Citrus Sinensis ID: 009261


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------54
MEALLLSSVSPFYNTPLKLKYNRTHFTAKPKLLSFHFSPLSTLSSFSSKPSKLFTTLSPSSQVSTEATDPPETEPETNSQEEKFDWFSQWYPLMPVCDLDKRVPHAKKVLGLDVVVWWDRNENEWRVFADACPHRLAPLSEGRIDQWGRLQCPYHGWCFSGSGDCKFIPQAPPDGPPVHTSKKACAAVYPSAVQNGILWFWPDIAPQCKDIIKTKKPPHIPELDDPSFTKMFGSRDVPYGYEVLMENLMDPAHLTYAHYGMMRTRKPKVMLDREGGRPIKISFEKIDINGFIAKQDSESAKFLAPCVFVVYFDLLENQENGSASSGGAEEKLKQRRVAMIFICAPVSPGNSRVIWAFPRNFQIWIDKVVPRWIFHIGQNLILDSDLCLLHVEERKIMAVGPANWQKACFVPTKSDNLVVGFRMWLKKYSGGQFNWGGKFDATLPPTLPREQLMDRYWSHVVNCKSCNAAHKSLNALEVILQVVSVVSVGIVAATKQNAMSMATRATIVSFAVICFAASKWLSHFVYKTFHYHDYNHALR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEECcccccccccCEEEEccccEEEEEEcccccEEEEEcccccccccccccEEccccEEEcccccEEEcccccEEEcccccccccccccccccccEEEEEEEEccEEEEEccccccccccccccccccccccccccccEEEEEEEECccccHHHHccccccccccccccccccccccEEECccccCEEEEEEEECccccccccccccccEECccEEEEEEEcccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEECccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccc
*******SVSPFYNTPLKLKYNRTHFTAKPKLLSFHFS*********************************************FDWFSQWYPLMPVCDLDKRVPHAKKVLGLDVVVWWDRNENEWRVFADACPHRLAPLSEGRIDQWGRLQCPYHGWCFSGSGDCKFIPQAP*********KKACAAVYPSAVQNGILWFWPDIAPQCKDIIKTKKPPHIPELDDPSFTKMFGSRDVPYGYEVLMENLMDPAHLTYAHYGMMRTRKPKVMLDREGGRPIKISFEKIDINGFIAKQDSESAKFLAPCVFVVYFDLLENQENGSASSGGAEEKLKQRRVAMIFICAPVSPGNSRVIWAFPRNFQIWIDKVVPRWIFHIGQNLILDSDLCLLHVEERKIMAVGPANWQKACFVPTKSDNLVVGFRMWLKKYSGGQFNWGGKFDATLPPTLPREQLMDRYWSHVVNCKSCNAAHKSLNALEVILQVVSVVSVGIVAATKQNAMSMATRATIVSFAVICFAASKWLSHFVYKTFHYHDYNHA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEALLLSSVSPFYNTPLKLKYNRTHFTAKPKLLSFHFSPLSTLSSFSSKPSKLFTTLSPSSQVSTEATDPPETEPETNSQEEKFDWFSQWYPLMPVCDLDKRVPHAKKVLGLDVVVWWDRNENEWRVFADACPHRLAPLSEGRIDQWGRLQCPYHGWCFSGSGDCKFIPQAPPDGPPVHTSKKACAAVYPSAVQNGILWFWPDIAPQCKDIIKTKKPPHIPELDDPSFTKMFGSRDVPYGYEVLMENLMDPAHLTYAHYGMMRTRKPKVMLDREGGRPIKISFEKIDINGFIAKQDSESAKFLAPCVFVVYFDLLENQENGSASSGGAEEKLKQRRVAMIFICAPVSPGNSRVIWAFPRNFQIWIDKVVPRWIFHIGQNLILDSDLCLLHVEERKIMAVGPANWQKACFVPTKSDNLVVGFRMWLKKYSGGQFNWGGKFDATLPPTLPREQLMDRYWSHVVNCKSCNAAHKSLNALEVILQVVSVVSVGIVAATKQNAMSMATRATIVSFAVICFAASKWLSHFVYKTFHYHDYNHALR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protochlorophyllide-dependent translocon component 52, chloroplastic Part of a translocon most abundantly expressed in etiolated plants and involved in the protochlorophyllide-dependent import of the precursor NADPH:protochlorophyllide oxidoreductase A (pPORA).probableQ8W496

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3N0Q, chain A
Confidence level:very confident
Coverage over the Query: 74-312,335-431
View the alignment between query and template
View the model in PyMOL
Template: 1Z01, chain A
Confidence level:very confident
Coverage over the Query: 73-322,334-443
View the alignment between query and template
View the model in PyMOL