Citrus Sinensis ID: 009527


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530--
MAMARRMATFICLFVVGLSFAAAGDVTLDDDDSSPNIPGCNNKLQLVKVKNWVDNVEGESFAGLTARFGLPLPSDAAKAFKLPAVLSNPLNCCSTASKLSGSIALSMRGDCAFTTKAEVAQAAGAAALVVINDEEDLYKMVCSENDTALNISIPVLMIPKSRGDALNKSIADKQRVELLLYAPNRPDVDFAVIFLWMMAVGTIIAAALWSLLTSEQTDERYNELSPKESSNLEAVKDDSEKEVLDITAKGAIVFVIVASTFLVLLYFFMSSWFVWLLVVLFCIGGIEGMHNIIVTLVLSKCRNCGRKTVHLPLLDEVSVLSLVVLLFCVVFAVVWAVRRQASYSWVGQDILGICLMITVLQMARLPNIKVASVLLCCAFVYDIFWVFVSPLIFHESVMIAVARGDNSGGESIPMLLRIPRLFDPWGGYDMIGFGDILFPGLLICFAFRYDKENKKGVVKGYFLWLIIGYGFGLFLTYLGLYLMNGHGQPALLYLVPCTLGLTVILGLARGELKHLWDYSREPSSDMNRPVEA
cHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEECcccccccEEEEccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHccccEEEEEEcccccccccccccccccccccEEEEEcccHHHHHHHHHHccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccCEECccccccHHHHHHHHHHHHHHHHHHHEEcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHEEEEEEEEcccEEccccHHHcccccccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHcHHHHcccccccccccccccccc
******MATFICLFVVGLSFAAAGDVTLD******NIPGCNNKLQLVKVKNWVDNVEGESFAGLTARFGLPLPSDAAKAFKLPAVLSNPLNCCSTASKLSGSIALSMRGDCAFTTKAEVAQAAGAAALVVINDEEDLYKMVCSENDTALNISIPVLMIPKSRGDALNKSIADKQRVELLLYAPNRPDVDFAVIFLWMMAVGTIIAAALWSLLTSEQTDERY********************EVLDITAKGAIVFVIVASTFLVLLYFFMSSWFVWLLVVLFCIGGIEGMHNIIVTLVLSKCRNCGRKTVHLPLLDEVSVLSLVVLLFCVVFAVVWAVRRQASYSWVGQDILGICLMITVLQMARLPNIKVASVLLCCAFVYDIFWVFVSPLIFHESVMIAVARGDNSGGESIPMLLRIPRLFDPWGGYDMIGFGDILFPGLLICFAFRYDKENKKGVVKGYFLWLIIGYGFGLFLTYLGLYLMNGHGQPALLYLVPCTLGLTVILGLARGELKHLWDY**************
xxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMARRMATFICLFVVGLSFAAAGDVTLDDDDSSPNIPGCNNKLQLVKVKNWVDNVEGESFAGLTARFGLPLPSDAAKAFKLPAVLSNPLNCCSTASKLSGSIALSMRGDCAFTTKAEVAQAAGAAALVVINDEEDLYKMVCSENDTALNISIPVLMIPKSRGDALNKSIADKQRVELLLYAPNRPDVDFAVIFLWMMAVGTIIAAALWSLLTSEQTDERYNELSPKESSNLEAVKDDSEKEVLDITAKGAIVFVIVASTFLVLLYFFMSSWFVWLLVVLFCIGGIEGMHNIIVTLVLSKCRNCGRKTVHLPLLDEVSVLSLVVLLFCVVFAVVWAVRRQASYSWVGQDILGICLMITVLQMARLPNIKVASVLLCCAFVYDIFWVFVSPLIFHESVMIAVARGDNSGGESIPMLLRIPRLFDPWGGYDMIGFGDILFPGLLICFAFRYDKENKKGVVKGYFLWLIIGYGFGLFLTYLGLYLMNGHGQPALLYLVPCTLGLTVILGLARGELKHLWDYSREPSSDMNRPVEA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal peptide peptidase-like 5 Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.probableQ5Z413
Signal peptide peptidase-like 2 Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.probableQ53P98
Signal peptide peptidase-like 5 Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.probableQ9MA44

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ICU, chain A
Confidence level:very confident
Coverage over the Query: 45-189
View the alignment between query and template
View the model in PyMOL
Template: 4HYG, chain A
Confidence level:confident
Coverage over the Query: 323-405,427-509
View the alignment between query and template
View the model in PyMOL
Template: 1Y9Z, chain A
Confidence level:probable
Coverage over the Query: 91-211
View the alignment between query and template
View the model in PyMOL