Citrus Sinensis ID: 009177

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-

MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCIDVATAKACYEANFPCRTPPNWWTEELSIIDIEFFSRIIAAMKKRGAKALTIASALITYTERSLRDLVRDHSAGNGTKSSDAQSTNSQVRYQQRELLESIVSLMPSEKAAFPINFLCCLLRSAIFLKASTSCKNELEKRVSAILEHVSVDDLLVLSFTYDGERLFDLESVRKIISGFVEKEKSMAVFSGSGDFRESCSCSPAMHRVAKTVGTYLGEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVLLIKENEALRSELTRMKLYISDVQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS

ccccccHHHHHHHHHccccccccEEcccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccc

MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCIDVATAKACYEANFPCRTPPNWWTEELSIIDIEFFSRIIAAMKKRGAKALTIASALITYTERSLRDLVRD**********************QRELLESIVSLMPSEKAAFPINFLCCLLRSAIFLKASTSCKNELEKRVSAILEHVSVDDLLVLSFTYDGERLFDLESVRKIISGFVEKEK*****************SPAMHRVAKTVGTYLGEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLR********************ADVLLIKENEALRSELTRMKLYI************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Root phototropism protein 2	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Signal transducer of the phototropic response and photo-induced movements. Necessary for root phototropism. Involved in hypocotyl phototropism under high rate but not under low rate light. Regulates stomata opening. Seems to be not involved in chloroplast accumulation and translocation.	confident	Q682S0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HQI, chain A
Confidence level:confident
Coverage over the Query: 2-125
View the alignment between query and template
View the model in PyMOL

Template: 3I3N, chain A
Confidence level:probable
Coverage over the Query: 2-129,140-183,210-257
View the alignment between query and template
View the model in PyMOL