Citrus Sinensis ID: 009156

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540--

MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPFMEFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRGGDIKKTAEDLDEFMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQLRDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDEVVDTVGVTALPSEDSISERRRKLEFLEMQEELIKEEEEEEEEEQAKMKEAVRSRKDVALEEMTDPTAKEAQEQAKAKTLEKHEQLCELSRALAVLASASSVSHEREEFLRLVNKEIELYNSMVEKDGKVGEEEAKKAYRAAREETDQDAGEDVDEKVSSALINRVDAMLQKLEKEIDDVDAKIGDRWRLLDRDYDGKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVKLASQTEDTETAETGRS

ccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHcccc

ccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHEEEEEHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHEccccccHHHHHHHHHHHccHHHHHHHEEEHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHHcccccccc

MQHYWLGTKLLWADIRISSRLLLKLVngkglsrreRQQLTRTTADIFRLVPVAVFIIVPFMEFLLPVFLKlfpnmlpstfqDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQnsrggdikKTAEDLDEFMNKVrtgagvsndEILAFAKLFNdeltldnisrprLVNMCKymgispfgtDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQLRDWLDlslnhsvpssLLILSRAFsvsgkvrpeEAVQATLsslpdevvdtvgvtalpsedsiSERRRKLEFLEMQEELIKEEEEEEEEEQAKMKEAVRSRKDVALEEMTDPTAKEAQEQAKAKTLEKHEQLCELSRALAVLASASSVSHEREEFLRLVNKEIELYNSMvekdgkvgEEEAKKAYRAAREetdqdagedvDEKVSSALINRVDAMLQKLEKEIDDVdakigdrwrlldrdydgkVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVKLASqtedtetaetgrs

MQHYWLGTKLLWADIRISSRLLLKlvngkglsrrerqqltrttadifrlvPVAVFIIVPFMEFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKevqnsrggdikkTAEDLDEFMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQLRDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQatlsslpdevvdtvgvtalpsedsiserrRKLEFLEMQEELikeeeeeeeeeqakmkeavrsrKDVALEEMTDPTAKEAQEQAKAKTLEKHEQLCELSRALAVLAsassvshereEFLRLVNKEIELYNSmvekdgkvgeEEAKKAYRAAreetdqdagedvdEKVSSALINRVDAMLQKLekeiddvdakigdrwrlldrdydgkVTAEEVASAAMYLKDTLDKEGIQELIAnlskdregkiLVEDIVklasqtedtetaetgrs

MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPFMEFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRGGDIKKTAEDLDEFMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQLRDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDEVVDTVGVTALPSEDSISERRRKLeflemqeelikeeeeeeeeeqakmkeaVRSRKDVALEEMTDPtakeaqeqakaktlekHEQLCELSRalavlasassvsHEREEFLRLVNKEIELYNSMVEKDGKVGeeeakkayraareeTDQDAGEDVDEKVSSALINRVDAMLQKLEKEIDDVDAKIGDRWRLLDRDYDGKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVKLASQTEDTETAETGRS

**HYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPFMEFLLPVFLKLFPNMLPSTFQ*******ALKRRLIARIEYAKFLQDTV************************FMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIK******************LRQACRDRGLLGLLSVEEMRQQLRDWLDLSLNHSVPSSLLILSRAFSVS***********************V********************************************************************************CELSRALAVLA**********EFLRLVNKEIELYN****************************************LINRVDAMLQKLEKEIDDVDAKIGDRWRLLDRDYDGKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVK****************

MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPFMEFLLPVFLKLFPNMLPSTFQDKMREEE************AKF***********************AEDLDEFMNKV*****VSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQLRDWLDLSLNHSVPSSLLILSRAFS**************************************************************************************************************************************************************************************************************************VTAEEVASAA**********GIQELIANLSKDREGKILVEDIVKLASQ************

MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPFMEFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRGGDIKKTAEDLDEFMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQLRDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDEVVDTVGVTALPSEDSISERRRKLEFLEMQEEL********************SRKDVALEEM******************KHEQLCELSRALAVLAS*********EFLRLVNKEIELYNSMVEKDGKVGEEE**********************KVSSALINRVDAMLQKLEKEIDDVDAKIGDRWRLLDRDYDGKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVKLASQ************

MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPFMEFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNS****I*KTAEDLDEFMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQLRDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDEVVDTVGVTALPSEDSISERRRKLEFLEMQEELIKEEEEEEEEE***************************************EQLCELSRALAVLASASSVSHEREEFLRLVNKEIELYNSMVEKDGKVGEEEAKKAYRAAREETDQDAGEDVDEKVSSALINRVDAMLQKLEKEIDDVDAKIGDRWRLLDRDYDGKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVKLASQTED*********

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPFMEFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRGGDIKKTAEDLDEFMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQLRDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDEVVDTVGVTALPSEDSISERRRKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDVALEEMTDPTAKEAQEQAKAKTLEKHEQLCELSRALAVLASASSVSHEREEFLRLVNKEIELYNSMVEKDGKVGEEEAKKAYRAAREETDQDAGEDVDEKVSSALxxxxxxxxxxxxxxxxxxxxxIGDRWRLLDRDYDGKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVKLASQTEDTETAETGRS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		542	2.2.26 [Sep-21-2011]
Q5ZK33		752	LETM1 and EF-hand domain-	yes	no	0.599	0.432	0.486	3e-85
Q0VCA3		732	LETM1 and EF-hand domain-	yes	no	0.610	0.452	0.461	4e-80
Q1LY46		757	LETM1 and EF-hand domain-	yes	no	0.629	0.450	0.451	2e-79
Q0VA06		760	LETM1 and EF-hand domain-	yes	no	0.944	0.673	0.361	5e-77
Q5XIN6		739	LETM1 and EF-hand domain-	yes	no	0.645	0.473	0.456	3e-75
Q9Z2I0		738	LETM1 and EF-hand domain-	yes	no	0.618	0.453	0.458	9e-74
O95202		739	LETM1 and EF-hand domain-	yes	no	0.942	0.691	0.367	1e-73
P91927		1013	LETM1 and EF-hand domain-	yes	no	0.516	0.276	0.465	2e-70
Q7TNU7		480	LETM1 domain-containing p	no	no	0.536	0.606	0.450	1e-61
Q2VYF4		491	LETM1 domain-containing p	no	no	0.477	0.527	0.481	5e-60

>sp\|Q5ZK33\|LETM1_CHICK LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Gallus gallus GN=LETM1 PE=2 SV=1	Back alignment and function desciption

 Score =  316 bits (810), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 161/331 (48%), Positives = 227/331 (68%), Gaps = 6/331 (1%)

Query: 1   MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPF 60
           ++HY+ G +LLW D +I++R+L ++++G  LSRRER+Q  R  AD+FRLVP  VF++VPF
Sbjct: 158 LKHYYHGFRLLWIDTKIAARMLWRILHGNTLSRRERRQFLRICADLFRLVPFLVFLVVPF 217

Query: 61  MEFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRG 120
           MEFLLPV LKLFPNMLPSTF+ K ++EE LK++L  ++E AKFLQDT++EMA + + ++G
Sbjct: 218 MEFLLPVALKLFPNMLPSTFETKSKKEERLKKQLRVKLELAKFLQDTIEEMALKNKAAKG 277

Query: 121 GDIKKTAEDLDEFMNKVR-TGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGIS 179
              K    D   F  K+R TG   SN+EIL F+KLF DELTLDN++RP+LV +CK + + 
Sbjct: 278 NVTK----DFSTFFQKIRETGERPSNEEILRFSKLFEDELTLDNLTRPQLVALCKLLELQ 333

Query: 180 PFGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEE-MRQ 238
             GT+ +LR+ L  RL+ IK DDKMI  EGV+SL+  EL+ ACR RG+  L   EE +R+
Sbjct: 334 SIGTNNFLRFQLTMRLRTIKADDKMIAEEGVDSLTVKELQAACRARGMRALGVTEERLRE 393

Query: 239 QLRDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDEVVDTVGVTALPSE 298
           QL+ WLDL LN  +P+SLLILSRA  +   + P + ++ TL +LP+ V     V     E
Sbjct: 394 QLKQWLDLHLNQEIPTSLLILSRAMYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAEVE 453

Query: 299 DSISERRRKLEFLEMQEELIKEEEEEEEEEQ 329
               + + +LE    +E  I++E EE+E E+
Sbjct: 454 GEKVDNKARLEATLQEEAAIRKENEEKEMER 484

Crucial for the maintenance of mitochondrial tubular networks and for the assembly of the supercomplexes of the respiratory chain.
Gallus gallus (taxid: 9031)

>sp\|Q0VCA3\|LETM1_BOVIN LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Bos taurus GN=LETM1 PE=2 SV=1	Back alignment and function description

>sp\|Q1LY46\|LETM1_DANRE LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Danio rerio GN=letm1 PE=3 SV=2	Back alignment and function description

>sp\|Q0VA06\|LETM1_XENTR LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Xenopus tropicalis GN=letm1 PE=2 SV=1	Back alignment and function description

>sp\|Q5XIN6\|LETM1_RAT LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Rattus norvegicus GN=Letm1 PE=1 SV=1	Back alignment and function description

>sp\|Q9Z2I0\|LETM1_MOUSE LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Mus musculus GN=Letm1 PE=2 SV=1	Back alignment and function description

>sp\|O95202\|LETM1_HUMAN LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Homo sapiens GN=LETM1 PE=1 SV=1	Back alignment and function description

>sp\|P91927\|A60DA_DROME LETM1 and EF-hand domain-containing protein anon-60Da, mitochondrial OS=Drosophila melanogaster GN=Letm1 PE=2 SV=2	Back alignment and function description

>sp\|Q7TNU7\|LETM2_MOUSE LETM1 domain-containing protein LETM2, mitochondrial OS=Mus musculus GN=Letm2 PE=2 SV=1	Back alignment and function description

>sp\|Q2VYF4\|LETM2_HUMAN LETM1 domain-containing protein LETM2, mitochondrial OS=Homo sapiens GN=LETM2 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		542
224101261		687	predicted protein [Populus trichocarpa]	1.0	0.788	0.874	0.0
224109172		658	predicted protein [Populus trichocarpa]	0.992	0.817	0.888	0.0
255547432		758	leucine zipper-ef-hand containing transm	0.977	0.699	0.892	0.0
225434179		764	PREDICTED: LETM1 and EF-hand domain-cont	0.996	0.706	0.855	0.0
449477676		756	PREDICTED: LETM1 and EF-hand domain-cont	0.998	0.715	0.846	0.0
449470263		746	PREDICTED: LETM1 and EF-hand domain-cont	0.979	0.711	0.821	0.0
224092862		750	predicted protein [Populus trichocarpa]	0.992	0.717	0.842	0.0
297841081		747	calcium-binding EF hand family protein [	0.994	0.721	0.836	0.0
356566963		761	PREDICTED: LETM1 and EF-hand domain-cont	1.0	0.712	0.824	0.0
42562974		736	LETM1-like protein [Arabidopsis thaliana	0.977	0.720	0.835	0.0

>gi\|224101261\|ref\|XP_002312206.1\| predicted protein [Populus trichocarpa] gi\|222852026\|gb\|EEE89573.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/543 (87%), Positives = 512/543 (94%), Gaps = 1/543 (0%)

Query: 1   MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPF 60
           +QHYWLGTKLLWAD+RI SRLL+KL NGKGLSRRERQQLTRTTADIFRLVP AVFIIVPF
Sbjct: 145 LQHYWLGTKLLWADVRIGSRLLVKLANGKGLSRRERQQLTRTTADIFRLVPFAVFIIVPF 204

Query: 61  MEFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRG 120
           MEFLLPVFLKLFPNMLPSTFQD+M+E+EALKR+L ARIEYAKFLQDTVKEMAKEVQ SR 
Sbjct: 205 MEFLLPVFLKLFPNMLPSTFQDRMKEQEALKRKLNARIEYAKFLQDTVKEMAKEVQTSRS 264

Query: 121 GDIKKTAEDLDEFMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISP 180
           G+ K+TAEDLDEFMNKVRTG+ VSN+EIL FAKLFNDELTLDNISRPRLVNMCKYMGISP
Sbjct: 265 GEAKQTAEDLDEFMNKVRTGSRVSNEEILGFAKLFNDELTLDNISRPRLVNMCKYMGISP 324

Query: 181 FGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQL 240
           +GTDAYLRYMLRRRLQEIK+DDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQL
Sbjct: 325 YGTDAYLRYMLRRRLQEIKSDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQL 384

Query: 241 RDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDEVVDTVGVTALPSEDS 300
            DWLDLSLN SVPSSLLILSRAFS+SGKVRPEEAVQATLSSLPDEVVDTVGVTALPSEDS
Sbjct: 385 HDWLDLSLNRSVPSSLLILSRAFSISGKVRPEEAVQATLSSLPDEVVDTVGVTALPSEDS 444

Query: 301 ISERRRKLEFLEMQEELIKEEEEEEEEEQAKMKEAVRSRKDVALEEMTDPTAKEAQEQAK 360
           +SERRRKLE+LEMQEELIKEEEEEEEEEQAKMKE+V S+KDVALEEM+ PTA++A+EQAK
Sbjct: 445 VSERRRKLEYLEMQEELIKEEEEEEEEEQAKMKESVSSQKDVALEEMSIPTARDAREQAK 504

Query: 361 AKTLEKHEQLCELSRALAVLASASSVSHEREEFLRLVNKEIELYNSMVEKDGKVGEEEAK 420
           AKTLEKHEQLCELSRALAVLASASSVS EREEFLRLV KEI+LYN+MV+K+G  GEEEAK
Sbjct: 505 AKTLEKHEQLCELSRALAVLASASSVSREREEFLRLVKKEIDLYNNMVDKEGTEGEEEAK 564

Query: 421 KAYRAAREETDQDAGEDVDEKVSSALINRVDAMLQKLEKEIDDVDAKIGDRWRLLDRDYD 480
           KAY+AAREE+DQ A   + +K+SSALINRVDAMLQKLEKEIDDVDAKIGDRWRLLDRDYD
Sbjct: 565 KAYKAAREESDQAAETAISDKISSALINRVDAMLQKLEKEIDDVDAKIGDRWRLLDRDYD 624

Query: 481 GKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVKLASQTEDTE-TAET 539
           GKVT EEVASAAMYLKD L KEGIQELI+NLSKDREGKILVEDIV+L S+ +D +  AE 
Sbjct: 625 GKVTPEEVASAAMYLKDHLGKEGIQELISNLSKDREGKILVEDIVRLGSEMKDADAAAEE 684

Query: 540 GRS 542
           G+S
Sbjct: 685 GKS 687

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224109172\|ref\|XP_002315110.1\| predicted protein [Populus trichocarpa] gi\|222864150\|gb\|EEF01281.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255547432\|ref\|XP_002514773.1\| leucine zipper-ef-hand containing transmembrane protein, putative [Ricinus communis] gi\|223545824\|gb\|EEF47327.1\| leucine zipper-ef-hand containing transmembrane protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225434179\|ref\|XP_002275474.1\| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial [Vitis vinifera] gi\|296084337\|emb\|CBI24725.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449477676\|ref\|XP_004155090.1\| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449470263\|ref\|XP_004152837.1\| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224092862\|ref\|XP_002309727.1\| predicted protein [Populus trichocarpa] gi\|222852630\|gb\|EEE90177.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297841081\|ref\|XP_002888422.1\| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi\|297334263\|gb\|EFH64681.1\| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356566963\|ref\|XP_003551694.1\| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|42562974\|ref\|NP_176732.2\| LETM1-like protein [Arabidopsis thaliana] gi\|332196272\|gb\|AEE34393.1\| LETM1-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		542
TAIR\|locus:2034136		736	LETM2 "leucine zipper-EF-hand-	0.994	0.732	0.719	2.9e-197
TAIR\|locus:2080502		760	LETM1 "leucine zipper-EF-hand-	0.952	0.678	0.658	1.8e-174
UNIPROTKB\|Q5ZK33		752	LETM1 "LETM1 and EF-hand domai	0.560	0.404	0.490	1.9e-81
UNIPROTKB\|E2RHA5		741	LETM1 "Uncharacterized protein	0.560	0.410	0.470	2.8e-78
RGD\|1359678		739	Letm1 "leucine zipper-EF-hand	0.560	0.411	0.477	3.6e-78
MGI\|MGI:1932557		738	Letm1 "leucine zipper-EF-hand	0.560	0.411	0.474	5.9e-78
UNIPROTKB\|O95202		739	LETM1 "LETM1 and EF-hand domai	0.560	0.411	0.474	9.5e-78
UNIPROTKB\|F1S9F3		721	LETM1 "Uncharacterized protein	0.560	0.421	0.470	8.5e-77
UNIPROTKB\|K7GSE0		782	LETM1 "Uncharacterized protein	0.560	0.388	0.470	8.5e-77
UNIPROTKB\|F1N3R4		732	LETM1 "LETM1 and EF-hand domai	0.560	0.415	0.467	1.8e-76

TAIR\|locus:2034136 LETM2 "leucine zipper-EF-hand-containing transmembrane protein 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1910 (677.4 bits), Expect = 2.9e-197, P = 2.9e-197
 Identities = 388/539 (71%), Positives = 428/539 (79%)

Query:     1 MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPF 60
             +QHYWLGTKLLWAD+RIS RLL+KL NGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPF
Sbjct:   191 LQHYWLGTKLLWADVRISVRLLVKLANGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPF 250

Query:    61 MEFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRG 120
             MEFLLPVFLKLFPNMLPSTFQDKM+EEEALKRRL AR+EYAKFLQDTVKEMAKEVQ SR 
Sbjct:   251 MEFLLPVFLKLFPNMLPSTFQDKMKEEEALKRRLNARMEYAKFLQDTVKEMAKEVQTSRS 310

Query:   121 GDIKKTAEDLDEFMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISP 180
             G+IKKTAEDLD FM KVR G GVSNDEIL FAKLFNDELTLDNI+R RLVNMCKYMGISP
Sbjct:   311 GEIKKTAEDLDGFMTKVRRGVGVSNDEILGFAKLFNDELTLDNINRSRLVNMCKYMGISP 370

Query:   181 FGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGLLSVEEMRQQL 240
             FGTDAYLRYMLR+RLQEIK DDK+I+AEGVESLSEAELRQACR+RG+L L SVEEMR+QL
Sbjct:   371 FGTDAYLRYMLRKRLQEIKKDDKLIKAEGVESLSEAELRQACRERGMLQLGSVEEMREQL 430

Query:   241 RDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDEVVDTVGVTALPSEDS 300
              DWLDLSLNHSVPSSLLILSR+FS++GK++PEEAVQATLSSLPDEVVDTVGVTAL SEDS
Sbjct:   431 VDWLDLSLNHSVPSSLLILSRSFSMAGKLKPEEAVQATLSSLPDEVVDTVGVTALSSEDS 490

Query:   301 ISERRRKLXXXXXXXXXXXXXXXXXXXXXXXXXXXVRSRKDVALEEMTDPXXXXXXXXXX 360
             +SER+RKL                             S+KDVAL+EM             
Sbjct:   491 VSERKRKLEYLEMQEELIKEEEEEEEEEMAKMKESASSQKDVALDEMMASTAKDANEQAK 550

Query:   361 XXXXXXHEQLCELSRXXXXXXXXXXXXHEREEFLRLVNKEIELYNSMVEKDGKVGXXXXX 420
                   HEQLCELSR             EREEFL+LV KE++LYNSMVEK G        
Sbjct:   551 AKTLEKHEQLCELSRALAVLASASSVSMEREEFLKLVKKEVDLYNSMVEKGGTDDEEDAR 610

Query:   421 XXXXXXXXXTDQDAGEDVDEKVSSALINRVDAMLQKLEKEIDDVDAKIGDRWRLLDRDYD 480
                      +D+ A + + +K SSAL++RV+ MLQKLEKEIDDVD KIG+RWRLLDRDYD
Sbjct:   611 KAYLAAREDSDRSAQKAIADKTSSALLDRVETMLQKLEKEIDDVDNKIGNRWRLLDRDYD 670

Query:   481 GKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVKLASQTEDTETAET 539
             GKV+ +EVA AAMYLKDTL KEGIQELI NLSKD++GKILVED+VKLAS+ ED E  ET
Sbjct:   671 GKVSPDEVALAAMYLKDTLGKEGIQELIQNLSKDKDGKILVEDLVKLASEIEDAEAEET 729

GO:0005509 "calcium ion binding" evidence=IEA;ISS

GO:0005739 "mitochondrion" evidence=ISM;IDA

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:2080502 LETM1 "leucine zipper-EF-hand-containing transmembrane protein 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZK33 LETM1 "LETM1 and EF-hand domain-containing protein 1, mitochondrial" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RHA5 LETM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|1359678 Letm1 "leucine zipper-EF-hand containing transmembrane protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1932557 Letm1 "leucine zipper-EF-hand containing transmembrane protein 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|O95202 LETM1 "LETM1 and EF-hand domain-containing protein 1, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S9F3 LETM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|K7GSE0 LETM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N3R4 LETM1 "LETM1 and EF-hand domain-containing protein 1, mitochondrial" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_LG_VIII000678	hypothetical protein (687 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		542
pfam07766		268	pfam07766, LETM1, LETM1-like protein	1e-123
cd00051		63	cd00051, EFh, EF-hand, calcium binding motif; A di	8e-04

>gnl\|CDD\|219562 pfam07766, LETM1, LETM1-like protein	Back alignment and domain information

 Score =  362 bits (931), Expect = e-123
 Identities = 151/260 (58%), Positives = 190/260 (73%), Gaps = 5/260 (1%)

Query: 2   QHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPFM 61
           +HY+ GT+LL+ D++IS++LL K++NG  L+RRER+QL RTT D+FRLVP +VFIIVPF 
Sbjct: 13  RHYYDGTRLLFIDVKISAKLLWKVLNGYELTRREREQLYRTTRDLFRLVPFSVFIIVPFA 72

Query: 62  EFLLPVFLKLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRGG 121
           E LLP+ LKLFPNMLPSTF    + EE LK+ L  R E AKFLQ+T+KEMA   +NS   
Sbjct: 73  ELLLPIALKLFPNMLPSTFWTATQREEKLKKLLKVRKEVAKFLQETLKEMALHNKNSISQ 132

Query: 122 DIKKTAEDLDEFMNKVRTGAGVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPF 181
             KK       F  KVR+G   SN+EIL  +KLF DELTLDN+SRP+LV +CKY+ + PF
Sbjct: 133 AEKK----FASFFQKVRSGGEPSNEEILDVSKLFKDELTLDNLSRPQLVALCKYLELHPF 188

Query: 182 GTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGL-LSVEEMRQQL 240
           GTD  LR+ LR +L+ IK DD+ I  EGV SLS  EL+ ACR RG+  L LS E +R QL
Sbjct: 189 GTDNMLRFQLREKLRSIKADDRAIAREGVHSLSPEELQYACRARGMRALGLSEERLRDQL 248

Query: 241 RDWLDLSLNHSVPSSLLILS 260
           ++WLDLSLN  VPS+LL+LS
Sbjct: 249 QEWLDLSLNEKVPSTLLLLS 268

Members of this family are inner mitochondrial membrane proteins which play a role in potassium and hydrogen ion exchange. Deletion of LETM1 is thought to be involved in the development of Wolf-Hirschhorn syndrome in humans. Length = 268

>gnl\|CDD\|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		542
KOG1043		499	consensus Ca2+-binding transmembrane protein LETM1	100.0
PF07766		268	LETM1: LETM1-like protein; InterPro: IPR011685 Thi	100.0
KOG4263		299	consensus Putative receptor CCR1 [Signal transduct	99.97
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	99.3
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	99.24
KOG0030		152	consensus Myosin essential light chain, EF-Hand pr	99.16
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	99.12
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	99.02
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	99.01
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	98.91
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	98.91
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	98.9
KOG0028		172	consensus Ca2+-binding protein (centrin/caltractin	98.87
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	98.86
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	98.82
KOG0031		171	consensus Myosin regulatory light chain, EF-Hand p	98.79
cd00052		67	EH Eps15 homology domain; found in proteins implic	98.75
cd00213		88	S-100 S-100: S-100 domain, which represents the la	98.7
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	98.69
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	98.58
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	98.57
PTZ00183		158	centrin; Provisional	98.55
PF14658		66	EF-hand_9: EF-hand domain	98.52
PTZ00184		149	calmodulin; Provisional	98.52
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	98.51
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	98.49
KOG0028		172	consensus Ca2+-binding protein (centrin/caltractin	98.47
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	98.4
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	98.36
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	98.27
PTZ00183		158	centrin; Provisional	98.26
PTZ00184		149	calmodulin; Provisional	98.22
KOG0030		152	consensus Myosin essential light chain, EF-Hand pr	97.98
KOG0037		221	consensus Ca2+-binding protein, EF-Hand protein su	97.97
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	97.88
PLN02964		644	phosphatidylserine decarboxylase	97.81
KOG0031		171	consensus Myosin regulatory light chain, EF-Hand p	97.76
KOG0041		244	consensus Predicted Ca2+-binding protein, EF-Hand	97.68
KOG0038		189	consensus Ca2+-binding kinase interacting protein	97.62
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	97.6
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	97.59
PLN02964		644	phosphatidylserine decarboxylase	97.57
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	97.56
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	97.49
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	97.29
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	97.24
KOG0036		463	consensus Predicted mitochondrial carrier protein	97.23
KOG0377		631	consensus Protein serine/threonine phosphatase RDG	97.17
PF12763		104	EF-hand_4: Cytoskeletal-regulatory complex EF hand	97.09
KOG0036		463	consensus Predicted mitochondrial carrier protein	96.82
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	96.53
KOG0037		221	consensus Ca2+-binding protein, EF-Hand protein su	96.39
PF02037		35	SAP: SAP domain; InterPro: IPR003034 The SAP (afte	96.18
KOG0046		627	consensus Ca2+-binding actin-bundling protein (fim	96.16
KOG0040		2399	consensus Ca2+-binding actin-bundling protein (spe	96.11
PF10591		113	SPARC_Ca_bdg: Secreted protein acidic and rich in	96.07
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	96.03
KOG4065		144	consensus Uncharacterized conserved protein [Funct	95.75
smart00513		35	SAP Putative DNA-binding (bihelical) motif predict	95.59
KOG4223		325	consensus Reticulocalbin, calumenin, DNA supercoil	95.11
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	94.74
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	94.74
KOG4223		325	consensus Reticulocalbin, calumenin, DNA supercoil	94.63
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	94.34
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	93.8
KOG0042		680	consensus Glycerol-3-phosphate dehydrogenase [Ener	93.27
KOG1043		499	consensus Ca2+-binding transmembrane protein LETM1	93.2
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	92.79
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	92.77
KOG4251		362	consensus Calcium binding protein [General functio	91.66
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	91.39
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	90.96
KOG2243		5019	consensus Ca2+ release channel (ryanodine receptor	90.87
PF09279		83	EF-hand_like: Phosphoinositide-specific phospholip	90.02
KOG1955		737	consensus Ral-GTPase effector RALBP1 [Intracellula	88.63
KOG2643		489	consensus Ca2+ binding protein, contains EF-hand m	86.19
PF02037		35	SAP: SAP domain; InterPro: IPR003034 The SAP (afte	84.74
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	84.68
KOG2643		489	consensus Ca2+ binding protein, contains EF-hand m	84.46
KOG2562		493	consensus Protein phosphatase 2 regulatory subunit	84.44
KOG0035		890	consensus Ca2+-binding actin-bundling protein (act	84.2
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	83.89
smart00513		35	SAP Putative DNA-binding (bihelical) motif predict	83.53
KOG4666		412	consensus Predicted phosphate acyltransferase, con	83.19
KOG0377		631	consensus Protein serine/threonine phosphatase RDG	82.66
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	80.97

>KOG1043 consensus Ca2+-binding transmembrane protein LETM1/MRS7 [Function unknown]	Back alignment and domain information

Probab=100.00  E-value=1.7e-74  Score=613.71  Aligned_cols=330  Identities=52%  Similarity=0.850  Sum_probs=311.0

Q ss_pred             CcccchhhHHHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhhhhhhhhHHHHHhhhhhhhHHHHHHHHcCCCcchhh
Q 009156            1 MQHYWLGTKLLWADIRISSRLLLKLVNGKGLSRRERQQLTRTTADIFRLVPVAVFIIVPFMEFLLPVFLKLFPNMLPSTF   80 (542)
Q Consensus         1 ~~hY~~G~KlL~~d~Kis~~l~~k~~~G~~LTRrE~~~L~Rt~~Dl~RLvPF~vfiiVPf~E~lLPv~lklFPnmLPSTF   80 (542)
                      ++|||+|||+||.|+|++.+++|+++.|+.|||||++||+||+.|+||||||++|++|||+|+++|+++++|||||||||
T Consensus       130 lqhy~~gtkll~~e~kisaklLlkll~g~~ltrrE~~qL~rt~~d~frLvPfs~flivPf~El~Lp~~lKlfp~~lpstf  209 (499)
T KOG1043|consen  130 LQHYVDGTKLLGKEIKISAKLLLKLLKGYELTRRERGQLKRTCSDIFRLVPFSKFLIVPFMELLLPIFLKLFPNDLPSTF  209 (499)
T ss_pred             hHHHhhhhhhhhhhhhhhHHHHHHHHccCeeeHHHhhhHHhhccchheeccceeeeeeehHHHHhHHHHhhccccchhhH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCcchhhhHHHHHHHHHHhc-CCCCCCHHHHHHHHhhcCCcc
Q 009156           81 QDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRGGDIKKTAEDLDEFMNKVR-TGAGVSNDEILAFAKLFNDEL  159 (542)
Q Consensus        81 ~~~~q~~~~lkk~l~~R~~~akfLq~t~~e~~~~~~~~~~~~~~~~~~~~~~f~~kvr-~G~~ps~eeil~~aklF~d~l  159 (542)
                      ++..+++++..+++..|.++++|||+|+.+|....+.++++.+.+.. +|..|+.++| .|..+|+++|+.||++|+|+.
T Consensus       210 q~~kk~~~k~~k~~~~r~~~sk~Lq~tl~~~~~~~k~~~~~e~~qs~-~fd~f~~kvr~~~~~~S~eeii~~aklf~de~  288 (499)
T KOG1043|consen  210 QESKKEEEKLSKKYVERSEASKFLQKTLQQMIDRIKTWSNLETSQSI-EFDRFLGKVRFIGLGVSTEEIIAFAKLFSDEI  288 (499)
T ss_pred             HHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHhhhccchhhHHHHHH-HHHHHHHHhcccCCCccHHHHHHHHHHhccch
Confidence            99999888888888899999999999999999888776666665555 8999999999 699999999999999999999


Q ss_pred             ccCCCChHHHHHHHhhhCCCCCCccHHHHHHHHHHHHHHHHhhHhHHHhc-cCCCCHHHHHHHHHhcCCCCC-CCHHHHH
Q 009156          160 TLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIKNDDKMIQAEG-VESLSEAELRQACRDRGLLGL-LSVEEMR  237 (542)
Q Consensus       160 ~LdnLsr~~L~alcr~~~l~p~g~~~~LR~rLr~rl~~L~~DD~lI~~EG-v~sLs~~EL~~AC~~RGi~~~-~s~e~lr  237 (542)
                      +||||+|+||++||+||+++|||||.+|||+|+++|++|+.||..|.+|| |++|+..||+.||++|||++. +++++|+
T Consensus       289 ~LdnLsR~qL~al~k~m~l~~~Gt~~~lr~~lr~kik~ik~dD~~I~~eg~v~~ls~~el~~aC~~rgmra~gv~~e~l~  368 (499)
T KOG1043|consen  289 TLDNLSRPQLVALCKYMDLNSFGTDKLLRYQLRKKIKEIKKDDKHIATEGAVESLSLLELQIACRERGMRALGVSEERLR  368 (499)
T ss_pred             hhhccCHHHHHHHHHhhcccccCchHHHHHHHHHHHHHhcccccchhhhhhhhHhhHHHHHHHHHhhhcchhccchhhhh
Confidence            99999999999999999999999999999999999999999999999999 999999999999999999985 7889999


Q ss_pred             HHHHHHHhcccCCCCChhHHHhHhhhccCCCCChHHHHHHHhcc-CChhhhhhhcccccCCCcchhhhhhhHHHhHHHHH
Q 009156          238 QQLRDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSS-LPDEVVDTVGVTALPSEDSISERRRKLEFLEMQEE  316 (542)
Q Consensus       238 ~~L~~WL~ls~~~~vp~sLLl~s~a~~~~~~~~~~~~l~~~l~~-lp~~~~~~~~~~~~~~~~~~~~~~~kl~~~~~~e~  316 (542)
                      .+|..|+++|++++||++||+|||+|++++.....+++..+|+. +|+.+......++.+++.+.++++.|++.|++||+
T Consensus       369 ~ql~~wldlsl~~~vps~lL~Lsr~~~~~~~~~~~~s~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~kl~~l~~~e~  448 (499)
T KOG1043|consen  369 EQLRVWLDLSLDKKVPSVLLLLSRTFSLGQNSKAPSSSSGKLQIAAPDDLEKLEKLKKEESELGAVDRKKKLELLREGEE  448 (499)
T ss_pred             HHHHHHHhhhccccCchHHHHHhhhhhhhhcccCCchhhhHhhhhccccHHHhcccccccccccccchHHHHHhhhcccc
Confidence            99999999999999999999999999999887788888888885 99999999999998888888999999999999999


Q ss_pred             HHHHHHHHHHHHHHH
Q 009156          317 LIKEEEEEEEEEQAK  331 (542)
Q Consensus       317 ~i~~e~~~~~~~~~~  331 (542)
                      .|.+|.+++.+....
T Consensus       449 ~~~~e~eee~~~~~~  463 (499)
T KOG1043|consen  449 IISEEEEEEEKQYGR  463 (499)
T ss_pred             ccchhhhcccccccc
Confidence            999999866554433

>PF07766 LETM1: LETM1-like protein; InterPro: IPR011685 This is a group of mainly hypothetical eukaryotic proteins	Back alignment and domain information

>KOG4263 consensus Putative receptor CCR1 [Signal transduction mechanisms]	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>PF14658 EF-hand_9: EF-hand domain	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]	Back alignment and domain information

>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms]	Back alignment and domain information

>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A	Back alignment and domain information

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>PF02037 SAP: SAP domain; InterPro: IPR003034 The SAP (after SAF-A/B, Acinus and PIAS) motif is a putative DNA binding domain found in diverse nuclear proteins involved in chromosomal organisation [], including in apoptosis []	Back alignment and domain information

>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton]	Back alignment and domain information

>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>KOG4065 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00513 SAP Putative DNA-binding (bihelical) motif predicted to be involved in chromosomal organisation	Back alignment and domain information

>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>KOG1043 consensus Ca2+-binding transmembrane protein LETM1/MRS7 [Function unknown]	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>KOG4251 consensus Calcium binding protein [General function prediction only]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms]	Back alignment and domain information

>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C	Back alignment and domain information

>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF02037 SAP: SAP domain; InterPro: IPR003034 The SAP (after SAF-A/B, Acinus and PIAS) motif is a putative DNA binding domain found in diverse nuclear proteins involved in chromosomal organisation [], including in apoptosis []	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification]	Back alignment and domain information

>KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton]	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>smart00513 SAP Putative DNA-binding (bihelical) motif predicted to be involved in chromosomal organisation	Back alignment and domain information

>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms]	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		542
3skq_A		249	Mdm38 Is A 14-3-3-Like Receptor And Associates With		2e-34

>pdb|3SKQ|A Chain A, Mdm38 Is A 14-3-3-Like Receptor And Associates With The Protein Synthesis Machinery At The Inner Mitochondrial Membrane Length = 249

Back alignment and structure

Iteration: 1

Score = 144 bits (362), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 86/226 (38%), Positives = 132/226 (58%), Gaps = 18/226 (7%) Query: 70 KLFPNMLPSTFQDKMREEEALKRRLI-ARIEYAKFLQDTVKEMAKEVQNSRGGDIKKTAE 128 KLFPN+LPST++ ++++A + +LI R + ++FL +T++E N + + AE Sbjct: 1 KLFPNLLPSTYESG-KDKQAKRNKLIEIRKKTSEFLHETLEE-----SNLITYNTIENAE 54 Query: 129 DLDEFMNKVRTGAGV--------SNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISP 180 +F+N R +DEI A A++F ++ LDN+SRP+L M K+M + P Sbjct: 55 KKQKFLNFFRKLYSAKEGKIMTFQHDEISAIAQMFKNDSVLDNLSRPQLAAMSKFMSLRP 114 Query: 181 FGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGL-LSVEEMRQQ 239 FG D LRY +R +L++I NDDK I EGVESLS+ EL QAC RG+ +S E++ Sbjct: 115 FGNDNMLRYQIRSKLKDIMNDDKTIDYEGVESLSQEELYQACVSRGMKAYGVSKEDLVDN 174 Query: 240 LRDWLDLSLNHSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDE 285 L+ WL+L L +PS L++LS F+ G P+E S L ++ Sbjct: 175 LKVWLELRLRQKIPSVLMVLSSTFTFGG--LPKENYSKAFSPLAEK 218

PyMOL of 3skq

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		542
3skq_A		249	Mitochondrial distribution and morphology protein;	3e-76
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-13
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-04
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	3e-04
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	5e-04
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	7e-04
2hps_A		186	Coelenterazine-binding protein with bound coelent;	7e-04

>3skq_A Mitochondrial distribution and morphology protein; 14-3-3-like membrane protein, mitochondrial ribosome, respir chain biogenesis; 2.10A {Saccharomyces cerevisiae} Length = 249	Back alignment and structure

 Score =  240 bits (613), Expect = 3e-76
 Identities = 82/249 (32%), Positives = 129/249 (51%), Gaps = 34/249 (13%)

Query: 70  KLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRGGDIKKTAED 129
           KLFPN+LPST++    ++    + +  R + ++FL +T++E      N+   +  +  + 
Sbjct: 1   KLFPNLLPSTYESGKDKQAKRNKLIEIRKKTSEFLHETLEESNLITYNT--IENAEKKQK 58

Query: 130 LDEFMNKVRTGA-----GVSNDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTD 184
              F  K+ +          +DEI A A++F ++  LDN+SRP+L  M K+M + PFG D
Sbjct: 59  FLNFFRKLYSAKEGKIMTFQHDEISAIAQMFKNDSVLDNLSRPQLAAMSKFMSLRPFGND 118

Query: 185 AYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRDRGLLGL-LSVEEMRQQLRDW 243
             LRY +R +L++I NDDK I  EGVESLS+ EL QAC  RG+    +S E++   L+ W
Sbjct: 119 NMLRYQIRSKLKDIMNDDKTIDYEGVESLSQEELYQACVSRGMKAYGVSKEDLVDNLKVW 178

Query: 244 LDLSLNHSVPSSLLILSRAFSVSGKVR--------------------------PEEAVQA 277
           L+L L   +PS L++LS  F+  G  +                            + +  
Sbjct: 179 LELRLRQKIPSVLMVLSSTFTFGGLPKENYSKAFSPLAEKKETKSKYDDLLDLYYDGILQ 238

Query: 278 TLSSLPDEV 286
            LSS+PD V
Sbjct: 239 VLSSIPDPV 247

PyMOL of 3skq

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		542
3skq_A		249	Mitochondrial distribution and morphology protein;	100.0
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	99.38
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	99.37
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	99.31
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	99.3
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	99.26
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	99.26
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	99.24
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	99.21
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	99.17
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	99.17
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	99.15
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	99.15
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	99.13
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	99.13
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	99.12
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	99.12
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	99.09
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	99.09
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	99.09
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	99.09
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	99.08
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	99.08
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	99.08
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	99.08
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	99.07
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	99.07
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	99.07
3fwb_A		161	Cell division control protein 31; gene gating, com	99.07
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	99.06
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	99.06
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	99.06
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	99.06
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	99.05
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	99.05
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	99.05
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	99.05
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	99.04
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	99.03
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	99.03
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	99.03
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	99.03
1c07_A		95	Protein (epidermal growth factor receptor pathway	99.02
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	99.02
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	99.02
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	99.02
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	99.02
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	99.01
3li6_A		66	Calcium-binding protein; calcium signaling protein	99.01
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	99.01
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	99.01
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	99.01
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	99.01
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	99.01
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	99.0
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	99.0
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	98.99
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	98.99
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	98.97
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	98.97
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	98.97
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	98.96
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	98.96
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	98.96
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	98.96
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	98.96
2jnf_A		158	Troponin C; stretch activated muscle contraction,	98.95
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	98.95
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	98.95
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	98.94
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	98.94
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	98.94
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	98.94
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	98.93
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	98.92
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	98.91
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	98.91
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	98.9
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	98.9
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	98.9
2jq6_A		139	EH domain-containing protein 1; metal binding prot	98.9
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	98.9
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	98.89
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	98.89
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	98.88
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	98.88
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	98.88
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	98.88
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	98.87
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	98.87
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	98.87
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	98.87
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	98.87
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	98.86
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	98.85
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	98.85
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	98.85
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	98.83
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	98.83
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	98.82
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	98.82
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	98.81
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	98.79
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	98.78
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	98.78
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	98.77
1y1x_A		191	Leishmania major homolog of programmed cell death	98.77
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	98.77
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	98.76
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	98.76
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	98.75
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	98.74
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	98.74
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	98.74
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	98.73
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	98.72
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	98.71
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	98.71
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	98.71
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	98.71
2hps_A		186	Coelenterazine-binding protein with bound coelent;	98.7
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	98.69
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	98.69
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	98.68
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	98.68
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	98.67
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	98.67
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	98.67
3fwb_A		161	Cell division control protein 31; gene gating, com	98.67
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	98.65
2jnf_A		158	Troponin C; stretch activated muscle contraction,	98.65
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	98.65
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	98.64
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	98.64
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	98.64
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	98.64
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	98.63
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	98.63
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	98.63
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	98.63
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	98.62
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	98.62
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	98.61
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	98.61
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	98.6
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	98.6
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	98.6
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	98.59
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	98.59
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	98.59
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	98.58
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	98.57
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	98.57
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	98.56
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	98.55
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	98.54
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	98.53
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	98.53
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	98.53
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	98.52
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	98.51
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	98.51
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	98.51
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	98.51
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	98.51
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	98.5
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	98.5
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	98.49
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	98.49
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	98.49
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	98.49
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	98.49
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	98.48
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	98.48
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	98.47
1y1x_A		191	Leishmania major homolog of programmed cell death	98.47
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	98.46
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	98.46
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	98.46
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	98.46
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	98.45
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	98.45
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	98.44
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	98.44
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	98.43
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	98.41
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	98.41
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	98.41
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	98.41
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	98.41
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	98.41
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	98.4
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	98.39
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	98.38
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	98.37
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	98.36
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	98.33
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	98.33
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	98.32
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	98.32
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	98.31
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	98.31
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	98.3
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	98.3
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	98.28
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	98.26
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	98.26
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	98.25
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	98.24
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	98.24
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	98.22
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	98.21
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	98.19
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	98.18
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	98.18
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	98.17
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	98.17
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	98.17
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	98.13
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	98.12
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	98.09
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	98.07
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	98.04
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	98.04
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	98.03
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	98.02
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	98.02
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	98.01
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	97.99
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	97.96
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	97.94
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	97.93
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	97.88
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	97.84
2hps_A		186	Coelenterazine-binding protein with bound coelent;	97.81
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	97.78
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	97.75
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	97.73
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	97.68
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	97.66
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	97.59
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	97.55
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	97.52
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	97.4
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	97.35
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	97.34
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	97.34
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	97.33
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	97.3
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	97.25
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	97.23
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	97.23
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	97.18
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	97.17
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	97.14
1nub_A		229	Basement membrane protein BM-40; extracellular mod	96.95
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	96.67
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	96.35
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	96.05
1jjr_A		151	KU70, thyroid autoantigen; DNA repair protein, pro	96.01
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	95.41
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	94.81
2do1_A		55	Nuclear protein HCC-1; SAP domain, structural geno	94.73
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	94.3
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	93.98
2qpt_A		550	EH domain-containing protein-2; protein-nucleotide	93.92
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	93.57
3li6_A		66	Calcium-binding protein; calcium signaling protein	93.32
1zrj_A		50	E1B-55KDA-associated protein 5 isoform C; SAP doma	92.92
2rnn_A		114	E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA bind	92.7
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	92.08
2kvu_A		75	MKL/myocardin-like protein 1; SAP motif, DNA/RNA b	91.65
1h1j_S		51	THO1 protein; SAP domain, DNA binding; NMR {Saccha	91.63
1tuz_A		118	Diacylglycerol kinase alpha; transferase, HR532, n	91.61
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	90.83
4fl4_A		88	Glycoside hydrolase family 9; structural genomics,	90.77
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	90.36
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	90.29
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	90.24
4dh2_B		82	Dockerin type 1; cellulosome, cohesin, type I cohe	89.73
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	89.08
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	88.72
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	88.49
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	88.05
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	87.34
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	87.16
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	86.95
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	86.92
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	86.92
2ccl_B		63	Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d	86.34
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	86.31
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	85.91
2y3n_B		71	Cellulosomal family-48 processive glycoside hydro;	85.36
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	85.23
1jjr_A		151	KU70, thyroid autoantigen; DNA repair protein, pro	84.35
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	83.97
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	83.3
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	83.23
3ul4_B		65	Cellulosome enzyme, dockerin type I; cohesin, type	82.64
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	81.93
1c07_A		95	Protein (epidermal growth factor receptor pathway	81.85
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	80.47
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	80.41

>3skq_A Mitochondrial distribution and morphology protein; 14-3-3-like membrane protein, mitochondrial ribosome, respir chain biogenesis; 2.10A {Saccharomyces cerevisiae}	Back alignment and structure

Probab=100.00  E-value=5.8e-66  Score=507.66  Aligned_cols=217  Identities=38%  Similarity=0.653  Sum_probs=179.2

Q ss_pred             HHcCCCcchhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCcchhhhHHHHHHHHHHhcCCC-----CCC
Q 009156           70 KLFPNMLPSTFQDKMREEEALKRRLIARIEYAKFLQDTVKEMAKEVQNSRGGDIKKTAEDLDEFMNKVRTGA-----GVS  144 (542)
Q Consensus        70 klFPnmLPSTF~~~~q~~~~lkk~l~~R~~~akfLq~t~~e~~~~~~~~~~~~~~~~~~~~~~f~~kvr~G~-----~ps  144 (542)
                      |+|||||||||++.++++++.++.+++|.++|+|||+|+++|+..++.+.  .....+++|.+||+||++|.     +||
T Consensus         1 KlFPNmLPSTfe~~~~k~~k~~kll~~r~e~a~FLq~tl~e~~~~~~~~~--~~~~~~~~f~~f~~Kvr~~~e~~~~~ps   78 (249)
T 3skq_A            1 KLFPNLLPSTYESGKDKQAKRNKLIEIRKKTSEFLHETLEESNLITYNTI--ENAEKKQKFLNFFRKLYSAKEGKIMTFQ   78 (249)
T ss_dssp             ----------------------CHHHHHHHHHHHHHHHHTTCCCCCGGGC--SSHHHHHHHHHHHHHHHTCBTTBCEEEE
T ss_pred             CCCCCCCcccccCcchHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccc--ccHHHHHHHHHHHHHHhcCCCCCCCCCC
Confidence            68999999999999999999999999999999999999999875433322  22345679999999999642     479


Q ss_pred             HHHHHHHHhhcCCccccCCCChHHHHHHHhhhCCCCCCccHHHHHHHHHHHHHHHHhhHhHHHhccCCCCHHHHHHHHHh
Q 009156          145 NDEILAFAKLFNDELTLDNISRPRLVNMCKYMGISPFGTDAYLRYMLRRRLQEIKNDDKMIQAEGVESLSEAELRQACRD  224 (542)
Q Consensus       145 ~eeil~~aklF~d~l~LdnLsr~~L~alcr~~~l~p~g~~~~LR~rLr~rl~~L~~DD~lI~~EGv~sLs~~EL~~AC~~  224 (542)
                      ++||++||++|+|+++||||||+||++||+||||+||||+++||+|||+|+++|++||++|.+|||++||.+||+.||++
T Consensus        79 ~eeIl~vaklF~de~tLdnLsr~qLvaLck~m~L~p~gt~~~LR~rLr~rl~~I~~DDr~I~~EGV~sLs~~ELr~AC~~  158 (249)
T 3skq_A           79 HDEISAIAQMFKNDSVLDNLSRPQLAAMSKFMSLRPFGNDNMLRYQIRSKLKDIMNDDKTIDYEGVESLSQEELYQACVS  158 (249)
T ss_dssp             HHHHHHHHTTSCHHHHHHHSCHHHHHHHHHHTTCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHCGGGSCHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCCcccccCCHHHHHHHHHHhCCCCCCChHHHHHHHHHHHHHHHHhhHHHHHhCcccCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCC-CCHHHHHHHHHHHHhcccCCCCChhHHHhHhhhccCCCC--------------------------ChHHHHHH
Q 009156          225 RGLLGL-LSVEEMRQQLRDWLDLSLNHSVPSSLLILSRAFSVSGKV--------------------------RPEEAVQA  277 (542)
Q Consensus       225 RGi~~~-~s~e~lr~~L~~WL~ls~~~~vp~sLLl~s~a~~~~~~~--------------------------~~~~~l~~  277 (542)
                      |||++. +++++||.||++||+||++++||+|||||||||+|++..                          ++||||.+
T Consensus       159 RGm~~~gls~e~LR~~L~~WL~Lsl~~~vPssLLilSra~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~  238 (249)
T 3skq_A          159 RGMKAYGVSKEDLVDNLKVWLELRLRQKIPSVLMVLSSTFTFGGLPKENYSKAFSPLAEKKETKSKYDDLLDLYYDGILQ  238 (249)
T ss_dssp             TTCCCTTCCHHHHHHHHHHHHHHHHTSCCCHHHHHHHHGGGSSSCCCCCCEEEECHHHHTSSSCCHHHHHHHHHHHHHHH
T ss_pred             cCCCCCCCCHHHHHHHHHHHHHHHccCCCCHHHHHHHHHHHccCcchhhhhhhccchhhhhhccchhhhhHHHHHHHHHH
Confidence            999975 899999999999999999999999999999999998852                          46899999


Q ss_pred             HhccCChhhhh
Q 009156          278 TLSSLPDEVVD  288 (542)
Q Consensus       278 ~l~~lp~~~~~  288 (542)
                      |||||||+|||
T Consensus       239 vls~ipd~vyn  249 (249)
T 3skq_A          239 VLSSIPDPVYN  249 (249)
T ss_dssp             HHHHSCCTTTC
T ss_pred             HHccCCccccC
Confidence            99999999997

PyMOL of 3skq

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A*	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2do1_A Nuclear protein HCC-1; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.140.2.1	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>1zrj_A E1B-55KDA-associated protein 5 isoform C; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.140.2.1	Back alignment and structure

>2rnn_A E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA binding, sumoylation, metal-binding, nucLeu phosphoprotein, UBL conjugation pathway; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>2kvu_A MKL/myocardin-like protein 1; SAP motif, DNA/RNA binding, structural genomics, northeast structural genomics consortium (NESG), PSI-2; NMR {Homo sapiens} PDB: 2kw9_A	Back alignment and structure

>1h1j_S THO1 protein; SAP domain, DNA binding; NMR {Saccharomyces cerevisiae} SCOP: a.140.2.1 PDB: 2wqg_A	Back alignment and structure

>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum}	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens}	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum}	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		542
d1oqpa_		77	a.39.1.5 (A:) Caltractin (centrin 2) {Green algae	9e-05
d1exra_		146	a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr	4e-04
d1dtla_		156	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	7e-04
d1topa_		162	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	0.002
d1fi5a_		81	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus),	0.003

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77	Back information, alignment and structure


class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Caltractin (centrin 2)
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]

 Score = 38.7 bits (90), Expect = 9e-05
 Identities = 18/69 (26%), Positives = 38/69 (55%)

Query: 463 DVDAKIGDRWRLLDRDYDGKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVE 522
           D   +I   +RL D D  G +T +++   A  L + L +E +QE+IA   ++ + +I  +
Sbjct: 6   DSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDED 65

Query: 523 DIVKLASQT 531
           + +++  +T
Sbjct: 66  EFIRIMKKT 74

PyMOL of d1oqpa_

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		542
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.4
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	99.39
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	99.37
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.33
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	99.33
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	99.32
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	99.32
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	99.31
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	99.31
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	99.31
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	99.3
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	99.3
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	99.29
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	99.26
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	99.23
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	99.21
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	99.19
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	99.15
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	99.15
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	99.13
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	99.13
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.12
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	99.12
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	99.12
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	99.11
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	99.11
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	99.08
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	99.07
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.05
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	99.03
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	98.98
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	98.95
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	98.89
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	98.86
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	98.86
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	98.84
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	98.8
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.79
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	98.78
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.78
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	98.76
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	98.76
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	98.73
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	98.72
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	98.71
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	98.71
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	98.7
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	98.67
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	98.67
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	98.67
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	98.66
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	98.64
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	98.63
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	98.62
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	98.61
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	98.6
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	98.6
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	98.56
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	98.56
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.54
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	98.54
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	98.53
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	98.52
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	98.51
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	98.51
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	98.51
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.51
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	98.5
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	98.49
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	98.49
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	98.48
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	98.47
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	98.46
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	98.46
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	98.44
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	98.41
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	98.36
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	98.36
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	98.35
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	98.35
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	98.34
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	98.32
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	98.32
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	98.3
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	98.3
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.26
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.18
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	98.12
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	98.12
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	98.12
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	98.11
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	98.1
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	98.06
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	97.99
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	97.93
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	97.9
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	97.86
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	97.84
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	97.83
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	97.81
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	97.79
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.7
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	97.63
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	97.57
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	97.56
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	97.56
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	97.55
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	97.48
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	97.43
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	97.39
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	97.33
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	96.94
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	96.88
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	96.65
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	96.56
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	96.33
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	96.12
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	95.6
d1jeqa1		51	DNA binding C-terminal domain of ku70 {Human (Homo	95.53
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	95.37
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	95.14
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	94.86
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	94.16
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	94.09
d1sraa_		151	C-terminal (EC) domain of BM-40/SPARC/osteonectin	93.84
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	93.76
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	93.69
d1h1js_		44	S/mar DNA-binding protein Tho1 {Baker's yeast (Sac	93.55
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	93.45
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	93.29
d1tuza_		118	Diacylglycerol kinase alpha, N-terminal domain {Hu	93.26
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	93.11
d1zrja1		37	Heterogeneous nuclear ribonucleoprotein U-like pro	92.71
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	92.68
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	92.6
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	91.92
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	91.72
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	91.48
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	91.34
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	90.81
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	89.93
d2do1a1		42	Nuclear protein hcc-1 {Human (Homo sapiens) [TaxId	89.92
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	88.69
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	88.38
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	87.88
d2cclb1		59	Endo-1,4-beta-xylanase Y {Clostridium thermocellum	87.58
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	87.48
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	87.17
d1qasa1		94	Phosphoinositide-specific phospholipase C, isozyme	86.43
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	86.33
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	85.74
d1dava_		71	Cellulosome endoglucanase SS {Clostridium thermoce	83.97
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	82.43
d1j7qa_		86	Calcium vector protein {Amphioxus (Branchiostoma l	82.16
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	81.86
d1h8ba_		73	alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]}	81.74

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Troponin C
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=99.40  E-value=3.8e-13  Score=108.10  Aligned_cols=67  Identities=19%  Similarity=0.450  Sum_probs=63.8

Q ss_pred             HHHHHHHHHhhCCCCCCcccHHHHHHHHHhcCCCCCHHHHHHHHHHHcCCCCCcccHHHHHHHHhcC
Q 009156          465 DAKIGDRWRLLDRDYDGKVTAEEVASAAMYLKDTLDKEGIQELIANLSKDREGKILVEDIVKLASQT  531 (542)
Q Consensus       465 de~i~~aF~lfDkD~dG~Is~~EL~~aL~~lG~~lteeeI~eLi~~lD~D~DG~I~~deFvkl~~~~  531 (542)
                      ++++..+|+.||+|++|+|+..||+.+|+.+|.+++++++..|+..+|.|+||.|+|++|+.+|...
T Consensus         8 eeel~~~F~~fD~~~~G~I~~~el~~~l~~lg~~~~~~e~~~~~~~~D~d~dg~I~~~EF~~~m~~~   74 (75)
T d1jc2a_           8 EEELANCFRIFDKNADGFIDIEELGEILRATGEHVIEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGV   74 (75)
T ss_dssp             HHHHHHHHHHHCCSTTSSEEHHHHHHHHHHSSSCCCHHHHHHHHHHHCSSSCSEECHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHcCCCcCeEcHHHHHHHHHhcCCCccHHHHHHHHHHhCCCCCCcEeHHHHHHHHHhC
Confidence            4579999999999999999999999999999999999999999999999999999999999998754

PyMOL of d1jc2a_

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1h1js_ a.140.2.1 (S:) S/mar DNA-binding protein Tho1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1zrja1 a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucleoprotein U-like protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d2do1a1 a.140.2.1 (A:5-46) Nuclear protein hcc-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure