Citrus Sinensis ID: 009558

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530--
MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPLLSVILLAVGAVLLIGYLYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKFDQASVKRSYKPASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPSSLKQKHRDWSADTATKFFFKQDTAASSNEPSSLQIVLEYFKQVYGNPPIYIHENGSLSLSLSIYLSIYLLMLLTTDYSK
cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHcccccccccccccccccccHHHHHHHHHcEEEEEECccccccccccccEEEEccccccccHHHHHHHHHHHHHHHcccEEEccccccccccCEECcccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHcccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHHHHcccccc
********************************LLSVILLAVGAVLLIGYLYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLE*************VKRSYKPASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPSSLKQKHRDWSADTATKFFFKQDTAASSNEPSSLQIVLEYFKQVYGNPPIYIHENGSLSLSLSIYLSIYLLMLLTTDYS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPLLSVILLAVGAVLLIGYLYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKFDQASVKRSYKPASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPSSLKQKHRDWSADTATKFFFKQDTAASSNEPSSLQIVLEYFKQVYGNPPIYIHENGSLSLSLSIYLSIYLLMLLTTDYSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized protein At3g49720 probableQ9M2Y6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WCG, chain A
Confidence level:very confident
Coverage over the Query: 264-523
View the alignment between query and template
View the model in PyMOL
Template: 1V08, chain A
Confidence level:very confident
Coverage over the Query: 247-513
View the alignment between query and template
View the model in PyMOL
Template: 3AIS, chain A
Confidence level:confident
Coverage over the Query: 254-420
View the alignment between query and template
View the model in PyMOL
Template: 2P8J, chain A
Confidence level:confident
Coverage over the Query: 77-194
View the alignment between query and template
View the model in PyMOL
Template: 3E23, chain A
Confidence level:probable
Coverage over the Query: 93-229
View the alignment between query and template
View the model in PyMOL