Citrus Sinensis ID: 009074

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540----
MIDLISNLLCSLFFAMSKITILCSMGADFALNLPVFPKLTEELSKVEEKLKLAENLIETKNLEIKKINDEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDRLAITERTAKSEAQLKEKYHLRLKVLEESLRGSSNGSGRSTSDGRSISNGSSRRQSLGGADNISKLTSNGFISKRTPSSRSLSSSTVLKHAKGTSKSFDGGTRSLDRSKVLLNGSPNQSIDATKDSDTPNTWKGNLEDKPSEFQSTDTEDSVPGVLYDLLQKEVVALRKAGHEKDQSLKDKDDAIEILAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKDHENRAKRFGNTKGPVSSAQLLPGRNVPRSGLTRSTQ
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHccccccccccccccccHccccccccccccHHHHHHHHccccccccccccHHHHHHHccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
**DLISNLLCSLFFAMSKITILCSMGADFALNLPVFPKLTEELSKVEEKLKLAENLIETKNLEI**************************************ILAPL**************************************VQVALA*****************QIEICQEENKILD******VAEVEKLTQTVRELEEAVLAGGAAANAV**********************RAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQG****************************************************************************************************************************************************************GVLYDLLQKEVVAL*******************ILA************************************************************************
xxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDLISNLLCSLFFAMSKITILCSMGADFALNLPVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAIxxxxxxxxxxxxxxxxxxxxxxxxxxxxTKSKEAALLEAERTVQVALAKASMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLAGGAAANAxxxxxxxxxxxxxxxxxxxxxxxxxxxxANRVATVVANEWKDANDKVMPxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKSEAQLKEKYHLRLKVLEESLRGSSNGSGRSTSDGRSISNGSSRRQSLGGADNISKLTSNGFISKRTPSSRSLSSSTVLKHAKGTSKSFDGGTRSLDRSKVLLNGSPNQSIDATKDSDTPNTWKGNLEDKPSEFQSTDTEDSVPGVLYDLLQKEVVALRKAGHEKDQSLKDKDDAIEILAKKVDTLxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDHENRAKRFGNTKGPVSSAQLLPGRNVPRSGLTRSTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Microtubule-associated protein 70-2 Plant-specific protein that interact with microtubules.confidentQ6Z746
Microtubule-associated protein 70-2 Plant-specific protein that interact with microtubules.probableQ8L7S4
Microtubule-associated protein 70-1 Plant-specific protein that interact with microtubules. In association with MAP70.5, is essential for the normal banding pattern of secondary cell wall and for the proper development of xylem tracheary elements and wood formation.probableQ9C9X0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 270-305
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 34-73
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 115-143,154-183
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 104-206
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 178-236
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1g8x, chain Aprobable Alignment | Template Structure