhccchhheeehHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhccccCCCCCCccccccccccccHHHHHHHHHHHHhhCCCcccCCCC--CCCCcCHHHHHhhhcCcccccchhHHHHHH
Q 009019 399 VSGYFRLPNDIPKPVWRYPMSYLSFHYWALQGQYQNDLKGLWFDNQSP--DLPKIPGEYVLENVFQIDVRRSKWIDLSVI 476 (546)
Q Consensus 399 ~~Gf~i~~~~iP~~~W~~~~~yiS~~~Ya~~~l~~nef~g~~f~~~~~--~~~~~~G~~vL~~~~~~~~~~~~w~~~~iL 476 (546)
|+|||++.++||++ |+ |++|+||++|++||+++|||.+....|... ..+..+|++++.+ .+++. .+.|.|+.++
T Consensus 514 ~~G~fi~~~~ip~~-~~-w~~~~S~~ry~~e~l~~n~~~~~~~~~~~~~~~~~~~~~~~~l~~-~~~~~-~~~~~~l~~l 589 (613)
T KOG0061|consen 514 FGGFFINFDSIPKY-FR-WISYLSYFRYAFEALLINQFSGGSSRCFLSGNLCCESTGEDVLKQ-LGFED-SSFWLDLLVL 589 (613)
T ss_pred HhhhhcCcccccHH-HH-HHHHHhHHHHHHHHHHHHHhhccccccccCcCCcccccHHHHHHh-cCCcc-cccchhHHHH
Confidence 99999999999973 43 599999999999999999998733344332 3477899999998 88864 4699999999
Q ss_pred HHHHHHHHHHHHHHHHHhccccc
Q 009019 477 FSMIISYRIIFFVMIKISEDVTP 499 (546)
Q Consensus 477 ~~~~~~f~~l~~~~l~~~~~~~~ 499 (546)
++++++||+++|++|+++.+.++
T Consensus 590 ~~~~~~~~il~y~~L~~~~~~~~ 612 (613)
T KOG0061|consen 590 LAFIVFFRVLGYLALRFRVKRKR 612 (613)
T ss_pred HHHHHHHHHHHHHHHHhhccccC
Confidence 99999999999999999877653
|
|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF01061 ABC2_membrane: ABC-2 type transporter; InterPro: IPR013525 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >TIGR01247 drrB daunorubicin resistance ABC transporter membrane protein | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03062 pip_yhgE_Cterm YhgE/Pip C-terminal domain | Back alignment and domain information |
|---|
| >TIGR01291 nodJ ABC-2 type transporter, NodJ family | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00025 Mtu_efflux ABC transporter efflux protein, DrrB family | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03861 phenyl_ABC_PedC alcohol ABC transporter, permease protein | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK15066 inner membrane transport permease; Provisional | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0842 ABC-type multidrug transport system, permease component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01248 drrC daunorubicin resistance protein C | Back alignment and domain information |
|---|
| >TIGR03518 ABC_perm_GldF gliding motility-associated ABC transporter permease protein GldF | Back alignment and domain information |
|---|
| >PF06422 PDR_CDR: CDR ABC transporter; InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >PF12679 ABC2_membrane_2: ABC-2 family transporter protein | Back alignment and domain information |
|---|
| >PRK13830 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >COG1682 TagG ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK13891 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >PF13175 AAA_15: AAA ATPase domain | Back alignment and domain information |
|---|
| >PF12698 ABC2_membrane_3: ABC-2 family transporter protein; PDB: 2P0S_B 3CNI_A | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1277 NosY ABC-type transport system involved in multi-copper enzyme maturation, permease component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15176 Vi polysaccharide export inner membrane protein VexB; Provisional | Back alignment and domain information |
|---|
| >PF03379 CcmB: CcmB protein; InterPro: IPR003544 Within mitochondria and bacteria, a family of related proteins is involved in the assembly of periplasmic c-type cytochromes: these include CycK [], CcmF [,], NrfE [] and CcbS [] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF08370 PDR_assoc: Plant PDR ABC transporter associated; InterPro: IPR013581 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK13873 conjugal transfer ATPase TrbE; Provisional | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK05399 DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4587 ABC-type uncharacterized transport system, permease component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13898 type IV secretion system ATPase VirB4; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PF12730 ABC2_membrane_4: ABC-2 family transporter protein | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01190 ccmB heme exporter protein CcmB | Back alignment and domain information |
|---|
| >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12051 DUF3533: Protein of unknown function (DUF3533); InterPro: IPR022703 This transmembrane domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >COG4694 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 546 | ||||
| 2ghi_A | 260 | Crystal Structure Of Plasmodium Yoelii Multidrug Re | 2e-08 | ||
| 3d31_A | 348 | Modbc From Methanosarcina Acetivorans Length = 348 | 5e-08 | ||
| 3b5j_A | 243 | Crystal Structures Of The S504a Mutant Of An Isolat | 5e-08 | ||
| 2pmk_A | 243 | Crystal Structures Of An Isolated Abc-Atpase In Com | 6e-08 | ||
| 1mt0_A | 241 | Atp-Binding Domain Of Haemolysin B From Escherichia | 6e-08 | ||
| 2ff7_A | 247 | The Abc-Atpase Of The Abc-Transporter Hlyb In The A | 6e-08 | ||
| 2olj_A | 263 | Abc Protein Artp In Complex With AdpMG2+ Length = 2 | 7e-08 | ||
| 3c41_J | 242 | Abc Protein Artp In Complex With Amp-PnpMG2+ Length | 7e-08 | ||
| 4ayt_A | 595 | Structure Of The Human Mitochondrial Abc Transporte | 8e-08 | ||
| 2yyz_A | 359 | Crystal Structure Of Sugar Abc Transporter, Atp-Bin | 8e-08 | ||
| 1mv5_A | 243 | Crystal Structure Of Lmra Atp-Binding Domain Length | 1e-07 | ||
| 1vpl_A | 256 | Crystal Structure Of Abc Transporter Atp-binding Pr | 1e-07 | ||
| 4ayw_A | 619 | Structure Of The Human Mitochondrial Abc Transporte | 1e-07 | ||
| 2hyd_A | 578 | Multidrug Abc Transporter Sav1866 Length = 578 | 1e-07 | ||
| 2ffb_A | 247 | The Crystal Structure Of The Hlyb-Nbd E631q Mutant | 1e-07 | ||
| 1q12_A | 381 | Crystal Structure Of The Atp-bound E. Coli Malk Len | 2e-07 | ||
| 1q1b_A | 381 | Crystal Structure Of E. Coli Malk In The Nucleotide | 2e-07 | ||
| 1oxs_C | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 3e-07 | ||
| 4hlu_A | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 4e-07 | ||
| 2yz2_A | 266 | Crystal Structure Of The Abc Transporter In The Cob | 4e-07 | ||
| 3gfo_A | 275 | Structure Of Cbio1 From Clostridium Perfringens: Pa | 4e-07 | ||
| 4fwi_B | 334 | Crystal Structure Of The Nucleotide-binding Domain | 4e-07 | ||
| 2r6g_A | 381 | The Crystal Structure Of The E. Coli Maltose Transp | 4e-07 | ||
| 2onk_A | 240 | Abc Transporter Modbc In Complex With Its Binding P | 5e-07 | ||
| 3g5u_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 5e-07 | ||
| 3g60_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 5e-07 | ||
| 2it1_A | 362 | Structure Of Ph0203 Protein From Pyrococcus Horikos | 7e-07 | ||
| 1b0u_A | 262 | Atp-Binding Subunit Of The Histidine Permease From | 8e-07 | ||
| 1xef_A | 241 | Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI | 9e-07 | ||
| 2ffa_A | 247 | Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr | 9e-07 | ||
| 1oxx_K | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 1e-06 | ||
| 2pcj_A | 224 | Crystal Structure Of Abc Transporter (Aq_297) From | 1e-06 | ||
| 4f4c_A | 1321 | The Crystal Structure Of The Multi-Drug Transporter | 2e-06 | ||
| 1g29_1 | 372 | Malk Length = 372 | 5e-06 | ||
| 1v43_A | 372 | Crystal Structure Of Atpase Subunit Of Abc Sugar Tr | 6e-06 | ||
| 1vci_A | 373 | Crystal Structure Of The Atp-binding Cassette Of Mu | 6e-06 | ||
| 1f3o_A | 235 | Crystal Structure Of Mj0796 Atp-Binding Cassette Le | 9e-06 | ||
| 2nq2_C | 253 | An Inward-Facing Conformation Of A Putative Metal-C | 1e-05 | ||
| 3b5x_A | 582 | Crystal Structure Of Msba From Vibrio Cholerae Leng | 1e-05 | ||
| 3b5y_A | 582 | Crystal Structure Of Msba From Salmonella Typhimuri | 2e-05 | ||
| 4g1u_C | 266 | X-Ray Structure Of The Bacterial Heme Transporter H | 2e-05 | ||
| 1l2t_A | 235 | Dimeric Structure Of Mj0796, A Bacterial Abc Transp | 3e-05 | ||
| 3bk7_A | 607 | Structure Of The Complete Abce1RNAASE-L Inhibitor P | 4e-05 | ||
| 3j15_B | 593 | Model Of Ribosome-Bound Archaeal Pelota And Abce1 L | 5e-05 | ||
| 2d62_A | 375 | Crystal Structure Of Multiple Sugar Binding Transpo | 5e-05 | ||
| 3nh6_A | 306 | Nucleotide Binding Domain Of Human Abcb6 (Apo Struc | 8e-05 | ||
| 1z47_A | 355 | Structure Of The Atpase Subunit Cysa Of The Putativ | 8e-05 | ||
| 3tif_A | 235 | Dimeric Structure Of A Post-Hydrolysis State Of The | 9e-05 | ||
| 3b5w_A | 582 | Crystal Structure Of Eschericia Coli Msba Length = | 1e-04 | ||
| 3qf4_A | 587 | Crystal Structure Of A Heterodimeric Abc Transporte | 1e-04 | ||
| 4hlu_D | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 2e-04 | ||
| 1yqt_A | 538 | Rnase-L Inhibitor Length = 538 | 3e-04 | ||
| 3qf7_A | 365 | The Mre11:rad50 Complex Forms An Atp Dependent Mole | 5e-04 | ||
| 2ixf_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 7e-04 | ||
| 1ji0_A | 240 | Crystal Structure Analysis Of The Abc Transporter F | 7e-04 |
| >pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 | Back alignment and structure |
|
| >pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 | Back alignment and structure |
| >pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 | Back alignment and structure |
| >pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 | Back alignment and structure |
| >pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 | Back alignment and structure |
| >pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 | Back alignment and structure |
| >pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 | Back alignment and structure |
| >pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 | Back alignment and structure |
| >pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 | Back alignment and structure |
| >pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 | Back alignment and structure |
| >pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 | Back alignment and structure |
| >pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 | Back alignment and structure |
| >pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 | Back alignment and structure |
| >pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 | Back alignment and structure |
| >pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 | Back alignment and structure |
| >pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 | Back alignment and structure |
| >pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 | Back alignment and structure |
| >pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 | Back alignment and structure |
| >pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 | Back alignment and structure |
| >pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 | Back alignment and structure |
| >pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 | Back alignment and structure |
| >pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 | Back alignment and structure |
| >pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 | Back alignment and structure |
| >pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 | Back alignment and structure |
| >pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 | Back alignment and structure |
| >pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 | Back alignment and structure |
| >pdb|1G29|1 Chain 1, Malk Length = 372 | Back alignment and structure |
| >pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 | Back alignment and structure |
| >pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 | Back alignment and structure |
| >pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 | Back alignment and structure |
| >pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 | Back alignment and structure |
| >pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 | Back alignment and structure |
| >pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 | Back alignment and structure |
| >pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 | Back alignment and structure |
| >pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 | Back alignment and structure |
| >pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 | Back alignment and structure |
| >pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 | Back alignment and structure |
| >pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 | Back alignment and structure |
| >pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 | Back alignment and structure |
| >pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 | Back alignment and structure |
| >pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 | Back alignment and structure |
| >pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 | Back alignment and structure |
| >pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 | Back alignment and structure |
| >pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 | Back alignment and structure |
| >pdb|3QF7|A Chain A, The Mre11:rad50 Complex Forms An Atp Dependent Molecular Clamp In Dna Double-Strand Break Repair Length = 365 | Back alignment and structure |
| >pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 | Back alignment and structure |
| >pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 546 | |||
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 3e-19 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 5e-19 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 5e-18 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 6e-18 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 6e-18 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 2e-16 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 1e-15 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 5e-13 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 1e-12 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 5e-12 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 4e-11 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 6e-12 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 6e-10 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 9e-12 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 1e-10 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 1e-11 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 3e-11 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 4e-11 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 1e-10 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 3e-10 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 6e-10 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 1e-09 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 2e-09 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 9e-09 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 2e-08 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 3e-08 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 3e-08 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 8e-08 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 1e-06 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 1e-07 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 1e-07 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 1e-07 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 1e-06 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 1e-06 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 2e-06 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 3e-06 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 9e-06 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 1e-05 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 5e-05 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 5e-05 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 5e-05 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 7e-05 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 9e-05 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 1e-04 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 |
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 | Back alignment and structure |
|---|
Score = 86.4 bits (215), Expect = 3e-19
Identities = 41/117 (35%), Positives = 58/117 (49%), Gaps = 6/117 (5%)
Query: 1 MPWSEKRTLVERTIIEMGLQDCADTVIGNWHLRGISGGERRRVSIALEILMRPRLLFLDE 60
SE +VER GL + + + S G R++ IA +++ PRL LDE
Sbjct: 118 SSSSEIEEMVERATEIAGLGEKIKDRVSTY-----SKGMVRKLLIARALMVNPRLAILDE 172
Query: 61 PTSGLDSAAAFFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFG 117
PTSGLD A V + L+ S++G T++ S H EV L DR+ L+ G V G
Sbjct: 173 PTSGLDVLNAREVRKILKQASQEGLTILVSSHN-MLEVEFLCDRIALIHNGTIVETG 228
|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 546 | |||
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.93 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.92 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.92 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.92 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.92 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.91 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.91 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.91 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.91 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.91 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.91 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.91 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.91 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.91 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.9 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.9 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.9 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.9 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.9 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.9 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.9 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.9 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.9 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.9 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.89 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.89 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.87 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.87 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.87 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.87 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.86 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.86 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.84 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.83 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.83 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.83 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.83 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.83 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 99.82 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.82 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 99.81 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.81 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 99.81 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.81 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.81 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.8 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.8 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.79 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.78 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.78 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.78 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.78 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.77 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.77 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.77 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.76 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.76 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.75 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.75 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.75 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.74 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.74 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.73 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.73 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.73 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 99.73 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.72 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.71 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.7 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 99.66 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 99.55 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 99.54 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.54 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 99.54 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 99.52 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 99.44 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 99.41 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 99.37 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 99.34 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 99.33 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.14 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 99.12 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 98.93 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 98.91 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 98.9 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 98.65 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 98.63 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 98.63 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 98.61 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 98.58 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 98.56 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 98.53 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 98.47 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 98.3 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 98.27 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.26 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 98.23 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 98.22 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 98.19 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 98.15 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 98.14 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 98.09 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 98.07 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 98.06 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.98 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.94 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.94 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.86 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.73 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.71 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.66 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.65 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.49 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 97.38 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 97.33 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.2 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.02 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.9 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.9 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.74 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 96.27 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.25 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.18 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.11 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 96.09 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.07 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.02 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 95.8 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 95.56 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.46 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 95.46 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 95.39 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.31 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 94.72 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 94.52 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 93.91 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 93.73 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 93.33 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 93.26 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 92.8 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 91.97 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 91.02 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 90.08 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 89.9 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 89.68 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 89.54 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 88.48 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 88.42 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 87.37 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 85.56 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 85.38 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 82.54 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 81.81 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 81.81 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 81.36 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 81.29 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 80.37 |
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
Probab=99.93 E-value=2.5e-25 Score=224.15 Aligned_cols=117 Identities=28% Similarity=0.459 Sum_probs=107.2
Q ss_pred CHHHHHHHHHHHHHHcCCcccccccccCcccCCCCHHHHHHHHHHHHHHhCCCeEEEeCCCCCCCHHHHHHHHHHHHHHH
Q 009019 2 PWSEKRTLVERTIIEMGLQDCADTVIGNWHLRGISGGERRRVSIALEILMRPRLLFLDEPTSGLDSAAAFFVTQTLRCLS 81 (546)
Q Consensus 2 ~~~~~~~~v~~~l~~lgL~~~~~~~ig~~~~~~lSgGer~Rvsia~~l~~~P~il~LDEPtsgLD~~~~~~v~~~L~~l~ 81 (546)
++++.+++++++++.+||++.+|+.+ .+|||||||||+||++|+.+|++|+|||||+|||+.++.++++.|++++
T Consensus 116 ~~~~~~~~~~~~l~~~~L~~~~~~~~-----~~LSgGqkQRv~iAraL~~~P~lLlLDEPts~LD~~~~~~i~~~l~~l~ 190 (275)
T 3gfo_A 116 PEDEIRKRVDNALKRTGIEHLKDKPT-----HCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQ 190 (275)
T ss_dssp CHHHHHHHHHHHHHHTTCGGGTTSBG-----GGSCHHHHHHHHHHHHHTTCCSEEEEECTTTTCCHHHHHHHHHHHHHHH
T ss_pred CHHHHHHHHHHHHHHcCCchhhcCCc-----ccCCHHHHHHHHHHHHHHcCCCEEEEECccccCCHHHHHHHHHHHHHHH
Confidence 35566788999999999999888855 4699999999999999999999999999999999999999999999998
Q ss_pred -hCCCEEEEEecCCchHHHhhcCeEEEEeCCeEEEecChhHHHH
Q 009019 82 -RDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGETSAAFE 124 (546)
Q Consensus 82 -~~g~tvi~~~H~p~~~i~~~~D~v~lL~~G~~v~~G~~~~~~~ 124 (546)
++|+|||+++|++ .++.+++|+|++|++|++++.|+++++.+
T Consensus 191 ~~~g~tvi~vtHdl-~~~~~~~drv~~l~~G~i~~~g~~~~~~~ 233 (275)
T 3gfo_A 191 KELGITIIIATHDI-DIVPLYCDNVFVMKEGRVILQGNPKEVFA 233 (275)
T ss_dssp HHHCCEEEEEESCC-SSGGGGCSEEEEEETTEEEEEECHHHHTH
T ss_pred hhCCCEEEEEecCH-HHHHHhCCEEEEEECCEEEEECCHHHHhc
Confidence 5699999999996 67889999999999999999999988643
|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 546 | ||||
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 4e-18 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 4e-18 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 1e-17 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 5e-17 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 3e-16 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 5e-16 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 6e-16 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 7e-16 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 2e-15 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 2e-15 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 9e-15 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 1e-14 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 3e-13 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 3e-13 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 4e-13 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 5e-12 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 9e-11 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 8e-10 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 2e-09 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 3e-08 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 3e-08 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 6e-08 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 2e-04 |
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Branched chain aminoacid ABC transporter species: Thermotoga maritima, TM1139 [TaxId: 2336]
Score = 81.5 bits (201), Expect = 4e-18
Identities = 28/123 (22%), Positives = 57/123 (46%), Gaps = 6/123 (4%)
Query: 2 PWSEKRTLVERTIIEMGLQDCADTVIGNWHLRGISGGERRRVSIALEILMRPRLLFLDEP 61
KR L + L++ + G +SGGE++ ++I ++ RP+LL +DEP
Sbjct: 112 KEGIKRDLEWIFSLFPRLKERLKQLGGT-----LSGGEQQMLAIGRALMSRPKLLMMDEP 166
Query: 62 TSGLDSAAAFFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGETSA 121
+ GL V + ++ ++++G T++ ++ Y+L G+ V G+ S
Sbjct: 167 SLGLAPILVSEVFEVIQKINQEGTTILLVEQNA-LGALKVAHYGYVLETGQIVLEGKASE 225
Query: 122 AFE 124
+
Sbjct: 226 LLD 228
|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 546 | |||
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.96 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.95 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.95 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.95 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.95 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.95 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.94 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.94 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.94 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.94 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.93 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.93 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.91 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.91 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.9 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.9 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.89 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.89 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.87 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.71 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.52 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.22 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 98.81 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 98.06 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.97 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 97.16 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 92.56 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 89.66 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 82.67 |
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Maltose transport protein MalK, N-terminal domain species: Archaeon Thermococcus litoralis [TaxId: 2265]
Probab=99.96 E-value=1.4e-28 Score=239.47 Aligned_cols=118 Identities=27% Similarity=0.463 Sum_probs=109.8
Q ss_pred CCHHHHHHHHHHHHHHcCCcccccccccCcccCCCCHHHHHHHHHHHHHHhCCCeEEEeCCCCCCCHHHHHHHHHHHHHH
Q 009019 1 MPWSEKRTLVERTIIEMGLQDCADTVIGNWHLRGISGGERRRVSIALEILMRPRLLFLDEPTSGLDSAAAFFVTQTLRCL 80 (546)
Q Consensus 1 ~~~~~~~~~v~~~l~~lgL~~~~~~~ig~~~~~~lSgGer~Rvsia~~l~~~P~il~LDEPtsgLD~~~~~~v~~~L~~l 80 (546)
+++++++++++++++.+||++.+|++ +++|||||||||+|||+|+++|++|+|||||+|||+.++.++++.|+++
T Consensus 111 ~~~~e~~~~v~~~l~~~~l~~~~~~~-----p~~LSGGqkQRv~IAraL~~~P~iLllDEPt~~LD~~~~~~i~~~l~~l 185 (240)
T d1g2912 111 VPRQEIDQRVREVAELLGLTELLNRK-----PRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKL 185 (240)
T ss_dssp CCHHHHHHHHHHHHHHHTCGGGTTCC-----GGGSCHHHHHHHHHHHHHHTCCSEEEEECTTTTSCHHHHHHHHHHHHHH
T ss_pred CCHHHHHHHHHHHHHHcCChhHhcCC-----hhhCCHHHHHHHHHHHHHhcCCCEEEecCCCcccCHHHHHHHHHHHHHH
Confidence 35778899999999999999988874 4679999999999999999999999999999999999999999999999
Q ss_pred HhC-CCEEEEEecCCchHHHhhcCeEEEEeCCeEEEecChhHHHH
Q 009019 81 SRD-GRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGETSAAFE 124 (546)
Q Consensus 81 ~~~-g~tvi~~~H~p~~~i~~~~D~v~lL~~G~~v~~G~~~~~~~ 124 (546)
.++ |.|||++||++ .++.++||||++|++|++++.|+++++.+
T Consensus 186 ~~~~g~tvi~vTHd~-~~~~~~~drv~vm~~G~iv~~G~~~el~~ 229 (240)
T d1g2912 186 QRQLGVTTIYVTHDQ-VEAMTMGDRIAVMNRGVLQQVGSPDEVYD 229 (240)
T ss_dssp HHHHTCEEEEEESCH-HHHHHHCSEEEEEETTEEEEEECHHHHHH
T ss_pred HhccCCEEEEEcCCH-HHHHHhCCEEEEEECCEEEEEcCHHHHHh
Confidence 875 99999999994 89999999999999999999999998754
|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|