Citrus Sinensis ID: 009558
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 532 | 2.2.26 [Sep-21-2011] | |||||||
| Q9M2Y6 | 261 | Uncharacterized protein A | yes | no | 0.479 | 0.977 | 0.714 | 1e-103 | |
| B3H5Q1 | 521 | Beta-glucosidase 11 OS=Ar | no | no | 0.268 | 0.274 | 0.770 | 1e-66 | |
| Q8S3J3 | 560 | Hydroxyisourate hydrolase | no | no | 0.265 | 0.251 | 0.788 | 3e-62 | |
| O65458 | 507 | Beta-glucosidase 3 OS=Ara | no | no | 0.268 | 0.282 | 0.743 | 5e-59 | |
| Q67XN2 | 497 | Beta-glucosidase 8 OS=Ara | no | no | 0.296 | 0.317 | 0.670 | 3e-58 | |
| Q93ZI4 | 508 | Beta-glucosidase 10 OS=Ar | no | no | 0.259 | 0.271 | 0.721 | 2e-57 | |
| Q9ZUI3 | 512 | Beta-glucosidase 4 OS=Ara | no | no | 0.255 | 0.265 | 0.724 | 1e-56 | |
| Q8RXN9 | 500 | Putative beta-glucosidase | no | no | 0.257 | 0.274 | 0.702 | 2e-56 | |
| Q682B4 | 379 | Putative beta-glucosidase | no | no | 0.248 | 0.348 | 0.710 | 5e-56 | |
| Q3ECW8 | 517 | Beta-glucosidase 1 OS=Ara | no | no | 0.257 | 0.264 | 0.688 | 5e-56 |
| >sp|Q9M2Y6|Y3972_ARATH Uncharacterized protein At3g49720 OS=Arabidopsis thaliana GN=At3g49720 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 376 bits (965), Expect = e-103, Method: Compositional matrix adjust.
Identities = 183/256 (71%), Positives = 213/256 (83%), Gaps = 1/256 (0%)
Query: 1 MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPLLSVILLAVGAVLLIGYLYSGSGKTTIE 60
M+RR V RR+ DGGS PF G+ HSKSRSSPLLS+ L+ VGA LLIGY YSG G
Sbjct: 1 MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI 60
Query: 61 KEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGV 120
KE +SKV G SCT EVQRA+PVLKKAYGD M KVLHVGP+TCSVVS LLKEE+TEAWGV
Sbjct: 61 KE-VSKVTGDYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLKEEETEAWGV 119
Query: 121 EPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPE 180
EPYD++DAD++C+S V KG+VRVADIKFPLPYRAKSFSLVIVSDA+DYLSPKYLN+T+PE
Sbjct: 120 EPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPKYLNKTVPE 179
Query: 181 LARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKF 240
LARV+ DGVV+FAG PGQ RAKV+ELSKFGRPAK+RS++WW R+F+Q +LEEN+ +KKF
Sbjct: 180 LARVASDGVVLFAGLPGQQRAKVAELSKFGRPAKMRSASWWNRFFVQTNLEENDAPSKKF 239
Query: 241 DQASVKRSYKPASSAL 256
+QA K YKPA
Sbjct: 240 EQAVSKGLYKPACQVF 255
|
Arabidopsis thaliana (taxid: 3702) |
| >sp|B3H5Q1|BGL11_ARATH Beta-glucosidase 11 OS=Arabidopsis thaliana GN=BGLU11 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8S3J3|HIUH_SOYBN Hydroxyisourate hydrolase OS=Glycine max GN=HIUH PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O65458|BGL03_ARATH Beta-glucosidase 3 OS=Arabidopsis thaliana GN=BGLU3 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q67XN2|BGL08_ARATH Beta-glucosidase 8 OS=Arabidopsis thaliana GN=BGLU8 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q93ZI4|BGL10_ARATH Beta-glucosidase 10 OS=Arabidopsis thaliana GN=BGLU10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ZUI3|BGL04_ARATH Beta-glucosidase 4 OS=Arabidopsis thaliana GN=BGLU4 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8RXN9|BGL05_ARATH Putative beta-glucosidase 5 OS=Arabidopsis thaliana GN=BGLU5 PE=5 SV=2 | Back alignment and function description |
|---|
| >sp|Q682B4|BGL06_ARATH Putative beta-glucosidase 6 OS=Arabidopsis thaliana GN=BGLU6 PE=5 SV=1 | Back alignment and function description |
|---|
| >sp|Q3ECW8|BGL01_ARATH Beta-glucosidase 1 OS=Arabidopsis thaliana GN=BGLU1 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 532 | ||||||
| 255562096 | 261 | conserved hypothetical protein [Ricinus | 0.488 | 0.996 | 0.804 | 1e-118 | |
| 224105811 | 262 | predicted protein [Populus trichocarpa] | 0.490 | 0.996 | 0.773 | 1e-115 | |
| 224060959 | 262 | predicted protein [Populus trichocarpa] | 0.473 | 0.961 | 0.793 | 1e-114 | |
| 359475519 | 262 | PREDICTED: uncharacterized protein At3g4 | 0.481 | 0.977 | 0.816 | 1e-113 | |
| 449438287 | 261 | PREDICTED: uncharacterized protein At3g4 | 0.490 | 1.0 | 0.751 | 1e-112 | |
| 357446151 | 262 | hypothetical protein MTR_2g010540 [Medic | 0.490 | 0.996 | 0.716 | 1e-106 | |
| 147801370 | 256 | hypothetical protein VITISV_037838 [Viti | 0.462 | 0.960 | 0.75 | 1e-106 | |
| 358248664 | 262 | uncharacterized protein LOC100800870 [Gl | 0.473 | 0.961 | 0.722 | 1e-103 | |
| 297819624 | 261 | hypothetical protein ARALYDRAFT_485334 [ | 0.479 | 0.977 | 0.722 | 1e-102 | |
| 18408931 | 261 | uncharacterized protein [Arabidopsis tha | 0.479 | 0.977 | 0.714 | 1e-101 |
| >gi|255562096|ref|XP_002522056.1| conserved hypothetical protein [Ricinus communis] gi|223538655|gb|EEF40256.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 433 bits (1113), Expect = e-118, Method: Compositional matrix adjust.
Identities = 210/261 (80%), Positives = 232/261 (88%), Gaps = 1/261 (0%)
Query: 1 MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPLLSVILLAVGAVLLIGYLYSGSGKTTIE 60
MSRRP NPARRL DGG IPFVGS HSKSRSSPLLS+ L+ VGA+LLI Y YSGSG E
Sbjct: 1 MSRRPGNPARRLGDGGGIPFVGS-HSKSRSSPLLSICLVVVGAILLIIYCYSGSGGHISE 59
Query: 61 KEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGV 120
+EA SK+EG SCTLEVQRA+P+LKKAYGDSM KVLH+GP+TCSVVSKLLKEE+TEAWGV
Sbjct: 60 REAFSKIEGGGSCTLEVQRAIPLLKKAYGDSMHKVLHLGPDTCSVVSKLLKEEETEAWGV 119
Query: 121 EPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPE 180
EPYDLDD DA+C+SLVRKG+VRVADIKFPLPYRAKSFSLVIVSDA+DYLSP+YLN+TLPE
Sbjct: 120 EPYDLDDVDASCKSLVRKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPRYLNKTLPE 179
Query: 181 LARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKF 240
LARVS DGV+IF+GYPGQH+AKV+ELSKFGRPAK RSSTWWIRYFLQNSLEENE A+KKF
Sbjct: 180 LARVSADGVIIFSGYPGQHKAKVAELSKFGRPAKFRSSTWWIRYFLQNSLEENEAASKKF 239
Query: 241 DQASVKRSYKPASSALTAVEY 261
+QASVKRSYKP Y
Sbjct: 240 EQASVKRSYKPGCQVFHLKSY 260
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224105811|ref|XP_002313939.1| predicted protein [Populus trichocarpa] gi|118483865|gb|ABK93823.1| unknown [Populus trichocarpa] gi|222850347|gb|EEE87894.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224060959|ref|XP_002300295.1| predicted protein [Populus trichocarpa] gi|118484269|gb|ABK94014.1| unknown [Populus trichocarpa] gi|222847553|gb|EEE85100.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359475519|ref|XP_002269364.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] gi|297736364|emb|CBI25087.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449438287|ref|XP_004136920.1| PREDICTED: uncharacterized protein At3g49720-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357446151|ref|XP_003593353.1| hypothetical protein MTR_2g010540 [Medicago truncatula] gi|355482401|gb|AES63604.1| hypothetical protein MTR_2g010540 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147801370|emb|CAN74732.1| hypothetical protein VITISV_037838 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|358248664|ref|NP_001240175.1| uncharacterized protein LOC100800870 [Glycine max] gi|255641603|gb|ACU21074.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297819624|ref|XP_002877695.1| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata] gi|297323533|gb|EFH53954.1| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18408931|ref|NP_566924.1| uncharacterized protein [Arabidopsis thaliana] gi|145332799|ref|NP_001078265.1| uncharacterized protein [Arabidopsis thaliana] gi|75183398|sp|Q9M2Y6.1|Y3972_ARATH RecName: Full=Uncharacterized protein At3g49720 gi|6723417|emb|CAB66910.1| hypothetical protein [Arabidopsis thaliana] gi|21593048|gb|AAM64997.1| unknown [Arabidopsis thaliana] gi|222424727|dbj|BAH20317.1| AT3G49720 [Arabidopsis thaliana] gi|332645059|gb|AEE78580.1| uncharacterized protein [Arabidopsis thaliana] gi|332645060|gb|AEE78581.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 532 | ||||||
| TAIR|locus:2097380 | 261 | AT3G49720 "AT3G49720" [Arabido | 0.471 | 0.961 | 0.678 | 8.6e-88 | |
| TAIR|locus:2156208 | 258 | CGR3 "AT5G65810" [Arabidopsis | 0.466 | 0.961 | 0.674 | 9.9e-87 | |
| TAIR|locus:2202710 | 512 | BGLU4 "beta glucosidase 4" [Ar | 0.255 | 0.265 | 0.724 | 2.8e-78 | |
| TAIR|locus:2024685 | 521 | BGLU11 "beta glucosidase 11" [ | 0.276 | 0.282 | 0.763 | 4.2e-63 | |
| TAIR|locus:2197960 | 510 | BGLU40 "beta glucosidase 40" [ | 0.295 | 0.307 | 0.493 | 2e-61 | |
| UNIPROTKB|Q8L7J2 | 521 | BGLU6 "Beta-glucosidase 6" [Or | 0.257 | 0.262 | 0.578 | 1.1e-60 | |
| UNIPROTKB|Q9ZT64 | 513 | Q9ZT64 "Beta-glucosidase" [Pin | 0.268 | 0.278 | 0.561 | 2.9e-60 | |
| UNIPROTKB|Q7XKV4 | 510 | BGLU12 "Beta-glucosidase 12" [ | 0.291 | 0.303 | 0.539 | 2e-59 | |
| UNIPROTKB|Q9SPP9 | 540 | Q9SPP9 "Raucaffricine-O-beta-D | 0.265 | 0.261 | 0.578 | 1.4e-58 | |
| TAIR|locus:2050615 | 582 | BGLU28 "beta glucosidase 28" [ | 0.300 | 0.274 | 0.437 | 5e-57 |
| TAIR|locus:2097380 AT3G49720 "AT3G49720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 877 (313.8 bits), Expect = 8.6e-88, P = 8.6e-88
Identities = 171/252 (67%), Positives = 199/252 (78%)
Query: 1 MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPXXXXXXXXXXXXXXXXXXYSGSGKTTIE 60
M+RR V RR+ DGGS PF G+ HSKSRSSP YSG G
Sbjct: 1 MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI 60
Query: 61 KEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGV 120
KE +SKV G SCT EVQRA+PVLKKAYGD M KVLHVGP+TCSVVS LLKEE+TEAWGV
Sbjct: 61 KE-VSKVTGDYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLKEEETEAWGV 119
Query: 121 EPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPE 180
EPYD++DAD++C+S V KG+VRVADIKFPLPYRAKSFSLVIVSDA+DYLSPKYLN+T+PE
Sbjct: 120 EPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPKYLNKTVPE 179
Query: 181 LARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKF 240
LARV+ DGVV+FAG PGQ RAKV+ELSKFGRPAK+RS++WW R+F+Q +LEEN+ +KKF
Sbjct: 180 LARVASDGVVLFAGLPGQQRAKVAELSKFGRPAKMRSASWWNRFFVQTNLEENDAPSKKF 239
Query: 241 DQASVKRSYKPA 252
+QA K YKPA
Sbjct: 240 EQAVSKGLYKPA 251
|
|
| TAIR|locus:2156208 CGR3 "AT5G65810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202710 BGLU4 "beta glucosidase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024685 BGLU11 "beta glucosidase 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197960 BGLU40 "beta glucosidase 40" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8L7J2 BGLU6 "Beta-glucosidase 6" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9ZT64 Q9ZT64 "Beta-glucosidase" [Pinus contorta (taxid:3339)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7XKV4 BGLU12 "Beta-glucosidase 12" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SPP9 Q9SPP9 "Raucaffricine-O-beta-D-glucosidase" [Rauvolfia serpentina (taxid:4060)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2050615 BGLU28 "beta glucosidase 28" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9M2Y6 | Y3972_ARATH | No assigned EC number | 0.7148 | 0.4793 | 0.9770 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.2.1 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 532 | |||
| PLN02998 | 497 | PLN02998, PLN02998, beta-glucosidase | 1e-78 | |
| PLN02814 | 504 | PLN02814, PLN02814, beta-glucosidase | 4e-75 | |
| PLN02849 | 503 | PLN02849, PLN02849, beta-glucosidase | 5e-74 | |
| TIGR03356 | 426 | TIGR03356, BGL, beta-galactosidase | 6e-72 | |
| pfam00232 | 454 | pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil | 8e-69 | |
| COG2723 | 460 | COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu | 2e-60 | |
| PRK13511 | 469 | PRK13511, PRK13511, 6-phospho-beta-galactosidase; | 1e-44 | |
| PLN02998 | 497 | PLN02998, PLN02998, beta-glucosidase | 5e-33 | |
| PRK09852 | 474 | PRK09852, PRK09852, cryptic 6-phospho-beta-glucosi | 7e-29 | |
| PRK09589 | 476 | PRK09589, celA, 6-phospho-beta-glucosidase; Review | 4e-28 | |
| PRK09593 | 478 | PRK09593, arb, 6-phospho-beta-glucosidase; Reviewe | 2e-27 | |
| PRK15014 | 477 | PRK15014, PRK15014, 6-phospho-beta-glucosidase Bgl | 2e-27 | |
| TIGR01233 | 467 | TIGR01233, lacG, 6-phospho-beta-galactosidase | 8e-27 | |
| PLN02849 | 503 | PLN02849, PLN02849, beta-glucosidase | 1e-26 | |
| PLN02814 | 504 | PLN02814, PLN02814, beta-glucosidase | 1e-24 | |
| pfam00232 | 454 | pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil | 3e-18 | |
| TIGR03356 | 426 | TIGR03356, BGL, beta-galactosidase | 9e-09 | |
| COG2723 | 460 | COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu | 3e-05 |
| >gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase | Back alignment and domain information |
|---|
Score = 255 bits (651), Expect = 1e-78
Identities = 113/148 (76%), Positives = 138/148 (93%), Gaps = 1/148 (0%)
Query: 252 ASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNV-LGNGDI 310
A +A+++++Y++NDFPPGF+FGSGTSAYQVEGAA+EDGRTPSIWD FAHAG+ + G++
Sbjct: 17 ALTAVSSLKYSRNDFPPGFVFGSGTSAYQVEGAADEDGRTPSIWDVFAHAGHSGVAAGNV 76
Query: 311 ACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGI 370
ACD+YHKYKEDVKLMA GL+AYRFSISWSRL+P+GRGP+NPKGLQYYNNLI+ELI++GI
Sbjct: 77 ACDQYHKYKEDVKLMADMGLEAYRFSISWSRLLPSGRGPINPKGLQYYNNLIDELITHGI 136
Query: 371 QPHVTLHHSDLPQALEDEYGGWINRMIV 398
QPHVTLHH DLPQALEDEYGGW+++ IV
Sbjct: 137 QPHVTLHHFDLPQALEDEYGGWLSQEIV 164
|
Length = 497 |
| >gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase | Back alignment and domain information |
|---|
| >gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase | Back alignment and domain information |
|---|
| >gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase | Back alignment and domain information |
|---|
| >gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase | Back alignment and domain information |
|---|
| >gnl|CDD|182112 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236580 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184975 PRK15014, PRK15014, 6-phospho-beta-glucosidase BglA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase | Back alignment and domain information |
|---|
| >gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase | Back alignment and domain information |
|---|
| >gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase | Back alignment and domain information |
|---|
| >gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase | Back alignment and domain information |
|---|
| >gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 532 | |||
| KOG0626 | 524 | consensus Beta-glucosidase, lactase phlorizinhydro | 100.0 | |
| PLN02814 | 504 | beta-glucosidase | 100.0 | |
| PLN02849 | 503 | beta-glucosidase | 100.0 | |
| PLN02998 | 497 | beta-glucosidase | 100.0 | |
| PF00232 | 455 | Glyco_hydro_1: Glycosyl hydrolase family 1; InterP | 100.0 | |
| PRK09593 | 478 | arb 6-phospho-beta-glucosidase; Reviewed | 100.0 | |
| COG2723 | 460 | BglB Beta-glucosidase/6-phospho-beta-glucosidase/b | 100.0 | |
| PRK13511 | 469 | 6-phospho-beta-galactosidase; Provisional | 100.0 | |
| PRK09589 | 476 | celA 6-phospho-beta-glucosidase; Reviewed | 100.0 | |
| TIGR01233 | 467 | lacG 6-phospho-beta-galactosidase. This enzyme is | 100.0 | |
| PRK15014 | 477 | 6-phospho-beta-glucosidase BglA; Provisional | 100.0 | |
| PRK09852 | 474 | cryptic 6-phospho-beta-glucosidase; Provisional | 100.0 | |
| TIGR03356 | 427 | BGL beta-galactosidase. | 100.0 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 98.33 | |
| PF02449 | 374 | Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 | 98.28 | |
| PF00150 | 281 | Cellulase: Cellulase (glycosyl hydrolase family 5) | 97.66 | |
| smart00633 | 254 | Glyco_10 Glycosyl hydrolase family 10. | 96.49 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 96.35 | |
| COG1874 | 673 | LacA Beta-galactosidase [Carbohydrate transport an | 96.33 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 95.9 | |
| PF07745 | 332 | Glyco_hydro_53: Glycosyl hydrolase family 53; Inte | 95.65 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 94.5 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 94.2 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 94.05 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 93.84 | |
| PRK10150 | 604 | beta-D-glucuronidase; Provisional | 93.7 | |
| PLN02161 | 531 | beta-amylase | 93.14 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 92.99 | |
| PLN02803 | 548 | beta-amylase | 92.96 | |
| PLN02905 | 702 | beta-amylase | 92.41 | |
| PLN02801 | 517 | beta-amylase | 92.38 | |
| PLN02705 | 681 | beta-amylase | 92.29 | |
| PLN00197 | 573 | beta-amylase; Provisional | 92.2 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 92.11 | |
| PF01373 | 402 | Glyco_hydro_14: Glycosyl hydrolase family 14; Inte | 91.39 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 90.16 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 90.13 | |
| PF01301 | 319 | Glyco_hydro_35: Glycosyl hydrolases family 35; Int | 90.06 | |
| COG2730 | 407 | BglC Endoglucanase [Carbohydrate transport and met | 88.97 | |
| PF11790 | 239 | Glyco_hydro_cc: Glycosyl hydrolase catalytic core; | 87.98 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 85.96 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 85.26 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 84.84 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 84.81 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 83.88 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 83.17 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 82.0 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 81.19 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 80.46 |
| >KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5e-76 Score=627.69 Aligned_cols=260 Identities=54% Similarity=0.954 Sum_probs=227.2
Q ss_pred CCCcccccccccCcCCCCCCcEEeeeechhhhcCccCCCCCCCccceeccccCc-c---CCCCccCCccccccHHHHHHH
Q 009558 250 KPASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGN-V---LGNGDIACDEYHKYKEDVKLM 325 (532)
Q Consensus 250 ~p~cqifhL~~~~~~~FP~dFlwG~ATSA~QvEGa~~~dGkg~SiWD~~~~~~~-~---g~~~dva~D~YhrYkEDI~Lm 325 (532)
.+.|...+ .+.+..||+||+||+||||||+|||+++|||++|+||.|+|..+ . +.++|+|||+||||+|||+||
T Consensus 23 ~~~~~~~~--~~~r~~FP~~F~FGtAtSAyQ~EGA~~e~gRg~svWD~f~~~~p~~~~~~~ngdva~D~Yh~ykeDv~Lm 100 (524)
T KOG0626|consen 23 SSVCPKTT--KFSRADFPKGFLFGTATSAYQVEGAANEDGRGPSVWDTFTHKYPGKICDGSNGDVAVDFYHRYKEDVKLM 100 (524)
T ss_pred cccCcccC--cccccCCCCCceeeccchHHHhhhhhccCCCCCchhhhhhccCCcccccCCCCCeechhhhhhHHHHHHH
Confidence 45566555 66788999999999999999999999999999999999998644 2 667999999999999999999
Q ss_pred HHcCCCEEEecccccccccCCC--CCCChhHHHHHHHHHHHHHHCCCeeEEEeccCCcchhHHhhhCCccccceE-----
Q 009558 326 AKTGLDAYRFSISWSRLIPNGR--GPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIV----- 398 (532)
Q Consensus 326 ~elGv~ayRFSIsWsRI~P~G~--G~vN~~Gi~~Y~~lId~L~~~GIePiVTL~HfdlP~~L~d~~GGW~n~~~v----- 398 (532)
++||+++|||||+||||+|.|+ +.||++||+||+++|++|+++||+|+|||||||+||+|+|+||||+|+++|
T Consensus 101 k~lgv~afRFSIsWSRIlP~G~~~~gVN~~Gi~fY~~LI~eL~~nGI~P~VTLfHwDlPq~LeDeYgGwLn~~ivedF~~ 180 (524)
T KOG0626|consen 101 KELGVDAFRFSISWSRILPNGRLTGGVNEAGIQFYNNLIDELLANGIEPFVTLFHWDLPQALEDEYGGWLNPEIVEDFRD 180 (524)
T ss_pred HHcCCCeEEEEeehHhhCCCCCcCCCcCHHHHHHHHHHHHHHHHcCCeEEEEEecCCCCHHHHHHhccccCHHHHHHHHH
Confidence 9999999999999999999998 689999999999999999999999999999999999999999999999988
Q ss_pred --------------------------------------------------------------------------------
Q 009558 399 -------------------------------------------------------------------------------- 398 (532)
Q Consensus 399 -------------------------------------------------------------------------------- 398 (532)
T Consensus 181 yA~~CF~~fGDrVK~WiT~NEP~v~s~~gY~~G~~aPGrCs~~~~~c~~g~s~~epYiv~HNllLAHA~Av~~yr~kyk~ 260 (524)
T KOG0626|consen 181 YADLCFQEFGDRVKHWITFNEPNVFSIGGYDTGTKAPGRCSKYVGNCSAGNSGTEPYIVAHNLLLAHAAAVDLYRKKYKK 260 (524)
T ss_pred HHHHHHHHhcccceeeEEecccceeeeehhccCCCCCCCCCcccccCCCCCCCCCcchHHHHHHHHHHHHHHHHHHhhhh
Confidence
Q ss_pred --------------------------------------EecccccCCCcchhhcccCCCCCCCChhHHhhhcCCCceeee
Q 009558 399 --------------------------------------VANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGV 440 (532)
Q Consensus 399 --------------------------------------FlDPi~~GdYP~~m~e~lGsrLP~FT~eE~elIkgslDFLGI 440 (532)
|++|+++|+||+.|++.+|+|||.||++|.+++||+.||+||
T Consensus 261 ~Q~G~IGi~~~~~w~eP~~~s~~D~~Aa~Ra~~F~~gw~l~p~~~GdYP~~Mk~~vg~rLP~FT~ee~~~lKGS~DFvGi 340 (524)
T KOG0626|consen 261 KQGGKIGIALSARWFEPYDDSKEDKEAAERALDFFLGWFLEPLTFGDYPDEMKERVGSRLPKFTEEESKLLKGSYDFVGI 340 (524)
T ss_pred hcCCeEeEEEeeeeeccCCCChHHHHHHHHHHHhhhhhhhcccccCCcHHHHHHHhcccCCCCCHHHHHHhcCchhhcee
Confidence 889988999999999999999999999999999999999999
Q ss_pred ecccceeeecCCCCcccCCCCCCCCccccccccC---------CCCCCCCCchHHHHHHHHHHHHcCCCCEEEEeCCCCC
Q 009558 441 INYYTVYIKDNPSSLKQKHRDWSADTATKFFFKQ---------DTAASSNEPSSLQIVLEYFKQVYGNPPIYIHENGSLS 511 (532)
Q Consensus 441 NYYTs~~Vka~~~~~~~~~~~~~~D~~v~~~~~~---------~t~~GeIyP~GLr~iL~~Ik~rYgn~PIyITENGig~ 511 (532)
||||+.+|+...............|..+.. ... .+.+-.++|+|||++|+|++++|+||||||||||++.
T Consensus 341 NyYts~~~~~~~~~~~~~~~~~~~d~~~~~-~~~~~~~~~~~~~~~~~~v~P~Glr~~L~yiK~~Y~np~iyItENG~~d 419 (524)
T KOG0626|consen 341 NYYTSRYVKHLKPPPDPSQPGWSTDSGVDW-TLEGNDLIGPKAGSDWLPVYPWGLRKLLNYIKDKYGNPPIYITENGFDD 419 (524)
T ss_pred ehhhhhhhhccCCCCCCCCcccccccceee-eecccccccccccccceeeccHHHHHHHHHHHhhcCCCcEEEEeCCCCc
Confidence 999999998865432211122223332222 111 1112289999999999999999999999999999998
Q ss_pred C
Q 009558 512 L 512 (532)
Q Consensus 512 ~ 512 (532)
.
T Consensus 420 ~ 420 (524)
T KOG0626|consen 420 L 420 (524)
T ss_pred c
Confidence 5
|
|
| >PLN02814 beta-glucosidase | Back alignment and domain information |
|---|
| >PLN02849 beta-glucosidase | Back alignment and domain information |
|---|
| >PLN02998 beta-glucosidase | Back alignment and domain information |
|---|
| >PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK09593 arb 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13511 6-phospho-beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >PRK09589 celA 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01233 lacG 6-phospho-beta-galactosidase | Back alignment and domain information |
|---|
| >PRK15014 6-phospho-beta-glucosidase BglA; Provisional | Back alignment and domain information |
|---|
| >PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03356 BGL beta-galactosidase | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >smart00633 Glyco_10 Glycosyl hydrolase family 10 | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PRK10150 beta-D-glucuronidase; Provisional | Back alignment and domain information |
|---|
| >PLN02161 beta-amylase | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PLN02803 beta-amylase | Back alignment and domain information |
|---|
| >PLN02905 beta-amylase | Back alignment and domain information |
|---|
| >PLN02801 beta-amylase | Back alignment and domain information |
|---|
| >PLN02705 beta-amylase | Back alignment and domain information |
|---|
| >PLN00197 beta-amylase; Provisional | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 532 | ||||
| 3gno_A | 488 | Crystal Structure Of A Rice Os3bglu6 Beta-glucosida | 2e-46 | ||
| 3gno_A | 488 | Crystal Structure Of A Rice Os3bglu6 Beta-glucosida | 3e-12 | ||
| 3scp_A | 481 | Crystal Structure Of Rice Bglu1 E386a Mutant Length | 2e-44 | ||
| 3scp_A | 481 | Crystal Structure Of Rice Bglu1 E386a Mutant Length | 1e-11 | ||
| 3scw_A | 481 | Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C | 2e-44 | ||
| 3scw_A | 481 | Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C | 7e-11 | ||
| 3scr_A | 481 | Crystal Structure Of Rice Bglu1 E386s Mutant Length | 2e-44 | ||
| 3scr_A | 481 | Crystal Structure Of Rice Bglu1 E386s Mutant Length | 1e-11 | ||
| 3f4v_A | 481 | Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo | 2e-44 | ||
| 3f4v_A | 481 | Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo | 3e-12 | ||
| 2rgl_A | 481 | Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE | 2e-44 | ||
| 2rgl_A | 481 | Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE | 3e-12 | ||
| 3scn_A | 481 | Crystal Structure Of Rice Bglu1 E386g Mutant Length | 2e-44 | ||
| 3scn_A | 481 | Crystal Structure Of Rice Bglu1 E386g Mutant Length | 2e-11 | ||
| 3scv_A | 481 | Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C | 2e-44 | ||
| 3scv_A | 481 | Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C | 3e-11 | ||
| 4a3y_A | 540 | Crystal Structure Of Raucaffricine Glucosidase From | 2e-43 | ||
| 4a3y_A | 540 | Crystal Structure Of Raucaffricine Glucosidase From | 7e-12 | ||
| 1cbg_A | 490 | The Crystal Structure Of A Cyanogenic Beta-Glucosid | 2e-43 | ||
| 1cbg_A | 490 | The Crystal Structure Of A Cyanogenic Beta-Glucosid | 1e-08 | ||
| 4atd_A | 513 | Crystal Structure Of Native Raucaffricine Glucosida | 3e-43 | ||
| 4atd_A | 513 | Crystal Structure Of Native Raucaffricine Glucosida | 7e-12 | ||
| 3u57_A | 513 | Structures Of Alkaloid Biosynthetic Glucosidases De | 3e-43 | ||
| 3u57_A | 513 | Structures Of Alkaloid Biosynthetic Glucosidases De | 8e-12 | ||
| 3ahx_A | 453 | Crystal Structure Of Beta-Glucosidase A From Bacter | 1e-41 | ||
| 3ptk_A | 505 | The Crystal Structure Of Rice (Oryza Sativa L.) Os4 | 7e-41 | ||
| 3ptk_A | 505 | The Crystal Structure Of Rice (Oryza Sativa L.) Os4 | 2e-11 | ||
| 3aiu_A | 564 | Crystal Structure Of Beta-Glucosidase In Rye Length | 8e-41 | ||
| 3aiu_A | 564 | Crystal Structure Of Beta-Glucosidase In Rye Length | 2e-10 | ||
| 3ais_A | 565 | Crystal Structure Of A Mutant Beta-Glucosidase In W | 9e-41 | ||
| 3ais_A | 565 | Crystal Structure Of A Mutant Beta-Glucosidase In W | 8e-10 | ||
| 2dga_A | 565 | Crystal Structure Of Hexameric Beta-Glucosidase In | 9e-41 | ||
| 2dga_A | 565 | Crystal Structure Of Hexameric Beta-Glucosidase In | 8e-10 | ||
| 1qox_A | 449 | Beta-Glucosidase From Bacillus Circulans Sp. Alkalo | 3e-40 | ||
| 1qox_A | 449 | Beta-Glucosidase From Bacillus Circulans Sp. Alkalo | 8e-04 | ||
| 2jf6_A | 532 | Structure Of Inactive Mutant Of Strictosidine Gluco | 3e-40 | ||
| 2jf6_A | 532 | Structure Of Inactive Mutant Of Strictosidine Gluco | 7e-09 | ||
| 1gnx_A | 479 | B-Glucosidase From Streptomyces Sp Length = 479 | 1e-39 | ||
| 1tr1_A | 447 | Crystal Structure Of E96k Mutated Beta-glucosidase | 1e-39 | ||
| 1e4i_A | 447 | 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE | 1e-39 | ||
| 1v03_A | 565 | Crystal Structure Of The Sorghum Bicolor Dhurrinase | 3e-39 | ||
| 1v03_A | 565 | Crystal Structure Of The Sorghum Bicolor Dhurrinase | 1e-09 | ||
| 1bga_A | 447 | Beta-Glucosidase A From Bacillus Polymyxa Length = | 3e-39 | ||
| 1bgg_A | 448 | Glucosidase A From Bacillus Polymyxa Complexed With | 3e-39 | ||
| 1uyq_A | 447 | Mutated B-Glucosidase A From Paenibacillus Polymyxa | 3e-39 | ||
| 3ta9_A | 458 | Beta-Glucosidase A From The Halothermophile H. Oren | 3e-39 | ||
| 1v02_E | 565 | Crystal Structure Of The Sorghum Bicolor Dhurrinase | 3e-39 | ||
| 1v02_E | 565 | Crystal Structure Of The Sorghum Bicolor Dhurrinase | 1e-09 | ||
| 1v02_A | 565 | Crystal Structure Of The Sorghum Bicolor Dhurrinase | 6e-39 | ||
| 1v02_A | 565 | Crystal Structure Of The Sorghum Bicolor Dhurrinase | 1e-09 | ||
| 1np2_A | 436 | Crystal Structure Of Thermostable Beta-Glycosidase | 2e-38 | ||
| 2e3z_A | 465 | Crystal Structure Of Intracellular Family 1 Beta- G | 1e-37 | ||
| 2e3z_A | 465 | Crystal Structure Of Intracellular Family 1 Beta- G | 1e-08 | ||
| 1hxj_A | 507 | Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos | 7e-37 | ||
| 1hxj_A | 507 | Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos | 8e-08 | ||
| 1e1e_A | 512 | Crystal Structure Of A Monocot (Maize Zmglu1) Beta- | 7e-37 | ||
| 1e1e_A | 512 | Crystal Structure Of A Monocot (Maize Zmglu1) Beta- | 8e-08 | ||
| 1h49_A | 512 | Crystal Structure Of The Inactive Double Mutant Of | 7e-37 | ||
| 1h49_A | 512 | Crystal Structure Of The Inactive Double Mutant Of | 8e-08 | ||
| 1e4l_A | 512 | Crystal Structure Of The Inactive Mutant Monocot (M | 7e-37 | ||
| 1e4l_A | 512 | Crystal Structure Of The Inactive Mutant Monocot (M | 8e-08 | ||
| 1od0_A | 468 | Family 1 B-Glucosidase From Thermotoga Maritima Len | 1e-36 | ||
| 1od0_A | 468 | Family 1 B-Glucosidase From Thermotoga Maritima Len | 2e-04 | ||
| 1ug6_A | 431 | Structure Of Beta-Glucosidase At Atomic Resolution | 2e-36 | ||
| 3zjk_A | 431 | Crystal Structure Of Ttb-gly F401s Mutant Length = | 2e-36 | ||
| 1wcg_A | 464 | Aphid Myrosinase Length = 464 | 6e-36 | ||
| 1wcg_A | 464 | Aphid Myrosinase Length = 464 | 3e-05 | ||
| 3vik_A | 487 | Crystal Structure Of Beta-Glucosidase From Termite | 1e-35 | ||
| 3vik_A | 487 | Crystal Structure Of Beta-Glucosidase From Termite | 1e-07 | ||
| 3ahz_A | 487 | Crystal Structure Of Beta-Glucosidase From Termite | 1e-35 | ||
| 3ahz_A | 487 | Crystal Structure Of Beta-Glucosidase From Termite | 1e-07 | ||
| 3vij_A | 487 | Crystal Structure Of Beta-Glucosidase From Termite | 1e-35 | ||
| 3vij_A | 487 | Crystal Structure Of Beta-Glucosidase From Termite | 1e-07 | ||
| 3ai0_A | 487 | Crystal Structure Of Beta-Glucosidase From Termite | 2e-35 | ||
| 3ai0_A | 487 | Crystal Structure Of Beta-Glucosidase From Termite | 1e-07 | ||
| 2e9l_A | 469 | Crystal Structure Of Human Cytosolic Neutral Beta-G | 3e-35 | ||
| 2e9l_A | 469 | Crystal Structure Of Human Cytosolic Neutral Beta-G | 1e-07 | ||
| 2zox_A | 469 | Crystal Structure Of The Covalent Intermediate Of H | 3e-35 | ||
| 2zox_A | 469 | Crystal Structure Of The Covalent Intermediate Of H | 1e-07 | ||
| 2jfe_X | 469 | The Crystal Structure Of Human Cytosolic Beta-Gluco | 3e-35 | ||
| 2jfe_X | 469 | The Crystal Structure Of Human Cytosolic Beta-Gluco | 2e-07 | ||
| 4gxp_A | 467 | Chimeric Family 1 Beta-Glucosidase Made With Non-Co | 4e-35 | ||
| 4gxp_A | 467 | Chimeric Family 1 Beta-Glucosidase Made With Non-Co | 2e-09 | ||
| 2o9p_A | 454 | Beta-Glucosidase B From Paenibacillus Polymyxa Leng | 2e-34 | ||
| 2jie_A | 454 | Beta-Glucosidase B From Bacillus Polymyxa Complexed | 2e-34 | ||
| 2o9r_A | 452 | Beta-Glucosidase B Complexed With Thiocellobiose Le | 2e-34 | ||
| 4hz6_A | 444 | Crystal Structure Of Bglb Length = 444 | 3e-34 | ||
| 3cmj_A | 465 | Crystal Structure Of Engineered Beta-Glucosidase Fr | 3e-34 | ||
| 3ahy_A | 473 | Crystal Structure Of Beta-Glucosidase 2 From Fungus | 4e-31 | ||
| 3ahy_A | 473 | Crystal Structure Of Beta-Glucosidase 2 From Fungus | 4e-09 | ||
| 1myr_A | 501 | Myrosinase From Sinapis Alba Length = 501 | 2e-28 | ||
| 1myr_A | 501 | Myrosinase From Sinapis Alba Length = 501 | 1e-12 | ||
| 1dwa_M | 499 | Study On Radiation Damage On A Cryocooled Crystal. | 4e-26 | ||
| 1dwa_M | 499 | Study On Radiation Damage On A Cryocooled Crystal. | 6e-14 | ||
| 1e6q_M | 501 | Myrosinase From Sinapis Alba With The Bound Transit | 4e-26 | ||
| 1e6q_M | 501 | Myrosinase From Sinapis Alba With The Bound Transit | 7e-14 | ||
| 4pbg_A | 468 | 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 | 9e-25 | ||
| 2pbg_A | 468 | 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 | 9e-25 | ||
| 1pbg_A | 468 | The Three-Dimensional Structure Of 6-Phospho-Beta G | 9e-25 | ||
| 4f79_A | 480 | The Crystal Structure Of 6-Phospho-Beta-Glucosidase | 4e-23 | ||
| 4f66_A | 480 | The Crystal Structure Of 6-Phospho-Beta-Glucosidase | 4e-23 | ||
| 2xhy_A | 479 | Crystal Structure Of E.Coli Bgla Length = 479 | 4e-23 | ||
| 3pn8_A | 480 | The Crystal Structure Of 6-Phospho-Beta-Glucosidase | 7e-23 | ||
| 3qom_A | 481 | Crystal Structure Of 6-Phospho-Beta-Glucosidase Fro | 2e-19 | ||
| 4b3k_A | 479 | Family 1 6-phospho-beta-d Glycosidase From Streptoc | 3e-19 | ||
| 1vff_A | 423 | Beta-Glycosidase From Pyrococcus Horikoshii Length | 6e-17 | ||
| 3apg_A | 473 | Crystal Structure Of Hyperthermophilic Beta-Glucosi | 2e-04 |
| >pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 | Back alignment and structure |
|
| >pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 | Back alignment and structure |
| >pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 | Back alignment and structure |
| >pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 | Back alignment and structure |
| >pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 | Back alignment and structure |
| >pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 | Back alignment and structure |
| >pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 | Back alignment and structure |
| >pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 | Back alignment and structure |
| >pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 | Back alignment and structure |
| >pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 | Back alignment and structure |
| >pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 | Back alignment and structure |
| >pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 | Back alignment and structure |
| >pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 | Back alignment and structure |
| >pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 | Back alignment and structure |
| >pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 | Back alignment and structure |
| >pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 | Back alignment and structure |
| >pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 | Back alignment and structure |
| >pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 | Back alignment and structure |
| >pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 | Back alignment and structure |
| >pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 | Back alignment and structure |
| >pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 | Back alignment and structure |
| >pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 | Back alignment and structure |
| >pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 | Back alignment and structure |
| >pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 | Back alignment and structure |
| >pdb|3AHX|A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans Length = 453 | Back alignment and structure |
| >pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 | Back alignment and structure |
| >pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 | Back alignment and structure |
| >pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 | Back alignment and structure |
| >pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 | Back alignment and structure |
| >pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 | Back alignment and structure |
| >pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 | Back alignment and structure |
| >pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 | Back alignment and structure |
| >pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 | Back alignment and structure |
| >pdb|1QOX|A Chain A, Beta-Glucosidase From Bacillus Circulans Sp. Alkalophilus Length = 449 | Back alignment and structure |
| >pdb|1QOX|A Chain A, Beta-Glucosidase From Bacillus Circulans Sp. Alkalophilus Length = 449 | Back alignment and structure |
| >pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 | Back alignment and structure |
| >pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 | Back alignment and structure |
| >pdb|1GNX|A Chain A, B-Glucosidase From Streptomyces Sp Length = 479 | Back alignment and structure |
| >pdb|1TR1|A Chain A, Crystal Structure Of E96k Mutated Beta-glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance Length = 447 | Back alignment and structure |
| >pdb|1E4I|A Chain A, 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE Complex Of The Beta-Glucosidase From Bacillus Polymyxa Length = 447 | Back alignment and structure |
| >pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 | Back alignment and structure |
| >pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 | Back alignment and structure |
| >pdb|1BGA|A Chain A, Beta-Glucosidase A From Bacillus Polymyxa Length = 447 | Back alignment and structure |
| >pdb|1BGG|A Chain A, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate Length = 448 | Back alignment and structure |
| >pdb|1UYQ|A Chain A, Mutated B-Glucosidase A From Paenibacillus Polymyxa Showing Increased Stability Length = 447 | Back alignment and structure |
| >pdb|3TA9|A Chain A, Beta-Glucosidase A From The Halothermophile H. Orenii Length = 458 | Back alignment and structure |
| >pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 | Back alignment and structure |
| >pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 | Back alignment and structure |
| >pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 | Back alignment and structure |
| >pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 | Back alignment and structure |
| >pdb|1NP2|A Chain A, Crystal Structure Of Thermostable Beta-Glycosidase From Thermophilic Eubacterium Thermus Nonproteolyticus Hg102 Length = 436 | Back alignment and structure |
| >pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 | Back alignment and structure |
| >pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 | Back alignment and structure |
| >pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 | Back alignment and structure |
| >pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 | Back alignment and structure |
| >pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 | Back alignment and structure |
| >pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 | Back alignment and structure |
| >pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 | Back alignment and structure |
| >pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 | Back alignment and structure |
| >pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 | Back alignment and structure |
| >pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 | Back alignment and structure |
| >pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 | Back alignment and structure |
| >pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 | Back alignment and structure |
| >pdb|1UG6|A Chain A, Structure Of Beta-Glucosidase At Atomic Resolution From Thermus Thermophilus Hb8 Length = 431 | Back alignment and structure |
| >pdb|3ZJK|A Chain A, Crystal Structure Of Ttb-gly F401s Mutant Length = 431 | Back alignment and structure |
| >pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 | Back alignment and structure |
| >pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 | Back alignment and structure |
| >pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 | Back alignment and structure |
| >pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 | Back alignment and structure |
| >pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 | Back alignment and structure |
| >pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 | Back alignment and structure |
| >pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 | Back alignment and structure |
| >pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 | Back alignment and structure |
| >pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 | Back alignment and structure |
| >pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 | Back alignment and structure |
| >pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 | Back alignment and structure |
| >pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 | Back alignment and structure |
| >pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 | Back alignment and structure |
| >pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 | Back alignment and structure |
| >pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 | Back alignment and structure |
| >pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 | Back alignment and structure |
| >pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 | Back alignment and structure |
| >pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 | Back alignment and structure |
| >pdb|2O9P|A Chain A, Beta-Glucosidase B From Paenibacillus Polymyxa Length = 454 | Back alignment and structure |
| >pdb|2JIE|A Chain A, Beta-Glucosidase B From Bacillus Polymyxa Complexed With 2- F-Glucose Length = 454 | Back alignment and structure |
| >pdb|2O9R|A Chain A, Beta-Glucosidase B Complexed With Thiocellobiose Length = 452 | Back alignment and structure |
| >pdb|4HZ6|A Chain A, Crystal Structure Of Bglb Length = 444 | Back alignment and structure |
| >pdb|3CMJ|A Chain A, Crystal Structure Of Engineered Beta-Glucosidase From Soil Metagenome Length = 465 | Back alignment and structure |
| >pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 | Back alignment and structure |
| >pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 | Back alignment and structure |
| >pdb|1MYR|A Chain A, Myrosinase From Sinapis Alba Length = 501 | Back alignment and structure |
| >pdb|1MYR|A Chain A, Myrosinase From Sinapis Alba Length = 501 | Back alignment and structure |
| >pdb|1DWA|M Chain M, Study On Radiation Damage On A Cryocooled Crystal. Part 1: Structure Prior To Irradiation Length = 499 | Back alignment and structure |
| >pdb|1DWA|M Chain M, Study On Radiation Damage On A Cryocooled Crystal. Part 1: Structure Prior To Irradiation Length = 499 | Back alignment and structure |
| >pdb|1E6Q|M Chain M, Myrosinase From Sinapis Alba With The Bound Transition State Analogue Gluco-Tetrazole Length = 501 | Back alignment and structure |
| >pdb|1E6Q|M Chain M, Myrosinase From Sinapis Alba With The Bound Transition State Analogue Gluco-Tetrazole Length = 501 | Back alignment and structure |
| >pdb|4PBG|A Chain A, 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 | Back alignment and structure |
| >pdb|2PBG|A Chain A, 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 | Back alignment and structure |
| >pdb|1PBG|A Chain A, The Three-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis Length = 468 | Back alignment and structure |
| >pdb|4F79|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase Mutant (E375q) In Complex With Salicin 6-Phosphate Length = 480 | Back alignment and structure |
| >pdb|4F66|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 In Complex With Beta-D-Glucose-6-Phosphate. Length = 480 | Back alignment and structure |
| >pdb|2XHY|A Chain A, Crystal Structure Of E.Coli Bgla Length = 479 | Back alignment and structure |
| >pdb|3PN8|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 Length = 480 | Back alignment and structure |
| >pdb|3QOM|A Chain A, Crystal Structure Of 6-Phospho-Beta-Glucosidase From Lactobacillus Plantarum Length = 481 | Back alignment and structure |
| >pdb|4B3K|A Chain A, Family 1 6-phospho-beta-d Glycosidase From Streptococcus Pyogenes Length = 479 | Back alignment and structure |
| >pdb|1VFF|A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii Length = 423 | Back alignment and structure |
| >pdb|3APG|A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus Length = 473 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 | Back alignment and structure |
|---|
Score = 302 bits (776), Expect = 2e-97
Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
Query: 252 ASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHA-GNVLG--NG 308
+ + T+ FP GF+FG+ ++AYQ EGA EDGR +IWDTFAH G + N
Sbjct: 3 TMAQQSGGGLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNA 62
Query: 309 DIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISY 368
D+A D+YH+++ED++LMA G+DAYRFSI+WSR+ PNG G VN G+ +YN LI+ L++
Sbjct: 63 DVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAK 122
Query: 369 GIQPHVTLHHSDLPQALEDEYGGWINRMIV 398
GIQP+VTL+H DLPQALED+Y GW++R IV
Sbjct: 123 GIQPYVTLYHWDLPQALEDKYKGWLDRQIV 152
|
| >3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 | Back alignment and structure |
|---|
| >3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 | Back alignment and structure |
|---|
| >3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 | Back alignment and structure |
|---|
| >2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 | Back alignment and structure |
|---|
| >2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 | Back alignment and structure |
|---|
| >3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 | Back alignment and structure |
|---|
| >3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 | Back alignment and structure |
|---|
| >2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 | Back alignment and structure |
|---|
| >2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 | Back alignment and structure |
|---|
| >1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 | Back alignment and structure |
|---|
| >1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 | Back alignment and structure |
|---|
| >1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 | Back alignment and structure |
|---|
| >1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 | Back alignment and structure |
|---|
| >4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 | Back alignment and structure |
|---|
| >4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 | Back alignment and structure |
|---|
| >2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 | Back alignment and structure |
|---|
| >2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 | Back alignment and structure |
|---|
| >1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 | Back alignment and structure |
|---|
| >1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 | Back alignment and structure |
|---|
| >3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 | Back alignment and structure |
|---|
| >3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 | Back alignment and structure |
|---|
| >1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 | Back alignment and structure |
|---|
| >1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 | Back alignment and structure |
|---|
| >1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 | Back alignment and structure |
|---|
| >1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 | Back alignment and structure |
|---|
| >2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 | Back alignment and structure |
|---|
| >2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 | Back alignment and structure |
|---|
| >3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 | Back alignment and structure |
|---|
| >3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 | Back alignment and structure |
|---|
| >3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 | Back alignment and structure |
|---|
| >3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 | Back alignment and structure |
|---|
| >1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 | Back alignment and structure |
|---|
| >1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 | Back alignment and structure |
|---|
| >1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 | Back alignment and structure |
|---|
| >1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 | Back alignment and structure |
|---|
| >1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 | Back alignment and structure |
|---|
| >1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 | Back alignment and structure |
|---|
| >1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 | Back alignment and structure |
|---|
| >1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 | Back alignment and structure |
|---|
| >4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 | Back alignment and structure |
|---|
| >4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 | Back alignment and structure |
|---|
| >1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 | Back alignment and structure |
|---|
| >1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 | Back alignment and structure |
|---|
| >3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 | Back alignment and structure |
|---|
| >3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 | Back alignment and structure |
|---|
| >2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 | Back alignment and structure |
|---|
| >3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Length = 399 | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 532 | |||
| 4a3y_A | 540 | Raucaffricine-O-beta-D-glucosidase; hydrolase, alk | 100.0 | |
| 3ptm_A | 505 | Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly | 100.0 | |
| 3ta9_A | 458 | Glycoside hydrolase family 1; TIM barrel, glucosid | 100.0 | |
| 3gnp_A | 488 | OS03G0212800 protein; beta-alpha barrel, glycosida | 100.0 | |
| 3f5l_A | 481 | Beta-glucosidase; beta-alpha-barrels, glycosidase, | 100.0 | |
| 4atd_A | 513 | Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr | 100.0 | |
| 3vii_A | 487 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 100.0 | |
| 4dde_A | 480 | 6-phospho-beta-glucosidase; structural genomics, P | 100.0 | |
| 3qom_A | 481 | 6-phospho-beta-glucosidase; structural genomics, P | 100.0 | |
| 4hz8_A | 444 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba | 100.0 | |
| 4b3l_A | 479 | Beta-glucosidase; hydrolase, glycosidase, carbohyd | 100.0 | |
| 1gnx_A | 479 | Beta-glucosidase; hydrolase, glycosyltransferase, | 100.0 | |
| 1v08_A | 512 | Beta-glucosidase; glycoside hydrolase, dimboa-gluc | 100.0 | |
| 2e3z_A | 465 | Beta-glucosidase; TIM barrel, glycoside hydrolase | 100.0 | |
| 1cbg_A | 490 | Cyanogenic beta-glucosidase; hydrolase (O-glycosyl | 100.0 | |
| 1v02_A | 565 | Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri | 100.0 | |
| 2dga_A | 565 | Beta-glucosidase; alpha/beta barrel, hydrolase; 1. | 100.0 | |
| 2jf7_A | 532 | Strictosidine-O-beta-D-glucosidase; alkaloid, hydr | 100.0 | |
| 1qox_A | 449 | Beta-glucosidase; hydrolase, cellulose degradation | 100.0 | |
| 1uwi_A | 489 | Beta-galactosidase; hydrolase, beta-glycosidase, g | 100.0 | |
| 1e4i_A | 447 | Beta-glucosidase; hydrolase, family 1 glycosyl hyd | 100.0 | |
| 3ahx_A | 453 | Beta-glucosidase A; cellulases, glycosyl hydrolase | 100.0 | |
| 1wcg_A | 464 | Thioglucosidase, myrosinase; aphid, beta-glucosida | 100.0 | |
| 3ahy_A | 473 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 100.0 | |
| 3fj0_A | 465 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase | 100.0 | |
| 2e9l_A | 469 | Cytosolic beta-glucosidase; novel cytosolic neutra | 100.0 | |
| 2o9p_A | 454 | Beta-glucosidase B; family 1 glycoside hydrolase; | 100.0 | |
| 1e4m_M | 501 | Myrosinase MA1; hydrolase, family 1 glycosyl hydro | 100.0 | |
| 1pbg_A | 468 | PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g | 100.0 | |
| 1ug6_A | 431 | Beta-glycosidase; glucosidase, atomic resolution, | 100.0 | |
| 4ha4_A | 489 | Beta-galactosidase; TIM barrel, beta-glycosidase, | 100.0 | |
| 2j78_A | 468 | Beta-glucosidase A; family 1, hydrolase, inhibitor | 100.0 | |
| 2xhy_A | 479 | BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, | 100.0 | |
| 1qvb_A | 481 | Beta-glycosidase; TIM-barrel, thermostable, hydrol | 100.0 | |
| 3apg_A | 473 | Beta-glucosidase; TIM barrel, hydrolase, sugar bin | 100.0 | |
| 1vff_A | 423 | Beta-glucosidase; glycosyl hydrolase, membrane-bou | 100.0 | |
| 1fob_A | 334 | Beta-1,4-galactanase; B/A barrel, glycosyl hydrola | 99.43 | |
| 1uhv_A | 500 | Beta-xylosidase; family 39 glycoside hydrolase, xy | 99.4 | |
| 3icg_A | 515 | Endoglucanase D; cellulase, xylanase, carbohydrate | 99.22 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 99.22 | |
| 1w91_A | 503 | Beta-xylosidase; MAD, seMet, tetramer, hydrolase; | 99.21 | |
| 3tty_A | 675 | Beta-GAL, beta-galactosidase; TIM barrel, glycosid | 99.02 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 98.99 | |
| 3l55_A | 353 | B-1,4-endoglucanase/cellulase; putative beta-1,4-e | 98.93 | |
| 1h1n_A | 305 | Endo type cellulase ENGI; hydrolase, glycosyl hydr | 98.92 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 98.81 | |
| 1kwg_A | 645 | Beta-galactosidase; TIM barrel, glycoside hydrolas | 98.73 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 98.7 | |
| 1nq6_A | 302 | XYS1; glycoside hydrolase family 10, xylanase, xyl | 98.69 | |
| 3ndz_A | 345 | Endoglucanase D; cellotriose, xylanase, carbohydra | 98.69 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 98.68 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 98.65 | |
| 3qr3_A | 340 | Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A | 98.57 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 98.54 | |
| 1edg_A | 380 | Endoglucanase A; family A, cellulases, xylanases, | 98.5 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 98.47 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 98.42 | |
| 1hjs_A | 332 | Beta-1,4-galactanase; 4-galactanases, family 53 gl | 98.41 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 98.31 | |
| 3d3a_A | 612 | Beta-galactosidase; protein structure initiative I | 98.19 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 98.14 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 98.07 | |
| 3qho_A | 458 | Endoglucanase, 458AA long hypothetical endo-1,4-be | 98.06 | |
| 3cui_A | 315 | EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine | 98.03 | |
| 1uuq_A | 440 | Mannosyl-oligosaccharide glucosidase; hydrolase, m | 97.81 | |
| 4ekj_A | 500 | Beta-xylosidase; TIM-barrel fold, hemicellulase, h | 97.69 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 97.61 | |
| 3pzg_A | 383 | Mannan endo-1,4-beta-mannosidase. glycosyl hydrol | 97.51 | |
| 1ur4_A | 399 | Galactanase; hydrolase, beta-1, glycoside hydrolas | 97.49 | |
| 1egz_A | 291 | Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL | 97.39 | |
| 1tvn_A | 293 | Cellulase, endoglucanase G; glycoside hydrolase, C | 97.34 | |
| 3civ_A | 343 | Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. | 97.31 | |
| 2c0h_A | 353 | Mannan endo-1,4-beta-mannosidase; hydrolase, signa | 97.26 | |
| 3niy_A | 341 | Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 | 97.24 | |
| 3hn3_A | 613 | Beta-G1, beta-glucuronidase; lysosomal enzyme, aci | 97.22 | |
| 1xyz_A | 347 | 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola | 97.18 | |
| 1qnr_A | 344 | Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt | 97.16 | |
| 4hty_A | 359 | Cellulase; (alpha/beta)8 barrel, family 5 endogluc | 97.09 | |
| 1g01_A | 364 | Endoglucanase; alpha/beta barrel, TIM barrel, hydr | 97.07 | |
| 4e8d_A | 595 | Glycosyl hydrolase, family 35; TIM barrel, beta-pr | 97.0 | |
| 3thd_A | 654 | Beta-galactosidase; TIM-barrel domain, glycosyl hy | 96.94 | |
| 3u7v_A | 552 | Beta-galactosidase; structural genomics, PSI-biolo | 96.71 | |
| 1tg7_A | 971 | Beta-galactosidase; TIM barrel domain, glycoside h | 96.69 | |
| 2cks_A | 306 | Endoglucanase E-5; carbohydrate metabolism, polysa | 96.54 | |
| 3vup_A | 351 | Beta-1,4-mannanase; TIM barrel, digestive fluid, H | 96.51 | |
| 2whl_A | 294 | Beta-mannanase, baman5; glycoside hydrolase, hydro | 96.51 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 96.47 | |
| 3og2_A | 1003 | Beta-galactosidase; TIM barrel domain, glycoside h | 96.33 | |
| 7a3h_A | 303 | Endoglucanase; hydrolase, cellulose degradation, g | 96.31 | |
| 3cmg_A | 667 | Putative beta-galactosidase; structural genomics, | 96.25 | |
| 2y8k_A | 491 | Arabinoxylanase, carbohydrate binding family 6; hy | 96.2 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 96.09 | |
| 3fn9_A | 692 | Putative beta-galactosidase; structural genomics, | 96.09 | |
| 1ur1_A | 378 | Endoxylanase; hydrolase, family 10, glycoside hydr | 96.05 | |
| 1ta3_B | 303 | Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), | 95.95 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 95.87 | |
| 2dep_A | 356 | Xylanase B, thermostable celloxylanase; glycosidas | 95.76 | |
| 1bqc_A | 302 | Protein (beta-mannanase); glycosyl hydrolase, fami | 95.76 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 95.76 | |
| 3pzt_A | 327 | Endoglucanase; alpha/beta barrel, glycosyl hydrola | 95.71 | |
| 1r85_A | 379 | Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A | 95.69 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 95.62 | |
| 1wky_A | 464 | Endo-beta-1,4-mannanase; TIM barrel, catalytic dom | 95.55 | |
| 3jug_A | 345 | Beta-mannanase; TIM-barrel, glycosidase, hydrolase | 95.54 | |
| 1n82_A | 331 | Xylanase, intra-cellular xylanase; hydrolase; 1.45 | 95.52 | |
| 1i1w_A | 303 | Endo-1,4-beta-xylanase; xylan degradation, hydrola | 95.52 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 95.51 | |
| 3lpf_A | 605 | Beta-glucuronidase; alpha/beta barrel, sugar-bindi | 95.44 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 95.31 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 95.27 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 95.16 | |
| 1v0l_A | 313 | Endo-1,4-beta-xylanase A; glycoside hydrolase fami | 94.91 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 94.73 | |
| 1us2_A | 530 | Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca | 94.71 | |
| 2uwf_A | 356 | Endoxylanase, alkaline active endoxylanase; hydrol | 94.59 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 94.58 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 94.36 | |
| 3gm8_A | 801 | Glycoside hydrolase family 2, candidate beta-GLYC; | 94.34 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 94.27 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 94.22 | |
| 3emz_A | 331 | Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba | 94.13 | |
| 1w32_A | 348 | Endo-1,4-beta-xylanase A precursor; mutant, calciu | 94.08 | |
| 1fa2_A | 498 | Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 | 94.05 | |
| 1wdp_A | 495 | Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 | 93.62 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 93.27 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 93.25 | |
| 2xfr_A | 535 | Beta-amylase; hydrolase, carbohydrate metabolism, | 93.14 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 93.08 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 93.03 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 92.85 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 92.54 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 92.19 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 92.06 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 91.92 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 91.89 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 91.87 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 91.63 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 91.59 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 91.59 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 91.55 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 91.51 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 91.4 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 91.39 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 91.19 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 91.13 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 91.11 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 90.98 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 90.95 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 90.79 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 90.78 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 90.63 | |
| 4awe_A | 387 | Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana | 90.6 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 90.32 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 90.24 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 90.13 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 89.96 | |
| 2w61_A | 555 | GAS2P, glycolipid-anchored surface protein 2; glyc | 89.79 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 89.64 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 89.62 | |
| 3u7b_A | 327 | Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET | 89.56 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 89.44 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 89.37 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 89.35 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 89.32 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 89.26 | |
| 4f8x_A | 335 | Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET | 89.0 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 89.0 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 88.49 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 88.11 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 88.0 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 87.78 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 86.94 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 86.23 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 86.09 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 85.71 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 85.69 | |
| 3ro8_A | 341 | Endo-1,4-beta-xylanase; glycosyl hydrolase family | 85.33 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 85.07 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 85.04 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 85.02 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 84.51 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 84.28 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 83.87 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 83.65 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 83.59 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 83.36 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 82.53 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 82.47 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 82.3 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 82.28 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 82.04 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 81.76 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 81.59 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 81.4 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 80.89 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 80.81 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 80.68 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 80.24 |
| >4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-74 Score=627.71 Aligned_cols=255 Identities=46% Similarity=0.848 Sum_probs=217.4
Q ss_pred cccCcCCCCCCcEEeeeechhhhcCccCCCCCCCccceeccccCc--c--CCCCccCCccccccHHHHHHHHHcCCCEEE
Q 009558 259 VEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGN--V--LGNGDIACDEYHKYKEDVKLMAKTGLDAYR 334 (532)
Q Consensus 259 ~~~~~~~FP~dFlwG~ATSA~QvEGa~~~dGkg~SiWD~~~~~~~--~--g~~~dva~D~YhrYkEDI~Lm~elGv~ayR 334 (532)
..+++..||+||+||+|||||||||++++||||+|+||.|+|..+ . +.++++||||||||+|||+||++||+++||
T Consensus 15 ~~~sr~~FP~~FlwG~AtaA~QiEGa~~~dGkg~SiwD~~~~~~p~~~~~~~~gdvA~D~Yhry~EDi~Lm~elG~~~yR 94 (540)
T 4a3y_A 15 TRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYR 94 (540)
T ss_dssp GGCCGGGSCTTCEEEEECCHHHHCCCTTSTTCCCBHHHHHHHHCGGGSGGGCCTTTTTCHHHHHHHHHHHHHHHTCSEEE
T ss_pred CccccccCCCCCeEeeechHhhhcCCcCCCCCcccHHHhhhccCCCcccCCCCCCcccchhHhhHHHHHHHHHcCCCEEE
Confidence 456778899999999999999999999999999999999997532 2 788999999999999999999999999999
Q ss_pred ecccccccccCC--CCCCChhHHHHHHHHHHHHHHCCCeeEEEeccCCcchhHHhhhCCccccceE--------------
Q 009558 335 FSISWSRLIPNG--RGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIV-------------- 398 (532)
Q Consensus 335 FSIsWsRI~P~G--~G~vN~~Gi~~Y~~lId~L~~~GIePiVTL~HfdlP~~L~d~~GGW~n~~~v-------------- 398 (532)
|||+||||+|+| +|++|++|++||+++||+|+++||+|+|||||||+|+||+++||||+|++++
T Consensus 95 fSIsWsRI~P~G~~~g~~N~~Gl~fY~~lid~l~~~GIeP~VTL~H~dlP~~L~~~yGGW~nr~~v~~F~~Ya~~~f~~f 174 (540)
T 4a3y_A 95 FSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEF 174 (540)
T ss_dssp EECCHHHHSTTSSGGGCCCHHHHHHHHHHHHHHHHTTCEEEEEEESSCCBHHHHHHHCGGGSTHHHHHHHHHHHHHHHHH
T ss_pred eeccHhhcccCCCCCCCCCHHHHHHHHHHHHHHHHcCCccceeccCCCCcHHHHhccCCcCChHHHHHHHHHHHHHHHHh
Confidence 999999999999 4899999999999999999999999999999999999999999999999876
Q ss_pred --------------------------------------------------------------------------------
Q 009558 399 -------------------------------------------------------------------------------- 398 (532)
Q Consensus 399 -------------------------------------------------------------------------------- 398 (532)
T Consensus 175 gdrVk~W~T~NEP~~~~~~gy~~G~~aPg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~a~hh~llAha~Av 254 (540)
T 4a3y_A 175 GDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRTSPEHVNHPTVQHRCSTVAPQCICSTGNPGTEPYWVTHHLLLAHAAAV 254 (540)
T ss_dssp TTTCCEEEEEECHHHHHHHHHTSCCSTTCCCCC-------------------------CCTTTHHHHHHHHHHHHHHHHH
T ss_pred ccccCEeeEccccHHhhhhhhhhcCCCCCccccchhhhcchhhhhhhhhhhhccccccccchHHHHHHHHHHHHHhHHHH
Confidence
Q ss_pred ------------------------------------------------EecccccCCCcchhhcccCCCCCCCChhHHhh
Q 009558 399 ------------------------------------------------VANPLVYGDYPKIMKQNAGSRLPAFTDHESQQ 430 (532)
Q Consensus 399 ------------------------------------------------FlDPi~~GdYP~~m~e~lGsrLP~FT~eE~el 430 (532)
|+||++.|+||+.|++.+++++|.|+++|+++
T Consensus 255 ~~~r~~~~~~~~g~IGi~~~~~~~~P~~~~~~~~~~aa~~~~~~~~~~f~dp~~~G~YP~~~~~~~~~~l~~~~~~d~~l 334 (540)
T 4a3y_A 255 ELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKM 334 (540)
T ss_dssp HHHHHHTHHHHCCEEEEEEEEEEEEESSTTCHHHHHHHHHHHHHHTHHHHHHHHHSSCCHHHHHHHGGGSCCCCHHHHHH
T ss_pred HHHHHhccccccceEEEEecccccccCCCCcHhHHHHHHHHHHHHhcccchHHhcCCCcHHHHHHhhccCCcCCHHHHHh
Confidence 66777778888888888888999999999999
Q ss_pred hcCCCceeeeecccceeeecCCCCcccC-CCCCCCCcccc-------ccccCCCCCC--CCCchHHHHHHHHHHHHcCCC
Q 009558 431 IKGSADFIGVINYYTVYIKDNPSSLKQK-HRDWSADTATK-------FFFKQDTAAS--SNEPSSLQIVLEYFKQVYGNP 500 (532)
Q Consensus 431 IkgslDFLGINYYTs~~Vka~~~~~~~~-~~~~~~D~~v~-------~~~~~~t~~G--eIyP~GLr~iL~~Ik~rYgn~ 500 (532)
|++++||||||||++.+|++........ ......+.... .+..+.+.++ +|||+|||.+|+++++||++|
T Consensus 335 i~~~~DFiGinyY~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~t~~~W~~I~P~GL~~~L~~l~~rY~~P 414 (540)
T 4a3y_A 335 LKGSYDFVGLNYYTASYVTNASTNSSGSNNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVP 414 (540)
T ss_dssp HTTCCSEEEEEEEEEEEEEECC-------CCCHHHHTCEEEECEETTEESSCBCSSTTCBCCTHHHHHHHHHHHHHHCCS
T ss_pred hcCCCCeeEEecccceEEecCccCcccccccccccccccccccccCCCcCCCccCCCCceECHHHHHHHHHHHHHhcCCC
Confidence 9999999999999999998754322110 00000011000 1223445555 899999999999999999988
Q ss_pred CEEEEeCCCCCCC
Q 009558 501 PIYIHENGSLSLS 513 (532)
Q Consensus 501 PIyITENGig~~d 513 (532)
||||||||++..+
T Consensus 415 ~I~ItENG~~~~~ 427 (540)
T 4a3y_A 415 LIYVTENGVDDVK 427 (540)
T ss_dssp CEEEEEECCCCCC
T ss_pred cEEEeCCCCCccc
Confidence 8999999998643
|
| >3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* | Back alignment and structure |
|---|
| >3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} | Back alignment and structure |
|---|
| >3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* | Back alignment and structure |
|---|
| >3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* | Back alignment and structure |
|---|
| >4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* | Back alignment and structure |
|---|
| >3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* | Back alignment and structure |
|---|
| >3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A | Back alignment and structure |
|---|
| >4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* | Back alignment and structure |
|---|
| >4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A | Back alignment and structure |
|---|
| >1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A | Back alignment and structure |
|---|
| >1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A | Back alignment and structure |
|---|
| >2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* | Back alignment and structure |
|---|
| >1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* | Back alignment and structure |
|---|
| >2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* | Back alignment and structure |
|---|
| >2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A | Back alignment and structure |
|---|
| >1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} | Back alignment and structure |
|---|
| >1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} | Back alignment and structure |
|---|
| >2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* | Back alignment and structure |
|---|
| >1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* | Back alignment and structure |
|---|
| >1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* | Back alignment and structure |
|---|
| >1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A | Back alignment and structure |
|---|
| >4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... | Back alignment and structure |
|---|
| >2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A | Back alignment and structure |
|---|
| >1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* | Back alignment and structure |
|---|
| >3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* | Back alignment and structure |
|---|
| >1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* | Back alignment and structure |
|---|
| >1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* | Back alignment and structure |
|---|
| >3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A | Back alignment and structure |
|---|
| >3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* | Back alignment and structure |
|---|
| >3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* | Back alignment and structure |
|---|
| >1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* | Back alignment and structure |
|---|
| >4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* | Back alignment and structure |
|---|
| >1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* | Back alignment and structure |
|---|
| >1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* | Back alignment and structure |
|---|
| >3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A | Back alignment and structure |
|---|
| >3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* | Back alignment and structure |
|---|
| >1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* | Back alignment and structure |
|---|
| >4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* | Back alignment and structure |
|---|
| >1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* | Back alignment and structure |
|---|
| >4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A | Back alignment and structure |
|---|
| >3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* | Back alignment and structure |
|---|
| >3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* | Back alignment and structure |
|---|
| >2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* | Back alignment and structure |
|---|
| >3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} | Back alignment and structure |
|---|
| >2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* | Back alignment and structure |
|---|
| >7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A | Back alignment and structure |
|---|
| >3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* | Back alignment and structure |
|---|
| >1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} | Back alignment and structure |
|---|
| >1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A | Back alignment and structure |
|---|
| >1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 | Back alignment and structure |
|---|
| >3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} | Back alignment and structure |
|---|
| >1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A | Back alignment and structure |
|---|
| >1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A | Back alignment and structure |
|---|
| >2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* | Back alignment and structure |
|---|
| >1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A | Back alignment and structure |
|---|
| >1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 | Back alignment and structure |
|---|
| >1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 532 | ||||
| d1cbga_ | 490 | c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { | 8e-60 | |
| d1cbga_ | 490 | c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { | 8e-13 | |
| d1v02a_ | 484 | c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { | 1e-58 | |
| d1v02a_ | 484 | c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { | 2e-11 | |
| d1qoxa_ | 449 | c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan | 2e-58 | |
| d1qoxa_ | 449 | c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan | 6e-07 | |
| d1gnxa_ | 464 | c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. | 6e-58 | |
| d1gnxa_ | 464 | c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. | 4e-08 | |
| d1uwsa_ | 489 | c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus | 2e-57 | |
| d1e4mm_ | 499 | c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { | 4e-57 | |
| d1e4mm_ | 499 | c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { | 7e-14 | |
| d2j78a1 | 443 | c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m | 4e-57 | |
| d2j78a1 | 443 | c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m | 4e-08 | |
| d1e4ia_ | 447 | c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa | 5e-57 | |
| d1e4ia_ | 447 | c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa | 4e-05 | |
| d1wcga1 | 462 | c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( | 1e-56 | |
| d1wcga1 | 462 | c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( | 5e-10 | |
| d1pbga_ | 468 | c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL | 1e-55 | |
| d1pbga_ | 468 | c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL | 8e-06 | |
| d1qvba_ | 481 | c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha | 4e-55 | |
| d1qvba_ | 481 | c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha | 1e-04 | |
| d1ug6a_ | 426 | c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi | 9e-54 | |
| d1vffa1 | 423 | c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr | 2e-43 | |
| d1vffa1 | 423 | c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr | 0.004 | |
| d1kwga2 | 393 | c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t | 1e-12 | |
| d1edga_ | 380 | c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu | 1e-08 | |
| d1ceoa_ | 340 | c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm | 6e-08 | |
| d2pb1a1 | 394 | c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast | 1e-07 | |
| d1vjza_ | 325 | c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm | 4e-07 | |
| d1uuqa_ | 410 | c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta | 2e-06 | |
| d1h4pa_ | 408 | c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea | 2e-04 |
| >d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Family 1 of glycosyl hydrolase domain: Plant beta-glucosidase (myrosinase) species: Creeping white clover (Trifolium repens) [TaxId: 3899]
Score = 203 bits (517), Expect = 8e-60
Identities = 86/171 (50%), Positives = 118/171 (69%), Gaps = 10/171 (5%)
Query: 260 EYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHA--GNVLG--NGDIACDEY 315
+ ++ F PGF+FG+ +SA+Q EGAA EDG+ PSIWDTF H + NGD+A DEY
Sbjct: 13 DLNRSCFAPGFVFGTASSAFQYEGAAFEDGKGPSIWDTFTHKYPEKIKDRTNGDVAIDEY 72
Query: 316 HKYKEDVKLMAKTGLDAYRFSISWSRLIPNGR--GPVNPKGLQYYNNLINELISYGIQPH 373
H+YKED+ +M LDAYRFSISW R++P G+ G VN +G+ YYNNLINE+++ G+QP+
Sbjct: 73 HRYKEDIGIMKDMNLDAYRFSISWPRVLPKGKLSGGVNREGINYYNNLINEVLANGMQPY 132
Query: 374 VTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFT 424
VTL H D+PQALEDEY G++ R IV + DY ++ + G R+ +
Sbjct: 133 VTLFHWDVPQALEDEYRGFLGRNIVDD----FRDYAELCFKEFGDRVKHWI 179
|
| >d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 | Back information, alignment and structure |
|---|
| >d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 | Back information, alignment and structure |
|---|
| >d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 | Back information, alignment and structure |
|---|
| >d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 | Back information, alignment and structure |
|---|
| >d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 | Back information, alignment and structure |
|---|
| >d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 | Back information, alignment and structure |
|---|
| >d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 | Back information, alignment and structure |
|---|
| >d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 | Back information, alignment and structure |
|---|
| >d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 | Back information, alignment and structure |
|---|
| >d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 | Back information, alignment and structure |
|---|
| >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 | Back information, alignment and structure |
|---|
| >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 | Back information, alignment and structure |
|---|
| >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 | Back information, alignment and structure |
|---|
| >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 | Back information, alignment and structure |
|---|
| >d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 | Back information, alignment and structure |
|---|
| >d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 | Back information, alignment and structure |
|---|
| >d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 | Back information, alignment and structure |
|---|
| >d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 | Back information, alignment and structure |
|---|
| >d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 | Back information, alignment and structure |
|---|
| >d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 | Back information, alignment and structure |
|---|
| >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 | Back information, alignment and structure |
|---|
| >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 | Back information, alignment and structure |
|---|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 532 | |||
| d1v02a_ | 484 | Plant beta-glucosidase (myrosinase) {Sorghum bicol | 100.0 | |
| d1qoxa_ | 449 | Beta-glucosidase A {Bacillus circulans, subsp. alk | 100.0 | |
| d1gnxa_ | 464 | Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] | 100.0 | |
| d1wcga1 | 462 | Thioglucosidase {Cabbage aphid (Brevicoryne brassi | 100.0 | |
| d1cbga_ | 490 | Plant beta-glucosidase (myrosinase) {Creeping whit | 100.0 | |
| d2j78a1 | 443 | Beta-glucosidase A {Thermotoga maritima [TaxId: 23 | 100.0 | |
| d1e4mm_ | 499 | Plant beta-glucosidase (myrosinase) {White mustard | 100.0 | |
| d1e4ia_ | 447 | Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 | 100.0 | |
| d1pbga_ | 468 | 6-phospho-beta-D-galactosidase, PGAL {Lactococcus | 100.0 | |
| d1ug6a_ | 426 | Beta-glucosidase A {Thermus thermophilus [TaxId: 2 | 100.0 | |
| d1uwsa_ | 489 | beta-Glycosidase {Archaeon Sulfolobus solfataricus | 100.0 | |
| d1qvba_ | 481 | beta-Glycosidase {Archaeon Thermosphaera aggregans | 100.0 | |
| d1vffa1 | 423 | Beta-glucosidase A {Archaeon Pyrococcus horikoshii | 100.0 | |
| d1kwga2 | 393 | A4 beta-galactosidase {Thermus thermophilus [TaxId | 99.82 | |
| d1uuqa_ | 410 | Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | 99.32 | |
| d1edga_ | 380 | Endoglucanase CelA {Clostridium cellulolyticum [Ta | 99.1 | |
| d1rh9a1 | 370 | Beta-mannanase {Tomato (Lycopersicon esculentum) [ | 98.46 | |
| d1vjza_ | 325 | Endoglucanase homologue TM1752 {Thermotoga maritim | 98.42 | |
| d1ceoa_ | 340 | Endoglucanase CelC {Clostridium thermocellum [TaxI | 98.39 | |
| d1tg7a5 | 354 | Beta-galactosidase LacA, N-terminal domain {Penici | 98.19 | |
| d1h1na_ | 305 | Endocellulase EngI {Thermoascus aurantiacus [TaxId | 97.89 | |
| d1qnra_ | 344 | Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | 97.78 | |
| d1foba_ | 334 | Beta-1,4-galactanase {Fungus (Aspergillus aculeatu | 97.73 | |
| d2pb1a1 | 394 | Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) | 97.67 | |
| d1n82a_ | 330 | Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId | 97.52 | |
| d1h4pa_ | 408 | Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom | 97.45 | |
| d1vema2 | 417 | Bacterial beta-amylase {Bacillus cereus [TaxId: 13 | 97.32 | |
| d1ecea_ | 358 | Endocellulase E1 {Acidothermus cellulolyticus [Tax | 97.25 | |
| d1xyza_ | 320 | Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 | 97.17 | |
| d1uhva2 | 346 | Beta-D-xylosidase, catalytic domain {Thermoanaerob | 97.03 | |
| d1wkya2 | 297 | Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 | 96.99 | |
| d1nq6a_ | 302 | Xylanase A, catalytic core {Streptomyces halstedii | 96.95 | |
| d1ur4a_ | 387 | Beta-1,4-galactanase {Bacillus licheniformis [TaxI | 96.92 | |
| d2c0ha1 | 350 | endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed | 96.84 | |
| d1fh9a_ | 312 | Xylanase A, catalytic core {Cellulomonas fimi [Tax | 96.8 | |
| d1v0la_ | 302 | Xylanase A, catalytic core {Streptomyces lividans | 96.8 | |
| d1hjsa_ | 332 | Beta-1,4-galactanase {Thielavia heterothallica, ak | 96.63 | |
| d1tvna1 | 293 | Endoglucanase Cel5a {Pseudoalteromonas haloplankti | 96.53 | |
| d1bqca_ | 302 | Beta-mannanase {Thermomonospora fusca [TaxId: 2021 | 96.3 | |
| d1ta3b_ | 301 | Xylanase A, catalytic core {Emericella nidulans (A | 96.24 | |
| d1vbua1 | 324 | Xylanase {Thermotoga maritima [TaxId: 2336]} | 96.23 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 96.12 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 95.49 | |
| d7a3ha_ | 300 | Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId | 95.33 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 94.88 | |
| d1g01a_ | 357 | Alkaline cellulase K catalytic domain {Bacillus sp | 94.85 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 94.72 | |
| d1egza_ | 291 | Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: | 94.29 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 93.56 | |
| d1fa2a_ | 498 | beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI | 93.45 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 93.3 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 92.93 | |
| d1wdpa1 | 490 | beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} | 92.43 | |
| d1b1ya_ | 500 | beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 | 92.26 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 91.41 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 91.12 | |
| d1r85a_ | 371 | Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: | 89.98 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 89.23 | |
| d1ur1a_ | 350 | Xylanase {Cellvibrio mixtus [TaxId: 39650]} | 89.1 | |
| d2vzsa5 | 339 | Exochitosanase CsxA {Amycolatopsis orientalis [Tax | 87.99 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 87.75 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 87.36 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 86.88 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 85.89 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 85.03 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 84.24 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 80.26 |
| >d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Family 1 of glycosyl hydrolase domain: Plant beta-glucosidase (myrosinase) species: Sorghum bicolor [TaxId: 4558]
Probab=100.00 E-value=3.8e-72 Score=595.79 Aligned_cols=264 Identities=43% Similarity=0.752 Sum_probs=223.2
Q ss_pred CcCCCCCCcEEeeeechhhhcCccCCCCCCCccceeccccCc--c--CCCCccCCccccccHHHHHHHHHcCCCEEEecc
Q 009558 262 TKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGN--V--LGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSI 337 (532)
Q Consensus 262 ~~~~FP~dFlwG~ATSA~QvEGa~~~dGkg~SiWD~~~~~~~--~--g~~~dva~D~YhrYkEDI~Lm~elGv~ayRFSI 337 (532)
.+..||+||+||+|||||||||++++|||++|+||.|+|..+ . +.++++||||||||+|||+||++||+|+|||||
T Consensus 9 ~~~~FP~~FlwG~Atsa~Q~EG~~~~~gkg~s~wd~~~~~~~~~~~~~~~~~~a~d~y~ry~eDi~l~~~lG~~~yRfSi 88 (484)
T d1v02a_ 9 RRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSI 88 (484)
T ss_dssp CGGGSCTTCEEEEECCHHHHCCCTTSTTCCCBHHHHHHHHCGGGSTTSCCSSSTTCHHHHHHHHHHHHHHTTCSEEEEEC
T ss_pred ccccCCCCCeEeEEchHHHhCcCcCCCCCCccHHHHhhccCCCcccCCCCCCcccchhhhhHHHHHHHHHhCCCEEEccC
Confidence 355699999999999999999999999999999999998532 2 788999999999999999999999999999999
Q ss_pred cccccccCCC--CCCChhHHHHHHHHHHHHHHCCCeeEEEeccCCcchhHHhhhCCccccceE-----------------
Q 009558 338 SWSRLIPNGR--GPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIV----------------- 398 (532)
Q Consensus 338 sWsRI~P~G~--G~vN~~Gi~~Y~~lId~L~~~GIePiVTL~HfdlP~~L~d~~GGW~n~~~v----------------- 398 (532)
+||||+|+|+ |.+|++|++||+++|++|+++||+|+|||||||+|+||++++|||+|++++
T Consensus 89 sWsRI~P~g~~~g~~n~~gl~~Y~~~id~l~~~GI~P~vTL~Hfd~P~~l~~~~Ggw~n~~~~~~F~~Ya~~v~~~fgd~ 168 (484)
T d1v02a_ 89 SWPRILPKGTLAGGINEKRVEYYNKLIDLLLENGIEPYITIFHWDTPQALVDAYGGFLDERIIKDYTDFAKVCFEKFGKT 168 (484)
T ss_dssp CHHHHSTTSSSTTCCCHHHHHHHHHHHHHHHHTTCEEEEEEESSCCBHHHHHHHCGGGSTHHHHHHHHHHHHHHHHHTTT
T ss_pred CHHHcCCCCCCCCCCCHHHHHHHHHHHHHHHHcCCeEEEEecCCcccceeeeecCcccCHHHHHHHHHhhHHHHHHhcch
Confidence 9999999985 899999999999999999999999999999999999999999999999888
Q ss_pred --------------------------------------------------------------------------------
Q 009558 399 -------------------------------------------------------------------------------- 398 (532)
Q Consensus 399 -------------------------------------------------------------------------------- 398 (532)
T Consensus 169 V~~W~T~NEP~~~~~~~y~~g~~~pg~~~~~~~~~~~~~~~~~~~~~~~hn~l~AHa~a~~~~~~~~~~~~~~ig~~~~~ 248 (484)
T d1v02a_ 169 VKNWLTFNEPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALNV 248 (484)
T ss_dssp CCEEEEEECHHHHHHHHHTSCCSTTCBCCTTSCSSBCSSCTTTHHHHHHHHHHHHHHHHHHHHHHHTCTTTCEEEEEEEC
T ss_pred hhceEEecCcceecccccccceecccccCccccccCcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCceeeEecc
Confidence
Q ss_pred --------------------------EecccccCCCcchhhcccCCCCCCCChhHHhhhcCCCceeeeecccceeeecCC
Q 009558 399 --------------------------VANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNP 452 (532)
Q Consensus 399 --------------------------FlDPi~~GdYP~~m~e~lGsrLP~FT~eE~elIkgslDFLGINYYTs~~Vka~~ 452 (532)
|+||++.|+||..|+..+++++|.|+++|.+.|+++.||||||||++.+|+...
T Consensus 249 ~~~~p~~~~~~d~~aa~~~~~~~~~~f~d~~~~G~YP~~~~~~~~~~~p~~~~~~~~~i~~~~DFlGiNyYt~~~v~~~~ 328 (484)
T d1v02a_ 249 FGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHID 328 (484)
T ss_dssp CEEEESSSSHHHHHHHHHHHHHHHHHHHHHHHHSSCCHHHHHHHGGGSCCCCHHHHHHHTTCCSEEEEECCCEEEEEECC
T ss_pred cceecCCCchHHHHHHHHHHHHHhhhhhHHHhCCCCCHHHHhhhhhcCcccchhhHHHhhcCCCccccccceeEEEeccC
Confidence 677788888888888888888999999999999999999999999999998754
Q ss_pred CCcccCCCCCCCCccc-----c----ccccCCCCCC--CCCchHHHHHHHHHHHHcCCCCEEEEeCCCCCCCh-------
Q 009558 453 SSLKQKHRDWSADTAT-----K----FFFKQDTAAS--SNEPSSLQIVLEYFKQVYGNPPIYIHENGSLSLSL------- 514 (532)
Q Consensus 453 ~~~~~~~~~~~~D~~v-----~----~~~~~~t~~G--eIyP~GLr~iL~~Ik~rYgn~PIyITENGig~~d~------- 514 (532)
..+.... ....+... . .+..+.|+++ +|||+||+.+|++++++|+++||||||||+|..+.
T Consensus 329 ~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~t~~~W~ei~P~GL~~~L~~~~~rY~~~PI~ITENG~a~~d~~~~~~~~ 407 (484)
T d1v02a_ 329 LSPNNSP-VLNTDDAYASQETKGPDGNAIGPPTGNAWINMYPKGLHDILMTMKNKYGNPPMYITENGMGDIDKGDLPKPV 407 (484)
T ss_dssp CSTTCCC-CSGGGGGCEEEESBCTTSCBSSCBCSSSSCBCCTHHHHHHHHHHHHHSCCCCEEEEEECCCEECSSCCCHHH
T ss_pred CCCCccc-ccccCccccccccccCCCcccCCCcCCCCceEChHHHHHHHHHHHHHcCCCCEEEeCCCCCCccccccCCCC
Confidence 3221110 00000000 0 0122345555 89999999999999999998999999999998663
Q ss_pred ---hhhhhhhhhhhh
Q 009558 515 ---SIYLSIYLLMLL 526 (532)
Q Consensus 515 ---~~~~~~~~~~~~ 526 (532)
|.+|-.||-.-|
T Consensus 408 ~i~D~~Ri~yl~~hl 422 (484)
T d1v02a_ 408 ALEDHTRLDYIQRHL 422 (484)
T ss_dssp HHCCHHHHHHHHHHH
T ss_pred ccCCHHHHHHHHHHH
Confidence 455555654433
|
| >d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} | Back information, alignment and structure |
|---|
| >d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} | Back information, alignment and structure |
|---|
| >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} | Back information, alignment and structure |
|---|
| >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} | Back information, alignment and structure |
|---|
| >d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} | Back information, alignment and structure |
|---|
| >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} | Back information, alignment and structure |
|---|
| >d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} | Back information, alignment and structure |
|---|
| >d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} | Back information, alignment and structure |
|---|
| >d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} | Back information, alignment and structure |
|---|
| >d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} | Back information, alignment and structure |
|---|
| >d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} | Back information, alignment and structure |
|---|
| >d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} | Back information, alignment and structure |
|---|
| >d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} | Back information, alignment and structure |
|---|
| >d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|