Citrus Sinensis ID: 009617

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-
MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALNCNFTSNNSICMRDMGMKLTRATQGVETLFRSTVKPRSVKAQASAGDIEEATPFKPQAKKSSGVVLPFVGVACLGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGSLADKFGRTRTFQLDAVPLAAGAFLCATAQSVQTMIIGRVLAGIGIGISSAIVPLYISEISPTEIRGALGSVNQLFICVGILAALVAGLPLAGNPLWWRTMFGLAAIPSILLALGMGLSPESPRWLFQQGKKSEAEKSIQTLYGKERVSEVMLDLTNAGQGSAEPEAGWFDLFSSRYWKVVSVGAALFLFQQLAGINAVVYYSTSVFRSVGIESDVAASALVGAANVFGRKNLLTFSFTGMAASMLLLSLSFTWKVLAPYSGTLAVLGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAVALSLGMHWISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYIAVNVVETKGRSLEEIERALNPVV
ccccccEEccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHccccccHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccc
*****YAIKASVCFDARNRRRACVLAAGFANTRSVALNCNFT*********************************************************GVVLPFVGVACLGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGSLADKFGRTRTFQLDAVPLAAGAFLCATAQSVQTMIIGRVLAGIGIGISSAIVPLYISEISPTEIRGALGSVNQLFICVGILAALVAGLPLAGNPLWWRTMFGLAAIPSILLALGMGLSPESPRWLFQQGKKSEAEKSIQTLYGKERVSEVMLDL**********EAGWFDLFSSRYWKVVSVGAALFLFQQLAGINAVVYYSTSVFRSVGIESDVAASALVGAANVFGRKNLLTFSFTGMAASMLLLSLSFTWKVLAPYSGTLAVLGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAVALSLGMHWISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYIAVNVVETKGRSLEEIERALNPV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALNCNFTSNNSICMRDMGMKLTRATQGVETLFRSTVKPRSVKAQASAGDIEEATPFKPQAKKSSGVVLPFVGVACLGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGSLADKFGRTRTFQLDAVPLAAGAFLCATAQSVQTMIIGRVLAGIGIGISSAIVPLYISEISPTEIRGALGSVNQLFICVGILAALVAGLPLAGNPLWWRTMFGLAAIPSILLALGMGLSPESPRWLFQQGKKSEAEKSIQTLYGKERVSEVMLDLTNAGQGSAEPEAGWFDLFSSRYWKVVSVGAALFLFQQLAGINAVVYYSTSVFRSVGIESDVAASALVGAANVFGRKNLLTFSFTGMAASMLLLSLSFTWKVLAPYSGTLAVLGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAVALSLGMHWISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYIAVNVVETKGRSLEEIERALNPVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Plastidic glucose transporter 4 May be involved in the efflux of glucose towards the cytosol.confidentQ56ZZ7
Solute carrier family 2, facilitated glucose transporter member 14 Facilitative glucose transporter (By similarity). May have a specific function related to spermatogenesis.probableQ8TDB8
Putative metabolite transport protein YwtG probableC0SPB2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:very confident
Coverage over the Query: 100-528
View the alignment between query and template
View the model in PyMOL