Citrus Sinensis ID: 009316

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------
MDASMTMSKSVTTTSPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAGVGGKLKRRCGGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQKIVLATTPNEMAGATA
cccccccccccccccccEEEEccccccccccccEEcccccccccccccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHccccEEEEEccccccccccccccccEEEcccccccccccHHHHHHHHHHccccEEcccccccccccHHHHHHHHcccEEEcccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccEEEEEccccccccEEEcccHHHHHHHHHHHHHHHHHHcccccEEEEEccccccEEEEEEEEcccccEEEEcccccHHHHccHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEcccccccccccccEEHHHHHHHHHHHHHccccccccccccEEccEEEEEEEcccccccccccccccccEEEccccccEEEccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHcccEEccccccHHHHHHHcccccccccccccccHHccHHHHcccccccccccccHHHcccc
ccccEEcccccccccccEEEcccccEEEccccEEEccccEEcccccccHHccccccEEccccccHHHHHHHcEEEEcccHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHccEEEEEEcccHHHccccHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHcccEEccccHHHHHHHHcHHHHHHHHHHHcccEccEcccccccHHHHHHHHHHHcccEEEEEccccccccEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEccEEEEEEEEccccccHHHHHHHHcccHHHHHHHHHccccccccHHHcccccEEEEEEEEEEcccccccEccEEccEEEccccccEEEEEccccccEEccccccEEEEEEEEEccHHHHHHHHHHHHHHcEEEcccEcHHHHHHHHccHHHHHccccccHHHHcHHHHcccccccccHHHHHHHHHcc
mdasmtmsksvtttspglfvgrgkgilrssqcsfmvgsrtvnfprqvvagvggklkrrcggggalkvtCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVkladesvcigeapssqsyllIPNVLSAAISRgctmlhpgygflaeNAVFVEMCREHginfigpnpdsirimgdKSTARetmknagvptvpgsdgllqSTEEAVKLADELGFPVMIkataggggrgmrlakePDEFVKLLQQAKSEAAAAFGNDGVYLEKyvqnprhiEFQVLAdkygnvvhfgerdcSIQRRNQKLleeapspaltpELRKAMGDAAVAAAASIGYIGVGTVEFLldergsfyfmeMNTRIQVEHPVTEMISSVDLIEEQIHVAMGgklrykqediVLQGHSiecrinaedpfknfrpgpgiitaylpaggpfvrmdshvypdyvvppsydslLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILdvedfkngkvdtafipkheqelqapqkivlattpnemagata
mdasmtmsksvtttspglfvgrgKGILRSSQCSFmvgsrtvnfprqvvagvggklkrrcggggalkvtcrqekilvanrGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGinfigpnpdsiRIMGDKSTARETMKnagvptvpgsdgLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRAlndtiitgvptTIEYHKLILDVEDFKNGKVDTAFIPkheqelqapqkivlatTPNEMAGATA
MDAsmtmsksvtttsPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAgvggklkrrcggggALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDaavaaaaSIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQKIVLATTPNEMAGATA
****************GLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAGVGGKLKRRCGGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPN**************************************VKLADELGFPVMIKATAGG*************FVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSI************************GDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIP**************************
**************SP*LF**************************************************RQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQ***************EMAGA**
************TTSPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAGVGGKLKRRCGGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQKIVLATTPNEMAGATA
*****TMSKSVTTTSPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVV*****KLKRRCGGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQKIVLATTPN*MAG*T*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDASMTMSKSVTTTSPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAGVGGKLKRRCGGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQKIVLATTPNEMAGATA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query537 2.2.26 [Sep-21-2011]
B9HBA8528 Biotin carboxylase 1, chl yes no 0.968 0.984 0.882 0.0
B9N843526 Biotin carboxylase 2, chl no no 0.972 0.992 0.879 0.0
O04983537 Biotin carboxylase, chlor yes no 0.970 0.970 0.854 0.0
Q06862447 Biotin carboxylase OS=Nos yes no 0.817 0.982 0.653 1e-179
P49787450 Biotin carboxylase 1 OS=B yes no 0.824 0.984 0.581 1e-147
O27939491 Pyruvate carboxylase subu yes no 0.841 0.920 0.549 1e-145
Q58626501 Pyruvate carboxylase subu yes no 0.828 0.888 0.522 1e-135
D3DJ42472 2-oxoglutarate carboxylas yes no 0.821 0.934 0.545 1e-133
P37798449 Biotin carboxylase OS=Pse yes no 0.817 0.977 0.527 1e-132
P43873448 Biotin carboxylase OS=Hae yes no 0.817 0.979 0.540 1e-132
>sp|B9HBA8|ACCC1_POPTR Biotin carboxylase 1, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_831870 PE=2 SV=1 Back     alignment and function desciption
 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/526 (88%), Positives = 492/526 (93%), Gaps = 6/526 (1%)

Query: 1   MDASMTMSKSVTTTSPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAGVGGKLKRRCG 60
           M+A++ + KSVT+T PGLF+G+  GI RSSQCSFM+G++ VNFPRQ          +   
Sbjct: 1   MEATLPVCKSVTST-PGLFMGKTSGI-RSSQCSFMMGNK-VNFPRQRAQTAHVHCAK--- 54

Query: 61  GGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCI 120
            GGAL VTCR EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCI
Sbjct: 55  NGGALGVTCRAEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCI 114

Query: 121 GEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIR 180
           GEAPSSQSYL+IPNVLSAAISR CTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIR
Sbjct: 115 GEAPSSQSYLVIPNVLSAAISRRCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIR 174

Query: 181 IMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLA 240
           +MGDKSTARETMK AGVPTVPGSDGLLQSTEE V+LA+E+G+PVMIKATAGGGGRGMRLA
Sbjct: 175 VMGDKSTARETMKKAGVPTVPGSDGLLQSTEEGVRLANEIGYPVMIKATAGGGGRGMRLA 234

Query: 241 KEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSI 300
           KEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADK+GNVVHFGERDCSI
Sbjct: 235 KEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKFGNVVHFGERDCSI 294

Query: 301 QRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNT 360
           QRRNQKLLEEAPSPALTPELRKAMGDAAV+AAASIGYIGVGTVEFLLDERGSFYFMEMNT
Sbjct: 295 QRRNQKLLEEAPSPALTPELRKAMGDAAVSAAASIGYIGVGTVEFLLDERGSFYFMEMNT 354

Query: 361 RIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPG 420
           RIQVEHPVTEMISSVDLIEEQI VAMG KLRYKQEDIVL+GHSIECRINAED FK FRPG
Sbjct: 355 RIQVEHPVTEMISSVDLIEEQIRVAMGEKLRYKQEDIVLRGHSIECRINAEDAFKGFRPG 414

Query: 421 PGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTI 480
           PG ITAYLP+GGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRAL+DTI
Sbjct: 415 PGRITAYLPSGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALDDTI 474

Query: 481 ITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQKIVLA 526
           ITGVPTTI+YHKLIL++EDFKNG VDTAFIPKHE+EL APQ+I+ A
Sbjct: 475 ITGVPTTIDYHKLILEIEDFKNGNVDTAFIPKHEKELAAPQQIIPA 520
This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.
Populus trichocarpa (taxid: 3694)
EC: 6EC: .EC: 4EC: .EC: 1EC: .EC: 2
>sp|B9N843|ACCC2_POPTR Biotin carboxylase 2, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_673504 PE=2 SV=1 Back     alignment and function description
>sp|O04983|ACCC_ARATH Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana GN=CAC2 PE=1 SV=1 Back     alignment and function description
>sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 Back     alignment and function description
>sp|P49787|ACCC1_BACSU Biotin carboxylase 1 OS=Bacillus subtilis (strain 168) GN=accC1 PE=3 SV=3 Back     alignment and function description
>sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 Back     alignment and function description
>sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 Back     alignment and function description
>sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 Back     alignment and function description
>sp|P37798|ACCC_PSEAE Biotin carboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=accC PE=1 SV=1 Back     alignment and function description
>sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query537
145910320535 chloroplast biotin carboxylase [Gossypiu 0.990 0.994 0.875 0.0
239759398533 biotin carboxylase [Camellia oleifera] 0.988 0.996 0.881 0.0
224087339528 predicted protein [Populus trichocarpa] 0.968 0.984 0.882 0.0
255557562541 Biotin caboxylase subunit (BC) of Het-AC 0.992 0.985 0.873 0.0
380853844536 acetyl-CoA carboxylase [Nicotiana tabacu 0.988 0.990 0.874 0.0
307566892536 acetyl-CoA carboxylase BC subunit [Jatro 0.986 0.988 0.871 0.0
238837063536 heteromeric acetyl-CoA biotin carboxylas 0.986 0.988 0.867 0.0
224118754526 predicted protein [Populus trichocarpa] 0.972 0.992 0.879 0.0
225445664525 PREDICTED: biotin carboxylase 1, chlorop 0.970 0.992 0.880 0.0
297736021587 unnamed protein product [Vitis vinifera] 0.970 0.887 0.880 0.0
>gi|145910320|gb|ABP98813.1| chloroplast biotin carboxylase [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/538 (87%), Positives = 499/538 (92%), Gaps = 6/538 (1%)

Query: 1   MDASMTMSKSVTTTSPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAGVGGKLKR-RC 59
           MDAS+TM KSVT+  PGLF+GR + ++RSSQC+FMVGSR +N PRQ       + K  RC
Sbjct: 3   MDASLTMCKSVTS-PPGLFLGRSR-VIRSSQCTFMVGSR-INLPRQKAQSTQVRCKSSRC 59

Query: 60  GGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVC 119
           GG  AL   CR EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVC
Sbjct: 60  GG--ALGAKCRAEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVC 117

Query: 120 IGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSI 179
           IGEAPSSQSYLLIPNVLSAAISR CTMLHPGYGFL+ENAVFVEMCR+H INFIGPNPDSI
Sbjct: 118 IGEAPSSQSYLLIPNVLSAAISRNCTMLHPGYGFLSENAVFVEMCRDHRINFIGPNPDSI 177

Query: 180 RIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRL 239
           R+MGDKSTARETMKNAGVPTVPGSDGLLQSTEEA+KLA E+GFPVMIKATAGGGGRGMRL
Sbjct: 178 RVMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAIKLAHEIGFPVMIKATAGGGGRGMRL 237

Query: 240 AKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCS 299
           +KEPDEFVKLLQQAKSEAAAAFGNDGVYLEKY+QNPRHIEFQ LADKYGNVVHFGERDCS
Sbjct: 238 SKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYIQNPRHIEFQALADKYGNVVHFGERDCS 297

Query: 300 IQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMN 359
           IQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMN
Sbjct: 298 IQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMN 357

Query: 360 TRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRP 419
           TRIQVEHPVTEMISSVDLIEEQI VAMG KLRYKQEDIVL+GHSIECRINAED FK FRP
Sbjct: 358 TRIQVEHPVTEMISSVDLIEEQIRVAMGEKLRYKQEDIVLRGHSIECRINAEDAFKGFRP 417

Query: 420 GPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDT 479
           GPG IT+YLP+GGPFVRMDSHVY DYVVPPSYDSLLGKLIVWAPTREKAIERMKRAL+DT
Sbjct: 418 GPGRITSYLPSGGPFVRMDSHVYSDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALDDT 477

Query: 480 IITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQKIVLATTPNEMAGATA 537
           +ITGVPTTIEYHKLILD+EDF+NGKVDTAFIPKHE+EL APQK+V+A+   E+  ATA
Sbjct: 478 VITGVPTTIEYHKLILDIEDFRNGKVDTAFIPKHEEELAAPQKMVVASPAKELTSATA 535

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|239759398|gb|ACS14663.1| biotin carboxylase [Camellia oleifera] Back     alignment and taxonomy information
>gi|224087339|ref|XP_002308127.1| predicted protein [Populus trichocarpa] gi|290463112|sp|B9HBA8.1|ACCC1_POPTR RecName: Full=Biotin carboxylase 1, chloroplastic; AltName: Full=Acetyl-CoA carboxylase subunit A 1; Short=ACC; Flags: Precursor gi|222854103|gb|EEE91650.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255557562|ref|XP_002519811.1| Biotin caboxylase subunit (BC) of Het-ACCase [Ricinus communis] gi|223541050|gb|EEF42607.1| Biotin caboxylase subunit (BC) of Het-ACCase [Ricinus communis] Back     alignment and taxonomy information
>gi|380853844|gb|AFE88229.1| acetyl-CoA carboxylase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|307566892|gb|ADN52612.1| acetyl-CoA carboxylase BC subunit [Jatropha curcas] Back     alignment and taxonomy information
>gi|238837063|gb|ACR61637.1| heteromeric acetyl-CoA biotin carboxylase [Jatropha curcas] Back     alignment and taxonomy information
>gi|224118754|ref|XP_002331438.1| predicted protein [Populus trichocarpa] gi|290463113|sp|B9N843.1|ACCC2_POPTR RecName: Full=Biotin carboxylase 2, chloroplastic; AltName: Full=Acetyl-CoA carboxylase subunit A 2; Short=ACC; Flags: Precursor gi|222873652|gb|EEF10783.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225445664|ref|XP_002266489.1| PREDICTED: biotin carboxylase 1, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736021|emb|CBI24059.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query537
TIGR_CMR|GSU_2019446 GSU_2019 "acetyl-CoA carboxyla 0.817 0.984 0.593 3.1e-138
TIGR_CMR|BA_4408450 BA_4408 "acetyl-CoA carboxylas 0.824 0.984 0.567 4e-138
TIGR_CMR|CHY_1998449 CHY_1998 "acetyl-CoA carboxyla 0.821 0.982 0.573 7.7e-135
TIGR_CMR|CHY_0918517 CHY_0918 "acetyl-CoA carboxyla 0.824 0.856 0.527 5.2e-129
UNIPROTKB|Q487S0448 accC "Acetyl-CoA carboxylase, 0.826 0.991 0.539 6.8e-127
TIGR_CMR|CPS_0946448 CPS_0946 "acetyl-CoA carboxyla 0.826 0.991 0.539 6.8e-127
TIGR_CMR|SPO_1010449 SPO_1010 "acetyl-CoA carboxyla 0.800 0.957 0.557 4.8e-126
TIGR_CMR|CJE_1482443 CJE_1482 "acetyl-CoA carboxyla 0.819 0.993 0.529 1.3e-125
UNIPROTKB|Q9KV62447 VC_0295 "Acetyl-CoA carboxylas 0.817 0.982 0.529 2.4e-124
TIGR_CMR|VC_0295447 VC_0295 "acetyl-CoA carboxylas 0.817 0.982 0.529 2.4e-124
TIGR_CMR|GSU_2019 GSU_2019 "acetyl-CoA carboxylase, biotin carboxylase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
 Score = 1353 (481.3 bits), Expect = 3.1e-138, P = 3.1e-138
 Identities = 261/440 (59%), Positives = 321/440 (72%)

Query:    73 KILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLI 132
             K+L+ANRGEIA+RVIR   E+GI  VAVYST D+D+LHVKLADESVCIG APS QSYL I
Sbjct:     4 KVLIANRGEIALRVIRACKELGIKTVAVYSTADRDSLHVKLADESVCIGPAPSLQSYLNI 63

Query:   133 PNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETM 192
               ++SAA       +HPGYGFL+ENA F E+C   GI FIGP+  S+RIMGDK +AR+ +
Sbjct:    64 NAIISAAELTDAEAIHPGYGFLSENAAFAEICENCGITFIGPSSQSMRIMGDKISARQAV 123

Query:   193 KNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQ 252
                 VP +PG+   +    EAVK+A ++GFPV+IKATAGGGGRGM++   P         
Sbjct:   124 IKENVPILPGTKEGVNDVNEAVKIAKKIGFPVIIKATAGGGGRGMKIVHSPAALPNAFAT 183

Query:   253 AKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAP 312
             A++EA A FGN  VY+EKY + PRH+E QV+ADK+GNV+H GERDCSIQRR+QK++EE+P
Sbjct:   184 ARAEAQAGFGNPEVYIEKYCEKPRHVEIQVMADKHGNVIHLGERDCSIQRRHQKIIEESP 243

Query:   313 SPALTPELRKAMGDXXXXXXXSIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMI 372
              P +TP LRKAMGD       ++GY  VGTVEFL+D+  +FYFMEMNTR+QVEHPVTEM+
Sbjct:   244 CPVMTPALRKAMGDAAVRASKAVGYDSVGTVEFLVDKDLNFYFMEMNTRVQVEHPVTEMV 303

Query:   373 SSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGG 432
             + +D++ EQI  A G KLRYKQ DI L GH+IECRINAEDP K F P PG I  Y   GG
Sbjct:   304 TGIDIVREQIRSAAGLKLRYKQSDIKLHGHAIECRINAEDPVK-FTPSPGKIVGYHTPGG 362

Query:   433 PFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYHK 492
               VR+DS VY  Y V P YDSL+ KLIV A TRE AI RM RAL++ II G+ TTI +HK
Sbjct:   363 LGVRIDSFVYDQYSVVPHYDSLIAKLIVHAETREDAIRRMARALDEYIIEGIKTTIPFHK 422

Query:   493 LILDVEDFKNGKVDTAFIPK 512
              I+D +DF  G VDT F+ +
Sbjct:   423 RIMDNKDFMEGNVDTGFLER 442
GO:0003989 "acetyl-CoA carboxylase activity" evidence=ISS
GO:0006633 "fatty acid biosynthetic process" evidence=ISS
TIGR_CMR|BA_4408 BA_4408 "acetyl-CoA carboxylase, biotin carboxylase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1998 CHY_1998 "acetyl-CoA carboxylase, biotin carboxylase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0918 CHY_0918 "acetyl-CoA carboxylase, biotin carboxylase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q487S0 accC "Acetyl-CoA carboxylase, biotin carboxylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0946 CPS_0946 "acetyl-CoA carboxylase, biotin carboxylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1010 SPO_1010 "acetyl-CoA carboxylase, biotin carboxylase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_1482 CJE_1482 "acetyl-CoA carboxylase, biotin carboxylase" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KV62 VC_0295 "Acetyl-CoA carboxylase, biotin carboxylase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0295 VC_0295 "acetyl-CoA carboxylase, biotin carboxylase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58626PYCA_METJA6, ., 4, ., 1, ., 10.52240.82860.8882yesno
P24182ACCC_ECOLI6, ., 4, ., 1, ., 20.53160.81750.9777N/Ano
Q06862ACCC_NOSS16, ., 4, ., 1, ., 20.65370.81750.9821yesno
P37798ACCC_PSEAE6, ., 4, ., 1, ., 20.52710.81750.9777yesno
P49787ACCC1_BACSU6, ., 4, ., 1, ., 20.58100.82490.9844yesno
Q8X9B6ACCC_ECO576, ., 4, ., 1, ., 20.53160.81750.9777N/Ano
O04983ACCC_ARATH6, ., 4, ., 1, ., 20.85470.97020.9702yesno
O30019PYCA_ARCFU6, ., 4, ., 1, ., 10.50680.81370.8636yesno
B9N843ACCC2_POPTR6, ., 4, ., 1, ., 20.87920.97200.9923nono
O27939PYCA_METTH6, ., 4, ., 1, ., 10.54960.84170.9205yesno
P43873ACCC_HAEIN6, ., 4, ., 1, ., 20.54070.81750.9799yesno
D3DJ422OCS_HYDTT6, ., 4, ., 1, ., 70.54520.82120.9343yesno
O52058ACCC_ALLVD6, ., 4, ., 1, ., 20.53390.81750.9777yesno
B9HBA8ACCC1_POPTR6, ., 4, ., 1, ., 20.88210.96830.9848yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer6.4.1.20.994
3rd Layer6.3.40.998
3rd Layer6.3.4.140.994
3rd Layer6.4.10.998

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_VI0248
hypothetical protein (528 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00041116
SubName- Full=Putative uncharacterized protein; (281 aa)
• •  •• 0.976
estExt_Genewise1_v1.C_LG_XVII1359
hypothetical protein (284 aa)
• •  •• 0.974
grail3.0095003402
hypothetical protein (284 aa)
• •  •• 0.974
estExt_fgenesh4_pg.C_LG_IX0832
[acyl-carrier protein] S-malonyltransferase (EC-2.3.1.39) (371 aa)
•    •• 0.963
gw1.XIV.1152.1
acetyl-CoA carboxylase (587 aa)
• •  •• 0.958
eugene3.00161050
SubName- Full=Putative uncharacterized protein; (760 aa)
• •  •• 0.939
eugene3.00060828
acetyl-CoA carboxylase (EC-6.4.1.2) (753 aa)
• •  •• 0.939
fgenesh4_pg.C_scaffold_16349000001
Predicted protein (290 aa)
• ••••• 0.921
fgenesh4_pg.C_LG_XV000664
malate synthase (EC-2.3.3.9) (554 aa)
    ••• 0.919
eugene3.00140876
acetate-CoA ligase (EC-6.2.1.1) (684 aa)
     •• 0.911

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
PRK08591451 PRK08591, PRK08591, acetyl-CoA carboxylase biotin 0.0
TIGR00514449 TIGR00514, accC, acetyl-CoA carboxylase, biotin ca 0.0
PRK05586447 PRK05586, PRK05586, biotin carboxylase; Validated 0.0
PRK08654499 PRK08654, PRK08654, pyruvate carboxylase subunit A 0.0
COG4770 645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 0.0
COG0439449 COG0439, AccC, Biotin carboxylase [Lipid metabolis 0.0
PRK06111450 PRK06111, PRK06111, acetyl-CoA carboxylase biotin 0.0
PRK12999 1146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 0.0
PRK08462445 PRK08462, PRK08462, biotin carboxylase; Validated 0.0
PRK07178472 PRK07178, PRK07178, pyruvate carboxylase subunit A 0.0
PRK12833467 PRK12833, PRK12833, acetyl-CoA carboxylase biotin 0.0
COG1038 1149 COG1038, PycA, Pyruvate carboxylase [Energy produc 0.0
PRK08463478 PRK08463, PRK08463, acetyl-CoA carboxylase subunit 0.0
TIGR02712 1201 TIGR02712, urea_carbox, urea carboxylase 1e-174
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 1e-168
pfam02786211 pfam02786, CPSase_L_D2, Carbamoyl-phosphate syntha 3e-96
smart00878107 smart00878, Biotin_carb_C, Biotin carboxylase C-te 2e-54
pfam02785107 pfam02785, Biotin_carb_C, Biotin carboxylase C-ter 3e-54
pfam00289108 pfam00289, CPSase_L_chain, Carbamoyl-phosphate syn 2e-47
COG0458400 COG0458, CarB, Carbamoylphosphate synthase large s 1e-19
TIGR013691050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth 3e-17
TIGR01369 1050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth 2e-15
PRK128151068 PRK12815, carB, carbamoyl phosphate synthase large 2e-15
COG0026375 COG0026, PurK, Phosphoribosylaminoimidazole carbox 1e-14
pfam13535183 pfam13535, ATP-grasp_4, ATP-grasp domain 4e-14
PRK06019372 PRK06019, PRK06019, phosphoribosylaminoimidazole c 1e-13
PRK05294 1066 PRK05294, carB, carbamoyl phosphate synthase large 3e-13
PRK12815 1068 PRK12815, carB, carbamoyl phosphate synthase large 7e-13
PRK01372304 PRK01372, ddl, D-alanine--D-alanine ligase; Review 1e-12
TIGR01161352 TIGR01161, purK, phosphoribosylaminoimidazole carb 3e-12
PLN027351102 PLN02735, PLN02735, carbamoyl-phosphate synthase 2e-11
TIGR00768277 TIGR00768, rimK_fam, alpha-L-glutamate ligases, Ri 7e-11
TIGR01205315 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine l 2e-10
COG1181317 COG1181, DdlA, D-alanine-D-alanine ligase and rela 4e-10
pfam02222171 pfam02222, ATP-grasp, ATP-grasp domain 8e-10
PLN02948 577 PLN02948, PLN02948, phosphoribosylaminoimidazole c 3e-09
pfam07478201 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-t 5e-09
PLN02735 1102 PLN02735, PLN02735, carbamoyl-phosphate synthase 1e-08
PRK12767326 PRK12767, PRK12767, carbamoyl phosphate synthase-l 1e-08
TIGR00877422 TIGR00877, purD, phosphoribosylamine--glycine liga 3e-08
TIGR02144280 TIGR02144, LysX_arch, Lysine biosynthesis enzyme L 9e-08
COG0151428 COG0151, PurD, Phosphoribosylamine-glycine ligase 8e-07
pfam08443190 pfam08443, RimK, RimK-like ATP-grasp domain 4e-06
PRK052941066 PRK05294, carB, carbamoyl phosphate synthase large 6e-06
TIGR02068 864 TIGR02068, cya_phycin_syn, cyanophycin synthetase 8e-06
COG0189318 COG0189, RimK, Glutathione synthase/Ribosomal prot 8e-06
PRK14569296 PRK14569, PRK14569, D-alanyl-alanine synthetase A; 1e-05
PRK13790379 PRK13790, PRK13790, phosphoribosylamine--glycine l 6e-05
pfam01071193 pfam01071, GARS_A, Phosphoribosylglycinamide synth 8e-05
PRK02186 887 PRK02186, PRK02186, argininosuccinate lyase; Provi 1e-04
pfam08442202 pfam08442, ATP-grasp_2, ATP-grasp domain 1e-04
PRK00696388 PRK00696, sucC, succinyl-CoA synthetase subunit be 1e-04
PRK00885420 PRK00885, PRK00885, phosphoribosylamine--glycine l 1e-04
COG0045387 COG0045, SucC, Succinyl-CoA synthetase, beta subun 3e-04
PRK14016 727 PRK14016, PRK14016, cyanophycin synthetase; Provis 3e-04
PRK01966333 PRK01966, ddl, D-alanyl-alanine synthetase A; Revi 4e-04
PRK13789426 PRK13789, PRK13789, phosphoribosylamine--glycine l 5e-04
TIGR01142380 TIGR01142, purT, phosphoribosylglycinamide formylt 0.002
TIGR01016386 TIGR01016, sucCoAbeta, succinyl-CoA synthetase, be 0.002
>gnl|CDD|236307 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information 
 Score =  839 bits (2169), Expect = 0.0
 Identities = 274/451 (60%), Positives = 348/451 (77%), Gaps = 3/451 (0%)

Query: 72  EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLL 131
           +KIL+ANRGEIA+R+IR   E+GI  VAV+ST D+DALHV+LADE+VCIG APS +SYL 
Sbjct: 3   DKILIANRGEIALRIIRACKELGIKTVAVHSTADRDALHVQLADEAVCIGPAPSKKSYLN 62

Query: 132 IPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARET 191
           IP ++SAA   G   +HPGYGFL+ENA F E+C + G  FIGP+ ++IR+MGDK TA+ T
Sbjct: 63  IPAIISAAEITGADAIHPGYGFLSENADFAEICEDSGFTFIGPSAETIRLMGDKVTAKAT 122

Query: 192 MKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQ 251
           MK AGVP VPGSDG +   EEA+ +A E+G+PV+IKATAGGGGRGMR+ +   E  K   
Sbjct: 123 MKKAGVPVVPGSDGPVDDEEEALAIAKEIGYPVIIKATAGGGGRGMRVVRTEAELEKAFS 182

Query: 252 QAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEA 311
            A++EA AAFGN GVY+EKY++NPRHIE QVLAD +GN +H GERDCS+QRR+QK+LEEA
Sbjct: 183 MARAEAKAAFGNPGVYMEKYLENPRHIEIQVLADGHGNAIHLGERDCSLQRRHQKVLEEA 242

Query: 312 PSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEM 371
           PSPA+T ELR+ +G+AAV AA +IGY G GT+EFL ++ G FYF+EMNTRIQVEHPVTEM
Sbjct: 243 PSPAITEELRRKIGEAAVKAAKAIGYRGAGTIEFLYEKNGEFYFIEMNTRIQVEHPVTEM 302

Query: 372 ISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAG 431
           I+ VDL++EQI +A G  L  KQEDIV +GH+IECRINAEDP KNF P PG IT Y P G
Sbjct: 303 ITGVDLVKEQIRIAAGEPLSIKQEDIVFRGHAIECRINAEDPAKNFMPSPGKITRYHPPG 362

Query: 432 GPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEYH 491
           GP VR+DS VY  Y +PP YDS++GKLIV   TRE+AI RMKRAL++ +I G+ TTI  H
Sbjct: 363 GPGVRVDSAVYTGYTIPPYYDSMIGKLIVHGETREEAIARMKRALSEFVIDGIKTTIPLH 422

Query: 492 KLILDVEDFKNGKVDTAFIPKHEQELQAPQK 522
             +L+  +F+ G  +  ++   E++L   ++
Sbjct: 423 LRLLNDPNFQAGDYNIHYL---EKKLALQEE 450

Length = 451
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|236325 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223516 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236269 PRK08462, PRK08462, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|190425 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>gnl|CDD|214878 smart00878, Biotin_carb_C, Biotin carboxylase C-terminal domain Back     alignment and domain information
>gnl|CDD|202395 pfam02785, Biotin_carb_C, Biotin carboxylase C-terminal domain Back     alignment and domain information
>gnl|CDD|201133 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>gnl|CDD|223534 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223105 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|222206 pfam13535, ATP-grasp_4, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|235674 PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|234948 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|233295 TIGR01161, purK, phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>gnl|CDD|215391 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|233121 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>gnl|CDD|233310 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase Back     alignment and domain information
>gnl|CDD|224102 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|216935 pfam02222, ATP-grasp, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>gnl|CDD|203643 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-terminus Back     alignment and domain information
>gnl|CDD|215391 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|237195 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233164 TIGR00877, purD, phosphoribosylamine--glycine ligase Back     alignment and domain information
>gnl|CDD|131199 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX Back     alignment and domain information
>gnl|CDD|223229 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|117020 pfam08443, RimK, RimK-like ATP-grasp domain Back     alignment and domain information
>gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233705 TIGR02068, cya_phycin_syn, cyanophycin synthetase Back     alignment and domain information
>gnl|CDD|223267 COG0189, RimK, Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173033 PRK14569, PRK14569, D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>gnl|CDD|237507 PRK13790, PRK13790, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|216282 pfam01071, GARS_A, Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information
>gnl|CDD|235010 PRK02186, PRK02186, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|219843 pfam08442, ATP-grasp_2, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|234813 PRK00696, sucC, succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|234856 PRK00885, PRK00885, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|223123 COG0045, SucC, Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237586 PRK14016, PRK14016, cyanophycin synthetase; Provisional Back     alignment and domain information
>gnl|CDD|234993 PRK01966, ddl, D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>gnl|CDD|184327 PRK13789, PRK13789, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|130212 TIGR01142, purT, phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>gnl|CDD|233234 TIGR01016, sucCoAbeta, succinyl-CoA synthetase, beta subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 537
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 100.0
KOG0238 670 consensus 3-Methylcrotonyl-CoA carboxylase, biotin 100.0
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 100.0
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 100.0
PRK08654499 pyruvate carboxylase subunit A; Validated 100.0
KOG0369 1176 consensus Pyruvate carboxylase [Energy production 100.0
PRK07178472 pyruvate carboxylase subunit A; Validated 100.0
PRK08463478 acetyl-CoA carboxylase subunit A; Validated 100.0
PRK12833467 acetyl-CoA carboxylase biotin carboxylase subunit; 100.0
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 100.0
PRK12999 1146 pyruvate carboxylase; Reviewed 100.0
PRK05586447 biotin carboxylase; Validated 100.0
TIGR00514449 accC acetyl-CoA carboxylase, biotin carboxylase su 100.0
PRK08462445 biotin carboxylase; Validated 100.0
PRK08591451 acetyl-CoA carboxylase biotin carboxylase subunit; 100.0
TIGR02712 1201 urea_carbox urea carboxylase. Members of this fami 100.0
KOG0368 2196 consensus Acetyl-CoA carboxylase [Lipid transport 100.0
PRK06111450 acetyl-CoA carboxylase biotin carboxylase subunit; 100.0
PLN02948 577 phosphoribosylaminoimidazole carboxylase 100.0
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 100.0
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 100.0
PLN027351102 carbamoyl-phosphate synthase 100.0
PF02786211 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, 100.0
PLN02735 1102 carbamoyl-phosphate synthase 100.0
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 100.0
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 100.0
PRK07206416 hypothetical protein; Provisional 100.0
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 100.0
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 100.0
PRK02186 887 argininosuccinate lyase; Provisional 100.0
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 100.0
PRK00885420 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 100.0
TIGR00877423 purD phosphoribosylamine--glycine ligase. This enz 100.0
TIGR013691050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 100.0
PLN02257434 phosphoribosylamine--glycine ligase 100.0
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK128151068 carB carbamoyl phosphate synthase large subunit; R 100.0
COG0458400 CarB Carbamoylphosphate synthase large subunit (sp 100.0
PRK052941066 carB carbamoyl phosphate synthase large subunit; R 100.0
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 100.0
PRK05784486 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 100.0
PRK13790379 phosphoribosylamine--glycine ligase; Provisional 100.0
COG0027394 PurT Formate-dependent phosphoribosylglycinamide f 100.0
PRK14569296 D-alanyl-alanine synthetase A; Provisional 100.0
PRK06524493 biotin carboxylase-like protein; Validated 100.0
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 100.0
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotid 100.0
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 100.0
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 100.0
PRK06849389 hypothetical protein; Provisional 100.0
TIGR01205315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 100.0
PRK14568343 vanB D-alanine--D-lactate ligase; Provisional 100.0
PF02785107 Biotin_carb_C: Biotin carboxylase C-terminal domai 100.0
PRK14572347 D-alanyl-alanine synthetase A; Provisional 100.0
PRK14570364 D-alanyl-alanine synthetase A; Provisional 99.98
smart00878107 Biotin_carb_C Biotin carboxylase C-terminal domain 99.97
PRK14571299 D-alanyl-alanine synthetase A; Provisional 99.97
PRK14573809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 99.97
COG2232389 Predicted ATP-dependent carboligase related to bio 99.96
PRK10446300 ribosomal protein S6 modification protein; Provisi 99.95
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 99.95
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 99.95
PRK13278358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 99.94
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.94
KOG03701435 consensus Multifunctional pyrimidine synthesis pro 99.94
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 99.94
PRK13277366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 99.93
KOG0237 788 consensus Glycinamide ribonucleotide synthetase (G 99.93
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 99.93
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-gr 99.92
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.91
PF02222172 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T 99.91
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 99.9
PRK14016 727 cyanophycin synthetase; Provisional 99.89
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 99.86
), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071194 GARS_A: Phosphoribosylglycinamide synthetase, ATP- 99.85
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 99.83
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 99.82
COG3919415 Predicted ATP-grasp enzyme [General function predi 99.81
PRK12458338 glutathione synthetase; Provisional 99.76
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 99.72
TIGR02068 864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 99.71
TIGR01380312 glut_syn glutathione synthetase, prokaryotic. This 99.7
PRK05246316 glutathione synthetase; Provisional 99.7
TIGR01435737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 99.68
PRK02471752 bifunctional glutamate--cysteine ligase/glutathion 99.67
PLN02941328 inositol-tetrakisphosphate 1-kinase 99.65
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofu 99.6
TIGR02291317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 99.54
PF14398262 ATPgrasp_YheCD: YheC/D like ATP-grasp 99.18
TIGR01016386 sucCoAbeta succinyl-CoA synthetase, beta subunit. 99.14
PRK00696388 sucC succinyl-CoA synthetase subunit beta; Provisi 99.1
PF14397285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 99.07
PF13549222 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A. 98.85
PF02955173 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP 98.55
PRK14046392 malate--CoA ligase subunit beta; Provisional 98.55
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy 98.5
PLN00124422 succinyl-CoA ligase [GDP-forming] subunit beta; Pr 98.48
PF08442202 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 98.23
PF02750203 Synapsin_C: Synapsin, ATP binding domain; InterPro 98.23
PLN02235423 ATP citrate (pro-S)-lyase 98.22
PF05770307 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- 98.14
PF14305239 ATPgrasp_TupA: TupA-like ATPgrasp 98.11
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 97.91
PF03133292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 97.74
KOG3895488 consensus Synaptic vesicle protein Synapsin [Signa 97.42
PF06849124 DUF1246: Protein of unknown function (DUF1246); In 97.31
PF06973188 DUF1297: Domain of unknown function (DUF1297); Int 97.13
PF14403445 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 96.94
PF11379355 DUF3182: Protein of unknown function (DUF3182); In 96.56
PF14243130 DUF4343: Domain of unknown function (DUF4343) 96.54
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 96.06
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 95.79
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 95.43
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 95.18
CHL00194317 ycf39 Ycf39; Provisional 95.15
KOG2157497 consensus Predicted tubulin-tyrosine ligase [Postt 94.87
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 94.58
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 94.02
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 93.88
PLN00016378 RNA-binding protein; Provisional 93.76
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 93.52
KOG2799434 consensus Succinyl-CoA synthetase, beta subunit [E 93.22
PRK05849 783 hypothetical protein; Provisional 93.02
PRK03659601 glutathione-regulated potassium-efflux system prot 92.8
KOG2156662 consensus Tubulin-tyrosine ligase-related protein 92.73
COG0569225 TrkA K+ transport systems, NAD-binding component [ 92.63
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 92.56
PRK04148134 hypothetical protein; Provisional 92.54
PF07065299 D123: D123; InterPro: IPR009772 This family contai 92.47
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 92.19
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 91.94
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.65
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 91.6
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 91.51
PRK03562621 glutathione-regulated potassium-efflux system prot 91.44
COG2910211 Putative NADH-flavin reductase [General function p 91.35
PRK10669558 putative cation:proton antiport protein; Provision 91.31
KOG1057 1018 consensus Arp2/3 complex-interacting protein VIP1/ 90.61
PRK06718202 precorrin-2 dehydrogenase; Reviewed 90.55
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 90.47
PRK06988312 putative formyltransferase; Provisional 89.62
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 89.48
PRK13303265 L-aspartate dehydrogenase; Provisional 89.16
PRK06719157 precorrin-2 dehydrogenase; Validated 89.04
PF01820117 Dala_Dala_lig_N: D-ala D-ala ligase N-terminus; In 88.96
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 87.95
TIGR01285432 nifN nitrogenase molybdenum-iron cofactor biosynth 87.37
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 87.13
cd03466429 Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup 86.97
PRK10537393 voltage-gated potassium channel; Provisional 86.79
PLN02695370 GDP-D-mannose-3',5'-epimerase 86.77
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 86.72
TIGR03025445 EPS_sugtrans exopolysaccharide biosynthesis polypr 86.7
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 86.39
PRK09496453 trkA potassium transporter peripheral membrane com 86.01
PF02639130 DUF188: Uncharacterized BCR, YaiI/YqxD family COG1 85.91
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 85.84
PRK00208250 thiG thiazole synthase; Reviewed 85.64
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 85.41
KOG1447412 consensus GTP-specific succinyl-CoA synthetase, be 85.06
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 84.91
PLN02572442 UDP-sulfoquinovose synthase 84.65
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 84.58
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 84.37
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 83.77
TIGR03023451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp 83.69
cd01965428 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_l 83.68
PLN03209576 translocon at the inner envelope of chloroplast su 83.65
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 83.4
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 83.39
COG1832140 Predicted CoA-binding protein [General function pr 83.31
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 83.31
PRK05993277 short chain dehydrogenase; Provisional 83.24
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 83.24
PRK05693274 short chain dehydrogenase; Provisional 83.23
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 83.21
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 83.03
KOG2774366 consensus NAD dependent epimerase [General functio 82.95
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 82.92
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.9
COG1671150 Uncharacterized protein conserved in bacteria [Fun 82.85
PRK10124463 putative UDP-glucose lipid carrier transferase; Pr 82.81
PRK08177225 short chain dehydrogenase; Provisional 82.51
PRK05562223 precorrin-2 dehydrogenase; Provisional 82.25
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.2
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 82.18
PRK09496453 trkA potassium transporter peripheral membrane com 82.11
PRK13302271 putative L-aspartate dehydrogenase; Provisional 81.94
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 81.78
PF13727175 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B. 81.76
cd01976421 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: 81.61
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 81.36
PRK08017256 oxidoreductase; Provisional 81.29
PRK00124151 hypothetical protein; Validated 81.18
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 80.88
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 80.84
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 80.84
TIGR02717447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 80.6
TIGR01283456 nifE nitrogenase molybdenum-iron cofactor biosynth 80.55
PLN02775286 Probable dihydrodipicolinate reductase 80.32
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 80.25
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 80.15
PRK00048257 dihydrodipicolinate reductase; Provisional 80.05
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=5e-125  Score=965.34  Aligned_cols=453  Identities=54%  Similarity=0.913  Sum_probs=447.1

Q ss_pred             CCCEEEEEcCcHHHHHHHHHHHHcCCcEEEEecCCCCCCchhhccCEEEEcCCCCCCCCCCCHHHHHHHHHHcCCCEEEe
Q 009316           70 RQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHP  149 (537)
Q Consensus        70 ~~~~iLI~~~g~ia~~ii~aa~~~Gi~~v~v~~~~d~~~~~~~~ad~~~~i~~~~~~~sy~~~~~i~~~a~~~~~d~V~p  149 (537)
                      ||+||||+||||||+||||+||++|+.+|+|||++|.+++|+.+||++++|||.+..+||+++++|+++|++.|+++|||
T Consensus         1 mf~KiLIANRGEIAcRVIRtar~lGi~tVAVYSdaDa~A~hV~~ADEAv~iGpapaaeSYL~~dkIi~Aa~~tGA~AIHP   80 (645)
T COG4770           1 MFSKILIANRGEIACRVIRTARDLGIRTVAVYSDADADALHVRMADEAVHIGPAPAAESYLDIDKIIDAARRTGAQAIHP   80 (645)
T ss_pred             CcceEEEeccchhhHHHHHHHHHcCCceEEEEecCCCCchhhhhcchhhhcCCCchhhhhccHHHHHHHHHHhCcccccC
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccHHHHHHHHHCCCceeCCCHHHHHHhcCHHHHHHHHHHcCCCCCCCCCcCCCCHHHHHHHHHhcCCcEEEeec
Q 009316          150 GYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKAT  229 (537)
Q Consensus       150 g~g~lsE~~~~a~~~e~~Gl~~iGp~~~~i~~~~dK~~~r~~l~~~Gvpvp~~~~~~v~~~~~~~~~~~~ig~PvvvKp~  229 (537)
                      ||||||||+.|+++|++.|+.||||++++|+.|+||..+|+++.++|+|++|+|...+.+.+++.++++++||||+||++
T Consensus        81 GYGFLSENa~FA~a~~~aGlvfIGP~~~aI~aMGdK~~AK~l~~~AgVp~VPG~~g~~qd~~~~~~~A~eiGyPVlIKAs  160 (645)
T COG4770          81 GYGFLSENADFAQAVEDAGLVFIGPSAGAIRAMGDKIAAKKLAAEAGVPTVPGYHGPIQDAAELVAIAEEIGYPVLIKAS  160 (645)
T ss_pred             CccccccCHHHHHHHHHCCcEEECCCHHHHHHhccHHHHHHHHHHcCCCccCCCCCcccCHHHHHHHHHhcCCcEEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcceEEeCCHHHHHHHHHHHHHHHHHhcCCCcEEEEecccCCcEEEEEEEEeCCCCEEEEeeeeeeeccccceeEE
Q 009316          230 AGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLE  309 (537)
Q Consensus       230 ~g~gg~Gv~~v~~~~el~~~~~~~~~~~~~~~g~~~vlvEe~I~g~~ei~v~v~~d~~G~vv~~~~r~~s~~~~~~k~~e  309 (537)
                      .||||+||+++++.+|+.++++.+++++..+||++.+|||+|+..+||+|+||++|++||++++++||||+||||||++|
T Consensus       161 aGGGGKGMRvv~~~~e~~e~l~sarrEA~asFGddrv~iEkyl~~PRHIEiQV~aD~HGNvv~LgERdCSlQRRhQKVIE  240 (645)
T COG4770         161 AGGGGKGMRVVETPEEFAEALESARREAKASFGDDRVFIEKYLDKPRHIEIQVFADQHGNVVHLGERDCSLQRRHQKVIE  240 (645)
T ss_pred             cCCCCCceEeecCHHHHHHHHHHHHHHHHhhcCCceEehhhhcCCCceEEEEEEecCCCCEEEeeccccchhhhcchhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcCCCCCCHHHHHHHHHHHHHHHHHcCCcceeEEEEEEeCCCCeEEEEEeccCCCcccchhhhcCCCHHHHHHHHHcCCC
Q 009316          310 EAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGK  389 (537)
Q Consensus       310 ~~P~~~l~~~~~~~l~~~a~~~~~alg~~G~~~vEf~~~~~g~~~~lEiN~R~~g~~~~~e~~tGidl~~~~i~~a~G~~  389 (537)
                      ++|+|.|+++.|++|.+.|+++++++||.|++||||+++.++.|||||||+|+|++||+||++||+||++||||+|.|++
T Consensus       241 EAPaP~l~~~~R~amg~aAv~~a~avgY~gAGTVEFivd~~~~f~FlEMNTRLQVEHPVTE~iTGiDLVewqiRVA~Gek  320 (645)
T COG4770         241 EAPAPFLTEETREAMGEAAVAAAKAVGYVGAGTVEFIVDADGNFYFLEMNTRLQVEHPVTELITGIDLVEWQIRVASGEK  320 (645)
T ss_pred             cCCCCCCCHHHHHHHHHHHHHHHHhcCCCcCceEEEEEcCCCcEEEEEeecceeccccchhhhhhhHHHHHHHHHhcCCc
Confidence            99999999999999999999999999999999999999988889999999999999999999999999999999999999


Q ss_pred             CCCCccccccceeEEEEEEeeCCCCCCCCCCCceEEEEecCCCCeEEEeeeccCCCccCCCCCCccEEEEEEcCCHHHHH
Q 009316          390 LRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAI  469 (537)
Q Consensus       390 l~~~~~~~~~~g~ai~~ri~ae~p~~~f~p~~G~i~~~~~~~~~~vr~d~~~~~G~~v~~~~ds~ig~vi~~g~~~~ea~  469 (537)
                      |++.|.+++.+|||||+|||||||..+|+|++|+|+.|.+|.++++|+|+++..|+.|+++|||||+|+|+||.||++|+
T Consensus       321 L~~~Q~di~l~GhAiE~RiyAEDp~r~FLPs~G~l~~~~~P~~~~vRvDsGV~~G~~Is~~YDpMiAKLi~~G~dR~eAl  400 (645)
T COG4770         321 LPFTQDDIPLNGHAIEARIYAEDPARGFLPSTGRLTRYRPPAGPGVRVDSGVREGDEISPFYDPMIAKLIVHGADREEAL  400 (645)
T ss_pred             CCcccccccccceeEEEEEeccCcccCccCCCceeEeecCCCCCceecccCcccCCccccccchHHHHHhhcCCCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhcceEeeeccCHHHHHHhcCCccccCCcccccccccchhhccCCcc
Q 009316          470 ERMKRALNDTIITGVPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAPQK  522 (537)
Q Consensus       470 ~~~~~al~~~~i~g~~tn~~~~~~~~~~~~f~~~~~~t~~~~~~~~~~~~~~~  522 (537)
                      ++|.+||+++.|.|+.||++||+.++.||+|+.|+.+|.||.++++++.++.+
T Consensus       401 ~rl~~AL~~~~v~Gi~tn~~Fl~al~~~~~F~~g~~~T~~i~r~~~~~~~~~~  453 (645)
T COG4770         401 DRLRRALAEFEVEGIATNIPFLRALMADPRFRGGDLDTGFIAREIEDLFAPAP  453 (645)
T ss_pred             HHHHHHHHhhEecCccccHHHHHHHhcCcccccCCCcceeeeecccccccCCC
Confidence            99999999999999999999999999999999999999999999988764433

>KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PF02785 Biotin_carb_C: Biotin carboxylase C-terminal domain; InterPro: IPR005482 Acetyl-CoA carboxylase is found in all animals, plants, and bacteria and catalyzes the first committed step in fatty acid synthesis Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>smart00878 Biotin_carb_C Biotin carboxylase C-terminal domain Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>KOG0237 consensus Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthetase, prokaryotic Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>PF13549 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A Back     alignment and domain information
>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>PRK14046 malate--CoA ligase subunit beta; Provisional Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PLN00124 succinyl-CoA ligase [GDP-forming] subunit beta; Provisional Back     alignment and domain information
>PF08442 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 The ATP-grasp superfamily currently includes 17 groups of enzymes, catalyzing ATP-dependent ligation of a carboxylate containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) Back     alignment and domain information
>PLN02235 ATP citrate (pro-S)-lyase Back     alignment and domain information
>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase Back     alignment and domain information
>PF14305 ATPgrasp_TupA: TupA-like ATPgrasp Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information
>KOG3895 consensus Synaptic vesicle protein Synapsin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06849 DUF1246: Protein of unknown function (DUF1246); InterPro: IPR010672 The last two steps of de novo purine biosynthesis are: i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP) In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH [] Back     alignment and domain information
>PF06973 DUF1297: Domain of unknown function (DUF1297); InterPro: IPR009720 The last two steps of de novo purine biosynthesis are: i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP) In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH [] Back     alignment and domain information
>PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2 Back     alignment and domain information
>PF11379 DUF3182: Protein of unknown function (DUF3182); InterPro: IPR021519 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>PF14243 DUF4343: Domain of unknown function (DUF4343) Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>KOG2157 consensus Predicted tubulin-tyrosine ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>KOG2799 consensus Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK05849 hypothetical protein; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>KOG2156 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF07065 D123: D123; InterPro: IPR009772 This family contains a number of eukaryotic D123 proteins approximately 330 residues long Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>KOG1057 consensus Arp2/3 complex-interacting protein VIP1/Asp1, involved in regulation of actin cytoskeleton [Cytoskeleton] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK06988 putative formyltransferase; Provisional Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF01820 Dala_Dala_lig_N: D-ala D-ala ligase N-terminus; InterPro: IPR011127 This entry represents the N-terminal region of the D-alanine--D-alanine ligase enzyme (6 Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01285 nifN nitrogenase molybdenum-iron cofactor biosynthesis protein NifN Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>cd03466 Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF02639 DUF188: Uncharacterized BCR, YaiI/YqxD family COG1671; InterPro: IPR003791 This entry describes proteins of unknown function Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>KOG1447 consensus GTP-specific succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>cd01965 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: Nitrogenase MoFe protein, beta subunit_like Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1832 Predicted CoA-binding protein [General function prediction only] Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1671 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF13727 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B Back     alignment and domain information
>cd01976 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe protein, beta subunit Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK00124 hypothetical protein; Validated Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>TIGR01283 nifE nitrogenase molybdenum-iron cofactor biosynthesis protein NifE Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
2vpq_A451 Crystal Structure Of Biotin Carboxylase From S. Aur 1e-136
2vqd_A464 Crystal Structure Of Biotin Carboxylase From Pseudo 1e-132
1ulz_A451 Crystal Structure Of The Biotin Carboxylase Subunit 1e-132
2gpw_A469 Crystal Structure Of The Biotin Carboxylase Subunit 1e-129
3jzf_A486 Crystal Structure Of Biotin Carboxylase From E. Col 1e-129
3g8c_A444 Crystal Stucture Of Biotin Carboxylase In Complex W 1e-129
3rup_B452 Crystal Structure Of E.Coli Biotin Carboxylase In C 1e-129
1bnc_A449 Three-Dimensional Structure Of The Biotin Carboxyla 1e-129
1dv2_A452 The Structure Of Biotin Carboxylase, Mutant E288k, 1e-128
3rv4_A452 Crystal Structure Of E.Coli Biotin Carboxylase R16e 1e-128
2gps_A469 Crystal Structure Of The Biotin Carboxylase Subunit 1e-128
3g8d_A444 Crystal Structure Of The Biotin Carboxylase Subunit 1e-128
3ouz_A446 Crystal Structure Of Biotin Carboxylase-Adp Complex 1e-120
3n6r_A 681 Crystal Structure Of The Holoenzyme Of Propionyl-co 1e-118
2dzd_A461 Crystal Structure Of The Biotin Carboxylase Domain 1e-112
3u9s_A 655 Crystal Structure Of P. Aeruginosa 3-methylcrotonyl 1e-110
4hnt_A 1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 1e-109
3hb9_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-109
3hbl_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-109
3ho8_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-109
3bg5_A 1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 1e-108
4hnu_A 1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 1e-108
3tw7_A 1165 Structure Of Rhizobium Etli Pyruvate Carboxylase T8 1e-108
4hnv_A 1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 1e-108
2qf7_A 1165 Crystal Structure Of A Complete Multifunctional Pyr 1e-108
3va7_A 1236 Crystal Structure Of The Kluyveromyces Lactis Urea 2e-98
2yl2_A540 Crystal Structure Of Human Acetyl-Coa Carboxylase 1 1e-67
3gid_A540 The Biotin Carboxylase (Bc) Domain Of Human Acetyl- 2e-65
2hjw_A573 Crystal Structure Of The Bc Domain Of Acc2 Length = 2e-65
3jrx_A587 Crystal Structure Of The Bc Domain Of Acc2 In Compl 2e-65
3jrw_A587 Phosphorylated Bc Domain Of Acc2 Length = 587 2e-65
1w93_A553 Crystal Structure Of Biotin Carboxylase Domain Of A 7e-56
1w96_A554 Crystal Structure Of Biotin Carboxylase Domain Of A 8e-56
2cqy_A108 Solution Structure Of B Domain From Human Propionyl 3e-17
3orq_A377 Crystal Structure Of N5-Carboxyaminoimidazole Synth 1e-06
1ce8_A 1073 Carbamoyl Phosphate Synthetase From Escherichis Col 2e-06
1jdb_B 1073 Carbamoyl Phosphate Synthetase From Escherichia Col 2e-06
1a9x_A 1073 Carbamoyl Phosphate Synthetase: Caught In The Act O 2e-06
3r23_A307 Crystal Structure Of D-Alanine--D-Alanine Ligase Fr 3e-05
2yrw_A451 Crystal Structure Of Gar Synthetase From Geobacillu 5e-05
3vpd_A281 Lysx From Thermus Thermophilus Complexed With Amp-p 5e-05
2czg_A433 Crystal Structure Of Probable Phosphoribosylglycina 1e-04
3k5i_A403 Crystal Structure Of N5-Carboxyaminoimidazole Synth 2e-04
3k5h_A403 Crystal Structure Of Carboxyaminoimidazole Ribonucl 2e-04
1uc8_A280 Crystal Structure Of A Lysine Biosynthesis Enzyme, 3e-04
2yw2_A424 Crystal Structure Of Gar Synthetase From Aquifex Ae 3e-04
2qk4_A452 Human Glycinamide Ribonucleotide Synthetase Length 4e-04
3aw8_A369 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 6e-04
2xd4_A422 Nucleotide-Bound Structures Of Bacillus Subtilis Gl 8e-04
3ax6_A380 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 8e-04
>pdb|2VPQ|A Chain A, Crystal Structure Of Biotin Carboxylase From S. Aureus Complexed With Amppnp Length = 451 Back     alignment and structure 
Iteration: 1

 Score =  483 bits (1243), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 236/443 (53%), Positives = 317/443 (71%), Gaps = 1/443 (0%)
Query: 72  EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLL 131
           +K+L+ANRGEIAVR+IR   ++GI  VA+YS  DKDALH ++ADE+ C+G   S  SYL 
Sbjct: 2   KKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLN 61
Query: 132 IPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARET 191
           IPN+LS A S GC  +HPGYGFLAENA F E+C    + FIGP+  SI+ MG K  A+  
Sbjct: 62  IPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAE 121
Query: 192 MKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQ 251
           M  A VP VPGSDGL++   EA K+A ++G+PV+IKATAGGGG+G+R+A++  E     +
Sbjct: 122 MIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGFR 181
Query: 252 QAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEA 311
             + EA  AFGN G+Y+EK+++N RHIE Q++ D YGNV+H GERDC+IQRR QKL+EEA
Sbjct: 182 MTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEEA 241
Query: 312 PSPALTPELRKAMGDXXXXXXXSIGYIGVGTVEFLLD-ERGSFYFMEMNTRIQVEHPVTE 370
           PSP L  E R+ MG+       ++ Y   GT+EF+ D     FYFMEMNTRIQVEHPVTE
Sbjct: 242 PSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVTE 301
Query: 371 MISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPA 430
           M++ +DL++ Q+ VAMG  L YKQEDI L GH+IE RINAE+P+KNF P PG I  YL  
Sbjct: 302 MVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLAP 361
Query: 431 GGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEY 490
           GG  VR++S  Y +Y +PP YDS++ KLI+  PTR++AI    RAL++ ++ G+ TTI +
Sbjct: 362 GGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIPF 421
Query: 491 HKLILDVEDFKNGKVDTAFIPKH 513
           H  +L+ + F++GK +T F+ ++
Sbjct: 422 HIKLLNNDIFRSGKFNTNFLEQN 444
>pdb|2VQD|A Chain A, Crystal Structure Of Biotin Carboxylase From Pseudomonas Aeruginosa Complexed With Ampcp Length = 464 Back     alignment and structure
>pdb|1ULZ|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit Of Pyruvate Carboxylase Length = 451 Back     alignment and structure
>pdb|2GPW|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, F363a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|3JZF|A Chain A, Crystal Structure Of Biotin Carboxylase From E. Coli In Complex With Benzimidazoles Series Length = 486 Back     alignment and structure
>pdb|3G8C|A Chain A, Crystal Stucture Of Biotin Carboxylase In Complex With Biotin, Bicarbonate, Adp And Mg Ion Length = 444 Back     alignment and structure
>pdb|1BNC|A Chain A, Three-Dimensional Structure Of The Biotin Carboxylase Subunit Of Acetyl-Coa Carboxylase Length = 449 Back     alignment and structure
>pdb|1DV2|A Chain A, The Structure Of Biotin Carboxylase, Mutant E288k, Complexed With Atp Length = 452 Back     alignment and structure
>pdb|2GPS|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E23r Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|3G8D|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E296a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli Length = 444 Back     alignment and structure
>pdb|3OUZ|A Chain A, Crystal Structure Of Biotin Carboxylase-Adp Complex From Campylobacter Jejuni Length = 446 Back     alignment and structure
>pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 Back     alignment and structure
>pdb|2DZD|A Chain A, Crystal Structure Of The Biotin Carboxylase Domain Of Pyruvate Carboxylase Length = 461 Back     alignment and structure
>pdb|3U9S|A Chain A, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc) 750 Kd Holoenzyme, Coa Complex Length = 655 Back     alignment and structure
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>pdb|3VA7|A Chain A, Crystal Structure Of The Kluyveromyces Lactis Urea Carboxylase Length = 1236 Back     alignment and structure
>pdb|2YL2|A Chain A, Crystal Structure Of Human Acetyl-Coa Carboxylase 1, Biotin Carboxylase (Bc) Domain Length = 540 Back     alignment and structure
>pdb|3GID|A Chain A, The Biotin Carboxylase (Bc) Domain Of Human Acetyl-Coa Carboxylase 2 (Acc2) In Complex With Soraphen A Length = 540 Back     alignment and structure
>pdb|2HJW|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 Length = 573 Back     alignment and structure
>pdb|3JRX|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 In Complex With Soraphen A Length = 587 Back     alignment and structure
>pdb|3JRW|A Chain A, Phosphorylated Bc Domain Of Acc2 Length = 587 Back     alignment and structure
>pdb|1W93|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae Length = 553 Back     alignment and structure
>pdb|1W96|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae In Complex With Soraphen A Length = 554 Back     alignment and structure
>pdb|2CQY|A Chain A, Solution Structure Of B Domain From Human Propionyl-Coa Carboxylase Alpha Subunit Length = 108 Back     alignment and structure
>pdb|3ORQ|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Synthetase From Staphylococcus Aureus Complexed With Adp Length = 377 Back     alignment and structure
>pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escherichis Coli With Complexed With The Allosteric Ligand Imp Length = 1073 Back     alignment and structure
>pdb|1JDB|B Chain B, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 1073 Back     alignment and structure
>pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 1073 Back     alignment and structure
>pdb|3R23|A Chain A, Crystal Structure Of D-Alanine--D-Alanine Ligase From Bacillus Anthracis Length = 307 Back     alignment and structure
>pdb|2YRW|A Chain A, Crystal Structure Of Gar Synthetase From Geobacillus Kaustophilus Length = 451 Back     alignment and structure
>pdb|3VPD|A Chain A, Lysx From Thermus Thermophilus Complexed With Amp-pnp Length = 281 Back     alignment and structure
>pdb|2CZG|A Chain A, Crystal Structure Of Probable Phosphoribosylglycinamide Formyl Transferase (Ph0318) From Pyrococcus Horikoshii Ot3 Length = 433 Back     alignment and structure
>pdb|3K5I|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Synthase From Aspergillus Clavatus In Complex With Adp And 5- Aminoimadazole Ribonucleotide Length = 403 Back     alignment and structure
>pdb|3K5H|A Chain A, Crystal Structure Of Carboxyaminoimidazole Ribonucleotide Synthase From Asperigillus Clavatus Complexed With Atp Length = 403 Back     alignment and structure
>pdb|1UC8|A Chain A, Crystal Structure Of A Lysine Biosynthesis Enzyme, Lysx, From Thermus Thermophilus Hb8 Length = 280 Back     alignment and structure
>pdb|2YW2|A Chain A, Crystal Structure Of Gar Synthetase From Aquifex Aeolicus In Complex With Atp Length = 424 Back     alignment and structure
>pdb|2QK4|A Chain A, Human Glycinamide Ribonucleotide Synthetase Length = 452 Back     alignment and structure
>pdb|3AW8|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Synthetase From Thermus Thermophilus Hb8 Length = 369 Back     alignment and structure
>pdb|2XD4|A Chain A, Nucleotide-Bound Structures Of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase Length = 422 Back     alignment and structure
>pdb|3AX6|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Synthetase From Thermotoga Maritima Length = 380 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query537
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 0.0
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin car 0.0
3ouz_A446 Biotin carboxylase; structural genomics, center fo 0.0
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 0.0
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 0.0
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 0.0
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 0.0
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 0.0
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 0.0
3jrx_A587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 0.0
3glk_A540 Acetyl-COA carboxylase 2; ATP binding, alternative 0.0
1w96_A554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 0.0
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 0.0
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 4e-61
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 3e-35
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 9e-29
3vmm_A474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 1e-25
3aw8_A369 PURK, phosphoribosylaminoimidazole carboxylase, AT 3e-17
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 5e-17
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 1e-15
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 2e-15
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 1e-14
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 1e-13
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 2e-13
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 2e-13
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 4e-13
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 5e-13
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 1e-12
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 1e-12
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 2e-12
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 2e-12
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 3e-12
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 5e-12
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 1e-11
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 2e-11
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 6e-11
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 1e-10
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 1e-10
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 3e-10
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amid 2e-08
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 2e-09
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 4e-09
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 4e-09
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 1e-08
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 3e-08
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 5e-08
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 3e-07
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 1e-06
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 1e-06
3ufx_B397 Succinyl-COA synthetase beta subunit; ATP-grAsp fo 2e-06
3ln7_A757 Glutathione biosynthesis bifunctional protein GSH; 1e-05
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Length = 451 Back     alignment and structure
 Score =  872 bits (2256), Expect = 0.0
 Identities = 241/443 (54%), Positives = 322/443 (72%), Gaps = 1/443 (0%)

Query: 72  EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLL 131
           +K+L+ANRGEIAVR+IR   ++GI  VA+YS  DKDALH ++ADE+ C+G   S  SYL 
Sbjct: 2   KKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLN 61

Query: 132 IPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARET 191
           IPN+LS A S GC  +HPGYGFLAENA F E+C    + FIGP+  SI+ MG K  A+  
Sbjct: 62  IPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAE 121

Query: 192 MKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQ 251
           M  A VP VPGSDGL++   EA K+A ++G+PV+IKATAGGGG+G+R+A++  E     +
Sbjct: 122 MIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGFR 181

Query: 252 QAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEA 311
             + EA  AFGN G+Y+EK+++N RHIE Q++ D YGNV+H GERDC+IQRR QKL+EEA
Sbjct: 182 MTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEEA 241

Query: 312 PSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLD-ERGSFYFMEMNTRIQVEHPVTE 370
           PSP L  E R+ MG+AAV AA ++ Y   GT+EF+ D     FYFMEMNTRIQVEHPVTE
Sbjct: 242 PSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVTE 301

Query: 371 MISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRPGPGIITAYLPA 430
           M++ +DL++ Q+ VAMG  L YKQEDI L GH+IE RINAE+P+KNF P PG I  YL  
Sbjct: 302 MVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLAP 361

Query: 431 GGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTIEY 490
           GG  VR++S  Y +Y +PP YDS++ KLI+  PTR++AI    RAL++ ++ G+ TTI +
Sbjct: 362 GGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIPF 421

Query: 491 HKLILDVEDFKNGKVDTAFIPKH 513
           H  +L+ + F++GK +T F+ ++
Sbjct: 422 HIKLLNNDIFRSGKFNTNFLEQN 444
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Length = 451 Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Length = 446 Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Length = 449 Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Length = 461 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Length = 587 Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Length = 540 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Length = 554 Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Length = 403 Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Length = 331 Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Length = 474 Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Length = 369 Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Length = 403 Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Length = 419 Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Length = 389 Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Length = 305 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Length = 377 Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A Length = 317 Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Length = 355 Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Length = 380 Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Length = 306 Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Length = 280 Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Length = 334 Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Length = 361 Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Length = 307 Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Length = 377 Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Length = 322 Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Length = 367 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Length = 433 Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Length = 343 Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Length = 364 Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Length = 391 Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Length = 1073 Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Length = 1073 Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Length = 364 Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Length = 346 Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Length = 372 Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Length = 386 Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Length = 383 Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Length = 344 Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Length = 309 Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Length = 750 Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Length = 373 Back     alignment and structure
>3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} Length = 397 Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Length = 757 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query537
3jrx_A587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 100.0
3glk_A540 Acetyl-COA carboxylase 2; ATP binding, alternative 100.0
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 100.0
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 100.0
3ouz_A446 Biotin carboxylase; structural genomics, center fo 100.0
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 100.0
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 100.0
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 100.0
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 100.0
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin car 100.0
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 100.0
1w96_A554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 100.0
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 100.0
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 100.0
3vot_A425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 100.0
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 100.0
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 100.0
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 100.0
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 100.0
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 100.0
3aw8_A369 PURK, phosphoribosylaminoimidazole carboxylase, AT 100.0
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 100.0
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 100.0
3vmm_A474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 100.0
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 100.0
2yw2_A424 Phosphoribosylamine--glycine ligase; glycinamide r 100.0
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 100.0
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 100.0
2qk4_A452 Trifunctional purine biosynthetic protein adenosi; 100.0
2ip4_A417 PURD, phosphoribosylamine--glycine ligase; GAR syn 100.0
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 100.0
1vkz_A412 Phosphoribosylamine--glycine ligase; TM1250, struc 100.0
2yrx_A451 Phosphoribosylglycinamide synthetase; glycinamide 100.0
3lp8_A442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 100.0
3mjf_A431 Phosphoribosylamine--glycine ligase; structural ge 100.0
2xcl_A422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 100.0
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amid 100.0
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 100.0
4fu0_A357 D-alanine--D-alanine ligase 7; vancomycin resistan 100.0
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 100.0
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 100.0
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 100.0
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 100.0
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 100.0
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 100.0
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 100.0
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 100.0
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 100.0
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 100.0
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 100.0
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 100.0
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 100.0
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 99.98
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 99.97
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 99.97
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 99.96
2pbz_A320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt 99.94
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 99.94
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 99.9
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 99.88
3ln7_A757 Glutathione biosynthesis bifunctional protein GSH; 99.87
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 99.83
1wr2_A238 Hypothetical protein PH1789; structural genomics, 99.82
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 99.8
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 99.8
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 99.79
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kina 99.73
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 99.7
2fp4_B395 Succinyl-COA ligase [GDP-forming] beta-chain, mito 99.52
3t7a_A330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 99.51
2nu8_B388 SCS-beta, succinyl-COA synthetase beta chain; citr 99.51
3ufx_B397 Succinyl-COA synthetase beta subunit; ATP-grAsp fo 99.21
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 98.0
3mwd_A425 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 97.36
3pff_A 829 ATP-citrate synthase; phosphohistidine, organic ac 97.14
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.32
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.26
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.06
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.91
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.4
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.21
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.21
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 95.16
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 94.98
2duw_A145 Putative COA-binding protein; ligand binding prote 94.9
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 94.75
2d59_A144 Hypothetical protein PH1109; COA binding, structur 94.63
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 94.52
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.23
1iuk_A140 Hypothetical protein TT1466; structural genomics, 94.04
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 93.98
3slg_A372 PBGP3 protein; structural genomics, seattle struct 93.92
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 93.85
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 93.84
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 93.83
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 93.73
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 93.48
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.36
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.34
2io8_A619 Bifunctional glutathionylspermidine synthetase/ami 93.27
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 93.12
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 92.7
2wm3_A299 NMRA-like family domain containing protein 1; unkn 92.32
1lss_A140 TRK system potassium uptake protein TRKA homolog; 92.19
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 92.08
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.9
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 91.86
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 91.77
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 91.67
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 91.42
3c85_A183 Putative glutathione-regulated potassium-efflux S 91.1
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 91.08
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 90.86
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 90.78
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 90.75
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 90.73
3ius_A286 Uncharacterized conserved protein; APC63810, silic 90.69
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 90.62
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 90.61
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 90.56
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 90.29
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 90.14
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 90.13
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 90.11
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 89.8
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 89.75
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 89.7
3n6x_A474 Putative glutathionylspermidine synthase; domain o 89.64
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 89.58
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 89.5
3pdi_B458 Nitrogenase MOFE cofactor biosynthesis protein NI; 89.35
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 89.22
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 89.19
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 88.86
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 88.63
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 88.5
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 87.72
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 87.65
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 87.23
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 86.9
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 86.63
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 86.57
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 86.49
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 86.4
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 86.38
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 86.31
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 86.22
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 86.15
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 86.14
4g65_A461 TRK system potassium uptake protein TRKA; structur 86.14
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 86.07
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 85.83
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 85.72
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 85.65
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 85.61
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 85.59
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 85.55
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 85.39
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 85.29
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 85.2
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 84.98
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 84.81
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 84.76
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 84.64
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 84.48
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 84.3
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 84.06
1lnq_A336 MTHK channels, potassium channel related protein; 83.9
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 83.71
4gx0_A565 TRKA domain protein; membrane protein, ION channel 83.47
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 83.43
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 83.33
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 83.26
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 83.21
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 83.07
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 83.05
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 82.95
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 82.67
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 82.57
1xq6_A253 Unknown protein; structural genomics, protein stru 82.43
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 82.23
2xdq_B511 Light-independent protochlorophyllide reductase S; 81.88
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 81.66
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 81.43
3u7q_A492 Nitrogenase molybdenum-iron protein alpha chain; m 81.38
3gem_A260 Short chain dehydrogenase; structural genomics, AP 81.3
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 81.22
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 81.15
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 81.11
3tqq_A314 Methionyl-tRNA formyltransferase; protein synthesi 81.11
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 80.96
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 80.89
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 80.85
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 80.81
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 80.55
1mio_B458 Nitrogenase molybdenum iron protein (beta chain); 80.51
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 80.44
3pdi_A483 Nitrogenase MOFE cofactor biosynthesis protein NI; 80.41
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 80.33
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 80.26
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 80.08
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-93  Score=779.62  Aligned_cols=452  Identities=35%  Similarity=0.566  Sum_probs=399.1

Q ss_pred             CCCCCCCCEEEEEcCcHHHHHHHHHHHHc---------CCcEEEEecCCC--CCCchhhccCEEEEcCCCCCCCCCCCHH
Q 009316           65 LKVTCRQEKILVANRGEIAVRVIRTAHEM---------GIPCVAVYSTID--KDALHVKLADESVCIGEAPSSQSYLLIP  133 (537)
Q Consensus        65 ~~~~~~~~~iLI~~~g~ia~~ii~aa~~~---------Gi~~v~v~~~~d--~~~~~~~~ad~~~~i~~~~~~~sy~~~~  133 (537)
                      .++.+||+||||+|||++|++|+++||++         |+++|++|++.|  .+++++++||+++++++.+..++|+|++
T Consensus        50 ~~g~~~~~kvLIanrGeiA~riira~r~lG~e~f~~e~Gi~tVav~s~~D~~~~a~~~~~ADe~v~i~~~~~~~syld~~  129 (587)
T 3jrx_A           50 FGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVE  129 (587)
T ss_dssp             TTCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHSCTTSSEEEEEECHHHHHTTCHHHHHSSEEEECCCSSGGGTTTCHH
T ss_pred             cCCCcccCEEEEECChHHHHHHHHHHHHhhhccccccCCceEEEEecccccCcCChhhHhCCEEEEeCCCCccccccCHH
Confidence            45678899999999999999999999987         799999998766  8999999999999999888889999999


Q ss_pred             HHHHHHHHcCCCEEEeCCCcccccHHHHHHHHHCCCceeCCCHHHHHHhcCHHHHHHHHHHcCCCCCCCCC---------
Q 009316          134 NVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSD---------  204 (537)
Q Consensus       134 ~i~~~a~~~~~d~V~pg~g~lsE~~~~a~~~e~~Gl~~iGp~~~~i~~~~dK~~~r~~l~~~Gvpvp~~~~---------  204 (537)
                      +|+++|++.++|+|||||||++|++.+++.|++.|++|+||++++++.++||..+|++|+++|||+|++..         
T Consensus       130 ~Il~~a~~~~vdaV~pG~GflsEn~~~a~~le~~Gi~~iGp~~~ai~~~~DK~~ak~ll~~aGVPvpp~~~~~l~~~~~~  209 (587)
T 3jrx_A          130 LIVDIAKRIPVQAVWAGWGHASENPKLPELLCKNGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTE  209 (587)
T ss_dssp             HHHHHHHHTTCSEEECCSSTTTTCTHHHHHHHTTTCEESSCCHHHHHHHCSHHHHHHHHHHTTCCBCCBTTTTCCCCC--
T ss_pred             HHHHHHHHhCCCEEEeCCCccccCHHHHHHHHHCCCCeeCCCHHHHHHhCCHHHHHHHHHHcCCCCCCeecccccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999843         


Q ss_pred             ------------------cCCCCHHHHHHHHHhcCCcEEEeecCCCCCcceEEeCCHHHHHHHHHHHHHHHHHhcCCCcE
Q 009316          205 ------------------GLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGV  266 (537)
Q Consensus       205 ------------------~~v~~~~~~~~~~~~ig~PvvvKp~~g~gg~Gv~~v~~~~el~~~~~~~~~~~~~~~g~~~v  266 (537)
                                        ..+.+.+++.++++++|||+||||..|+||+||++|++.+|+.++++.+..++    .+..+
T Consensus       210 ~~~~~~~~~~~~~~~~~~~~v~s~eea~~~a~~iGyPvVVKp~~GgGGkGv~iV~s~eEL~~a~~~a~~~~----~~~~v  285 (587)
T 3jrx_A          210 DDLQQGKRISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQVQSEI----PGSPI  285 (587)
T ss_dssp             ----CCCCCCCCHHHHHTTSCCSHHHHHHHHHHHCSSEEEEETTCCSSSSEEEECSTTTHHHHHHHHHHHS----TTCCE
T ss_pred             cccccccccccchhhccccccCCHHHHHHHHHhcCCeEEEEeCCCCCCCCeEEeCCHHHHHHHHHHHHhhc----cCCCE
Confidence                              11788999999999999999999999999999999999999999999887653    35789


Q ss_pred             EEEecccCCcEEEEEEEEeCCCCEEEEeeeeeeeccccceeEEEcCCCCCCHHHHHHHHHHHHHHHHHcCCcceeEEEEE
Q 009316          267 YLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFL  346 (537)
Q Consensus       267 lvEe~I~g~~ei~v~v~~d~~G~vv~~~~r~~s~~~~~~k~~e~~P~~~l~~~~~~~l~~~a~~~~~alg~~G~~~vEf~  346 (537)
                      +||+||+|++|++|++++|++|+++++++++|+++++++|.++++|++.++++.+++|.+.+.++++++||.|++++||+
T Consensus       286 lVEeyI~g~rei~V~vl~D~~G~vv~l~~rd~siqrr~qk~ie~aPa~~l~~~~~~~i~~~A~~~a~alGy~G~~~VEfl  365 (587)
T 3jrx_A          286 FLMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAPLAIFEFMEQCAIRLAKTVGYVSAGTVEYL  365 (587)
T ss_dssp             EEEECCCSCEEEEEEEEECSSSCEEEEEEEEEEEESSSCEEEEEESCCSSCHHHHHHHHHHHHHHHHHHTCCEEEEEEEE
T ss_pred             EEEEecCCCcEEEEEEEEcCCCCEEEEeeeeccccccccceeEecCCCCCCHHHHHHHHHHHHHHHHHcCCcceeEEEEE
Confidence            99999999999999999999999999999999999999999999999988999999999999999999999999999999


Q ss_pred             EeCCCCeEEEEEeccCCCcccchhhhcCCCHHHHHHHHHcCCCCC--------------------CCccc--cccceeEE
Q 009316          347 LDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLR--------------------YKQED--IVLQGHSI  404 (537)
Q Consensus       347 ~~~~g~~~~lEiN~R~~g~~~~~e~~tGidl~~~~i~~a~G~~l~--------------------~~~~~--~~~~g~ai  404 (537)
                      ++++|++||||||||+|++|+++|+++|+|++++|+++++|++|+                    +.|.+  +.++||||
T Consensus       366 ~d~dG~~yflEINpRl~~e~~vte~~tGvdlv~~~lria~G~pL~~~~di~~~~~~~~~~~~~~~~~~~~~~~~~~ghai  445 (587)
T 3jrx_A          366 YSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPISFETPSNPPLARGHVI  445 (587)
T ss_dssp             ECSSSCEEEEEEESSCCTTHHHHHHHHTCCHHHHHHHHHTTCCGGGCHHHHHHTTCCTTCCCCCCSSSCSSCCCCCSEEE
T ss_pred             EeCCCCEEEEEEeCCCCCccceeccccCCCHHHHHHHHHCCCCcccchhcccccccccccccccccccccccCCCCceEE
Confidence            998899999999999999999999999999999999999999986                    22222  56789999


Q ss_pred             EEEEeeCCCCCCCCCCCceEEEEecCCCCeEEEeeeccCCCccCCCCCCccEEEEEEcCCHHHHHHHHHHhhhcceEee-
Q 009316          405 ECRINAEDPFKNFRPGPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITG-  483 (537)
Q Consensus       405 ~~ri~ae~p~~~f~p~~G~i~~~~~~~~~~vr~d~~~~~G~~v~~~~ds~ig~vi~~g~~~~ea~~~~~~al~~~~i~g-  483 (537)
                      +||||||||.++|.|++|+|+.+..|++++||....+..+..|+++||||+||||+||+||++|+++|.+||++++|+| 
T Consensus       446 e~Ri~aedp~~~f~p~~G~i~~~~~~~~~~v~~~~~~~~~~~~~~~yd~~~~k~i~~g~~r~~a~~~~~~al~~~~i~g~  525 (587)
T 3jrx_A          446 AARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGD  525 (587)
T ss_dssp             EEEEEC----------CCCCEEEECSSCTTEEEEECCC----------CCEEEEEEEESSHHHHHHHHHHHHHHHHHSST
T ss_pred             EEeecccCccccCCCCCcEEEEEEeCCCCceEEeccccccCCcCcccCcccceEEEEcCCHHHHHHHHHHHHhccEEeCC
Confidence            9999999999999999999999999999999875554444469999999999999999999999999999999999999 


Q ss_pred             eccCHHHHHHhcCCccccCCcccccccccchhhccCC
Q 009316          484 VPTTIEYHKLILDVEDFKNGKVDTAFIPKHEQELQAP  520 (537)
Q Consensus       484 ~~tn~~~~~~~~~~~~f~~~~~~t~~~~~~~~~~~~~  520 (537)
                      ++||++||++||.||+|++|+++|+||++++..+..+
T Consensus       526 ~~tn~~~~~~~~~~~~f~~g~~~t~~~~~~~~~~~~~  562 (587)
T 3jrx_A          526 FRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQA  562 (587)
T ss_dssp             TSSTTHHHHHHHTSHHHHTTCSCCGGGGC--------
T ss_pred             CCCcHHHHHHHhCChhhccCCcchhHHhHhhhhhccc
Confidence            8999999999999999999999999999998777533
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure
>2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* Back     alignment and structure
>3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} Back     alignment and structure
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
>3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* Back     alignment and structure
>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3n6x_A Putative glutathionylspermidine synthase; domain of unknown function (DUF404), structural genomics; 2.35A {Methylobacillus flagellatus} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3pdi_B Nitrogenase MOFE cofactor biosynthesis protein NI; nitrogenase cofactor maturation, NIFB, nifdk, NIFH; HET: CZL; 2.40A {Azotobacter vinelandii} Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2xdq_B Light-independent protochlorophyllide reductase S; oxidoreductase, DPOR, (bacterio)chlorophyll biosynthesis, photosynthesis; 2.40A {Thermosynechococcus elongatus} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3u7q_A Nitrogenase molybdenum-iron protein alpha chain; multiple rossmann fold domains, reductase, nitrogen fixing, oxidoreductase; HET: HCA ICS 1CL CLF; 1.00A {Azotobacter vinelandii} SCOP: c.92.2.3 PDB: 1g21_A* 1g20_A* 1fp4_A* 1m1n_A* 1l5h_A* 1m1y_A* 1m34_A* 1n2c_A* 2afh_A* 2afi_A* 2afk_A* 2min_A* 3min_A* 3k1a_A* 1h1l_A* 1qgu_A* 1qh1_A* 1qh8_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3tqq_A Methionyl-tRNA formyltransferase; protein synthesis; 2.00A {Coxiella burnetii} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>1mio_B Nitrogenase molybdenum iron protein (beta chain); HET: HCA CFM CLP; 3.00A {Clostridium pasteurianum} SCOP: c.92.2.3 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3pdi_A Nitrogenase MOFE cofactor biosynthesis protein NI; nitrogenase cofactor maturation, NIFB, nifdk, NIFH; HET: CZL; 2.40A {Azotobacter vinelandii} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 537
d1a9xa5275 d.142.1.2 (A:128-402) Carbamoyl phosphate syntheta 6e-79
d1ulza3214 d.142.1.2 (A:115-328) Biotin carboxylase (BC), dom 2e-68
d2j9ga3216 d.142.1.2 (A:115-330) Biotin carboxylase (BC), dom 1e-63
d2r7ka2238 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carbo 1e-47
d1w96a3267 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M 5e-45
d1a9xa6259 d.142.1.2 (A:677-935) Carbamoyl phosphate syntheta 3e-42
d1ulza2114 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term 8e-41
d2j9ga2114 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term 8e-38
d1w96a2170 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N s 8e-38
d2r85a2235 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carbo 1e-36
d2j9ga1116 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-do 2e-36
d1ulza1123 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-do 3e-34
d1w96a1116 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C 2e-32
d1i7na2206 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus nor 2e-29
d1uc8a2192 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme Ly 5e-29
d1kjqa3206 d.142.1.2 (A:113-318) Glycinamide ribonucleotide t 2e-23
d3etja3198 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribo 3e-22
d1iowa2210 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain 3e-20
d1ehia2228 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase V 7e-20
d1gsoa3224 d.142.1.2 (A:104-327) Glycinamide ribonucleotide s 2e-19
d1vkza3220 d.142.1.2 (A:94-313) Glycinamide ribonucleotide sy 4e-15
d1e4ea2211 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase V 1e-13
d1eucb2246 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta- 1e-04
d2nu7b2238 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta- 5e-04
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 275 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: BC ATP-binding domain-like
domain: Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains
species: Escherichia coli [TaxId: 562]

 Score =  247 bits (631), Expect = 6e-79
 Identities = 56/297 (18%), Positives = 118/297 (39%), Gaps = 26/297 (8%)

Query: 184 DKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEP 243
           D+      MK  G+ T     G+  + EEA+ +A ++GFP +I+ +   GG G  +A   
Sbjct: 1   DRRRFDVAMKKIGLETARS--GIAHTMEEALAVAADVGFPCIIRPSFTMGGSGGGIAYNR 58

Query: 244 DEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGN--VVHFGERDCSIQ 301
           +E     ++  +          + +++ +   +  E +V+ DK  N  +V   E   ++ 
Sbjct: 59  EE----FEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMG 114

Query: 302 RRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGY-IGVGTVEFLLDERGS-FYFMEMN 359
                 +  AP+  LT +  + M +A++A    IG   G   V+F ++ +      +EMN
Sbjct: 115 IHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAVNPKNGRLIVIEMN 174

Query: 360 TRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRP 419
            R+     +    +   + +    +A+G  L     D           I       +F P
Sbjct: 175 PRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMND-----------ITGGRTPASFEP 223

Query: 420 GPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRAL 476
                  Y+    P    +     +  +     S +G+++    T+++++++  R L
Sbjct: 224 SID----YVVTKIPRFNFEKFAGANDRLTTQMKS-VGEVMAIGRTQQESLQKALRGL 275
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Length = 214 Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Length = 238 Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 267 Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 114 Back     information, alignment and structure
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 114 Back     information, alignment and structure
>d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Length = 235 Back     information, alignment and structure
>d2j9ga1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1ulza1 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-domain {Aquifex aeolicus [TaxId: 63363]} Length = 123 Back     information, alignment and structure
>d1w96a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 116 Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 206 Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Length = 192 Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Length = 228 Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Length = 224 Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Length = 220 Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Length = 211 Back     information, alignment and structure
>d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 238 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query537
d1a9xa5275 Carbamoyl phosphate synthetase (CPS), large subuni 100.0
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 100.0
d1a9xa6259 Carbamoyl phosphate synthetase (CPS), large subuni 100.0
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 100.0
d1w96a3267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 100.0
d2j9ga1116 Biotin carboxylase (BC), C-domain {Escherichia col 100.0
d1ulza1123 Biotin carboxylase (BC), C-domain {Aquifex aeolicu 100.0
d1w96a1116 Acetyl-CoA carboxylase, BC-C subdomain {Baker's ye 100.0
d2j9ga2114 Biotin carboxylase (BC), N-terminal domain {Escher 99.98
d1ulza2114 Biotin carboxylase (BC), N-terminal domain {Aquife 99.98
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 99.96
d1w96a2170 Acetyl-CoA carboxylase, BC-N subdomain {Baker's ye 99.96
d3etja3198 N5-carboxyaminoimidazole ribonucleotide synthetase 99.96
d1vkza3220 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.96
d1gsoa3224 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.95
d2r7ka2238 5-formaminoimidazole-4-carboxamide ribonucleotide 99.94
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 99.94
d1ehia2228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 99.93
d1e4ea2211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 99.93
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 99.91
d2r85a2235 5-formaminoimidazole-4-carboxamide ribonucleotide 99.91
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 99.82
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 99.16
d1gsaa2192 Prokaryotic glutathione synthetase, C-domain {Esch 99.11
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 99.05
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 98.91
d2nu7b2238 Succinyl-CoA synthetase, beta-chain, N-terminal do 98.55
d2pbza2213 5-formaminoimidazole-4-carboxamide ribonucleotide 98.45
d1eucb2246 Succinyl-CoA synthetase, beta-chain, N-terminal do 98.19
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 98.03
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 97.6
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 97.38
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.98
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.8
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.24
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.6
d1ehia1132 D-alanine:D-lactate ligase VanA, N-domain {Leucono 95.53
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 95.46
d1uc8a188 Lysine biosynthesis enzyme LysX, N-terminal domain 95.41
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 95.18
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 94.88
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.51
d1kjqa174 Glycinamide ribonucleotide transformylase PurT, C- 94.42
d2r7ka1123 5-formaminoimidazole-4-carboxamide ribonucleotide 92.82
d1e4ea1130 D-alanine:D-lactate ligase VanA, N-domain {Enteroc 92.7
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 92.24
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.55
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 91.39
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 91.28
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.17
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 90.95
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 90.94
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 90.93
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 90.84
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 90.51
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 90.49
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 90.42
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.96
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 89.76
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 89.61
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.27
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 89.12
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 89.1
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.88
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 88.8
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 88.62
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 88.41
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.99
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 87.91
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 87.84
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.79
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 87.28
d1m1na_477 Nitrogenase iron-molybdenum protein, alpha chain { 87.11
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 87.01
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.87
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 86.8
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 86.71
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 86.63
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 86.51
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 86.51
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.5
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 86.47
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 86.42
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 86.41
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 85.94
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 85.92
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 85.83
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 85.51
d1mioa_525 Nitrogenase iron-molybdenum protein, alpha chain { 85.36
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 85.35
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 85.01
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 84.9
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 84.86
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 84.74
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 84.64
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.59
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 84.34
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 84.33
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 83.87
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 83.81
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 83.8
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 83.59
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 83.22
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 83.21
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 83.16
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 82.92
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 82.89
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 82.81
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 82.49
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 82.33
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 82.05
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 81.78
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 81.55
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 81.47
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 81.16
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 80.94
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 80.47
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 80.28
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 80.23
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: BC ATP-binding domain-like
domain: Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=4.4e-46  Score=370.53  Aligned_cols=271  Identities=21%  Similarity=0.331  Sum_probs=236.2

Q ss_pred             CHHHHHHHHHHcCCCCCCCCCcCCCCHHHHHHHHHhcCCcEEEeecCCCCCcceEEeCCHHHHHHHHHHHHHHHHHhcCC
Q 009316          184 DKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGN  263 (537)
Q Consensus       184 dK~~~r~~l~~~Gvpvp~~~~~~v~~~~~~~~~~~~ig~PvvvKp~~g~gg~Gv~~v~~~~el~~~~~~~~~~~~~~~g~  263 (537)
                      ||..+|++|+++|||+|++  ..++|.+++.++++++|||+||||+.|+||+|+++|++.+|+.++++++..    .+++
T Consensus         1 Dr~~~r~~~~~~gip~~~~--~~~~~~~ea~~~~~~ig~PvviKp~~~~gg~G~~~v~~~~el~~~~~~a~~----~~~~   74 (275)
T d1a9xa5           1 DRRRFDVAMKKIGLETARS--GIAHTMEEALAVAADVGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLD----LSPT   74 (275)
T ss_dssp             SHHHHHHHHHHTTCCCCSE--EEESSHHHHHHHHHHHCSSEEEEETTCCTTTTCEEESSHHHHHHHHHHHHH----HCTT
T ss_pred             CHHHHHHHHHHCCCCCCCc--eEeCCHHHHHHHHHHcCCCEEEEECCCCCCCceEEeeCHHHHHHHHHHHHh----hCCC
Confidence            7999999999999999998  789999999999999999999999999999999999999999998887554    4678


Q ss_pred             CcEEEEecccCCcEEEEEEEEeCCCCEE--EEeeeeeeeccccceeEEEcCCCCCCHHHHHHHHHHHHHHHHHcCCc-ce
Q 009316          264 DGVYLEKYVQNPRHIEFQVLADKYGNVV--HFGERDCSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYI-GV  340 (537)
Q Consensus       264 ~~vlvEe~I~g~~ei~v~v~~d~~G~vv--~~~~r~~s~~~~~~k~~e~~P~~~l~~~~~~~l~~~a~~~~~alg~~-G~  340 (537)
                      .+++||+||+|++|++++++.|++|+.+  +..+++|+.++++++.++++|++.|+++.+++|.+.+.++++++||. |.
T Consensus        75 ~~v~iEe~l~g~~e~~v~~~~d~~g~~~~~~~~~~~~~~~~~~~~~~~~aP~~~L~~~~~~~i~~~a~~i~~~lg~~~G~  154 (275)
T d1a9xa5          75 KELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG  154 (275)
T ss_dssp             SCEEEEECCTTSEEEEEEEEECTTCCEEEEEEEEESSCTTSCGGGSCEEESCCSCCHHHHHHHHHHHHHHHHHHTCCSEE
T ss_pred             CcEEEeeecCCchhheeeeEEecCCCEEEEEeeccccccCcccCceeEEcCCCcCCHHHHHHHHHHHHHHHHHcCceECc
Confidence            8999999999999999999999988844  66789999999999999999999999999999999999999999996 99


Q ss_pred             eEEEEEEe-CCCCeEEEEEeccCCCcccchhhhcCCCHHHHHHHHHcCCCCCCCccccccceeEEEEEEeeCCCCCCCCC
Q 009316          341 GTVEFLLD-ERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIHVAMGGKLRYKQEDIVLQGHSIECRINAEDPFKNFRP  419 (537)
Q Consensus       341 ~~vEf~~~-~~g~~~~lEiN~R~~g~~~~~e~~tGidl~~~~i~~a~G~~l~~~~~~~~~~g~ai~~ri~ae~p~~~f~p  419 (537)
                      +++||+++ ++|++||+|+|||+|++|++++++||+||+++++++++|.++...+......           .....+.|
T Consensus       155 ~~~ef~~~~~~~~~~~iE~npR~~~~~~~~~~~tgidlv~~~~~~a~G~~l~~~~~~~~~~-----------~~~~~~~~  223 (275)
T d1a9xa5         155 SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDITGG-----------RTPASFEP  223 (275)
T ss_dssp             EEEEEEECTTTCCEEEEEEESSCCHHHHHHHHHHSCCHHHHHHHHHTTCCGGGSBCTTTTT-----------CSBSCSCC
T ss_pred             eEEEEEEeCCCCEEEEEEecCCCCceehhhhHhhCCCHHHHHHHHHcCCCCcccccccccc-----------cCccccCC
Confidence            99999998 6789999999999999999999999999999999999999986554332211           12234556


Q ss_pred             CCceEEEEecCCCCeEEEeeeccCCCccCCCCCCccEEEEEEcCCHHHHHHHHHHhh
Q 009316          420 GPGIITAYLPAGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRAL  476 (537)
Q Consensus       420 ~~G~i~~~~~~~~~~vr~d~~~~~G~~v~~~~ds~ig~vi~~g~~~~ea~~~~~~al  476 (537)
                      ..+.+....    +.++++.....|..+.+.||| +|+||++|+|++||++|+++||
T Consensus       224 ~~~~~~~k~----~~~~~~~~~~~~~~l~~~~~s-~g~vi~~G~t~~eA~~ka~raL  275 (275)
T d1a9xa5         224 SIDYVVTKI----PRFNFEKFAGANDRLTTQMKS-VGEVMAIGRTQQESLQKALRGL  275 (275)
T ss_dssp             BCSSEEEEE----EECCGGGCTTSCCBCCSSCCC-CEEEEEEESSHHHHHHHHHHHS
T ss_pred             CCCcEecCc----cceecCCCCCCCCEeCCCccc-CEEEEEEECCHHHHHHHHHHhC
Confidence            656554321    233444455567788899999 9999999999999999999987
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j9ga1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza1 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w96a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pbza2 d.142.1.9 (A:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ehia1 c.30.1.2 (A:3-134) D-alanine:D-lactate ligase VanA, N-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uc8a1 c.30.1.6 (A:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kjqa1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r7ka1 c.30.1.8 (A:1-123) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e4ea1 c.30.1.2 (A:2-131) D-alanine:D-lactate ligase VanA, N-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1m1na_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mioa_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure