Citrus Sinensis ID: 009116

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540---
MAIELSNLMERSLSMLSSDHKSVVSMNLFVALLCACIVIGHLLEENRWMNESITALIIGLCTGIVILLTTNGTSSHVLMFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISFVIISAGAVHFFKQMNIGTLKIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFNAIQSFDLSHINLSIALKFVGSFFYLFIASTMLGVIAGLLSAFIIKKLYMGRHSTDREVALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAEIFIFLYVGMDALDIEKWRVVRDSPGKSVGVSAILLGLVLLGRAAFVFPLSFLSNLTKKSSHEKIGLKQQLTIWWAGLMRGAVSMALAYKQFTSSGHTKLHGNAIMITSTITVVLFSTVVFGLMTQPLVRILLPSSKNLSRMLSDESSTPKSFIVPLLGNGQGSEADLKTPNVTRPTSLRMLLATPSHTVHHYWRKFDDAFMRPVFGGRGFVPVVPGSPLEQSVHQWQQE
ccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHcccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccHHHHHHHHHHHHHccccccccccccHHHHHHHEEEEHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHHHccccccccccccccccccccccccccccccc
******************DHKSVVSMNLFVALLCACIVIGHLLEENRWMNESITALIIGLCTGIVILLTTNGTSSHVLMFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISFVIISAGAVHFFKQMNIGTLKIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFNAIQSFDLSHINLSIALKFVGSFFYLFIASTMLGVIAGLLSAFIIKKLYMGRHSTDREVALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAEIFIFLYVGMDALDIEKWRVVRDSPGKSVGVSAILLGLVLLGRAAFVFPLSFLSNLTKKSSHEKIGLKQQLTIWWAGLMRGAVSMALAYKQFTSSGHTKLHGNAIMITSTITVVLFSTVVFGLMTQPLVRILL*********************************************LRMLLATPSHTVHHYWRKFDDAFMRPVFGGRGFVPVVP**************
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIELSNLMERSLSMLSSDHKSVVSMNLFVALLCACIVIGHLLEENRWMNESITALIIGLCTGIVILLTTNGTSSHVLMFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISFVIISAGAVHFFKQMNIGTLKIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFNAIQSFDLSHINLSIALKFVGSFFYLFIASTMLGVIAGLLSAFIIKKLYMGRHSTDREVALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAEIFIFLYVGMDALDIEKWRVVRDSPGKSVGVSAILLGLVLLGRAAFVFPLSFLSNLTKKSSHEKIGLKQQLTIWWAGLMRGAVSMALAYKQFTSSGHTKLHGNAIMITSTITVVLFSTVVFGLMTQPLVRILLPSSKNLSRMLSDESSTPKSFIVPLLGNGQGSEADLKTPNVTRPTSLRMLLATPSHTVHHYWRKFDDAFMRPVFGGRGFVPVVPGSPLEQSVHQWQQE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 2 Acts in low affinity electroneutral exchange of protons for cations such as Na(+) or K(+) across membranes. May also exchange Li(+) and Cs(+) with a lower affinity. Involved in vacuolar ion compartmentalization necessary for cell volume regulation and cytoplasmic Na(+) detoxification.confidentQ56XP4
Sodium/hydrogen exchanger 3 May act in low affinity electroneutral exchange of protons for cations such as Na(+) or K(+) across membranes. May also exchange Li(+) and Cs(+) with a lower affinity.probableQ84WG1
Sodium/hydrogen exchanger 1 Acts in low affinity electroneutral exchange of protons for cations such as Na(+) or K(+) across membranes. Can also exchange Li(+) and Cs(+) with a lower affinity. Involved in vacuolar ion compartmentalization necessary for cell volume regulation and cytoplasmic Na(+) detoxification. Required during leaves expansion, probably to stimulate epidermal cell expansion. Confers competence to grow in high salinity conditions.probableQ68KI4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZCD, chain A
Confidence level:confident
Coverage over the Query: 84-445
View the alignment between query and template
View the model in PyMOL
Template: 3ZUX, chain A
Confidence level:confident
Coverage over the Query: 85-231
View the alignment between query and template
View the model in PyMOL