Citrus Sinensis ID: 009316


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------
MDASMTMSKSVTTTSPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAGVGGKLKRRCGGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQKIVLATTPNEMAGATA
cccccccccccccccccEEECccccccccccccEEcccccccccccccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHccccEEEEEccccccccccccccccEEEcccccccccccHHHHHHHHHHccccEEcccccccccccHHHHHHHHcccEECcccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccEEEEEccccccccEEEcccHHHHHHHHHHHHHHHHHHcccccEEEEEccccccEEEEEEEEcccccEEEEcccccHHHHccHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEcccccccccccccEEHHHHHHHHHHHHHccccccccccccEEccEEEEEEEcccccccccccccccccEEEccccccEEEcccccccccccccccHHHHHHHcccccHHHHHHHHHHHHcccEEccccccHHHHHHHcccccccccccccccHHccHHHHcccccccccccccHHHcccc
**************SPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVV*****KLKRRCGGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQ***************EMAGA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDASMTMSKSVTTTSPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAGVGGKLKRRCGGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQKIVLATTPNEMAGATA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Biotin carboxylase, chloroplastic This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.confidentO04983
Biotin carboxylase 1, chloroplastic This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.confidentB9HBA8
Biotin carboxylase This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.probableP37798

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.4.-.-Forming carbon-carbon bonds.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.4.-Other carbon--nitrogen ligases.probable
6.4.1.-Ligases that form carbon-carbon bonds.probable
6.4.1.2Acetyl-CoA carboxylase.probable
6.3.4.14Biotin carboxylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DZD, chain A
Confidence level:very confident
Coverage over the Query: 68-515
View the alignment between query and template
View the model in PyMOL