Citrus Sinensis ID: 009668

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------53

MELLTASSATFSPLPSNFPSFTFKATISKSWKSHPGIVEARLQGFLLRTRTTISKRLGICCNSVGPFKEEFLFQHFCQLNKGFSSQCGLISIRYRSSLLKVRSCSDRIRQCVSVLFVQLVFTAMLVTSTTIALSETPSLALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGAEIRHLALTREKVSLNPVKSRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTFPKDEDGFCGCLQDSASTCNMNGGQLFAR

cccccccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccccHHccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccHHHHHHccccccEEEEEEEEEEEEccccccccccEEEEEcccccHHHHcccccccEEEEEccEEcccccHHHHHHHHcccccccEEEEEEEccEEEEEEEEEEEEEcccEEEEEccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHcccccEEEEEcccccccEEEccccccccccccEEEEEcccccHHHHHHHHHccccccEEEEccccccccEEEEEEEcccccEEEEEEEEEccccccccccccccccEEccccccccccccccccccccccccccccccccc

cEEEEcccccccccccccccEEEEccHHHHHHccccccHHHccccEEEEccccccccccccccccccHEEEHcHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccEEEcccHHHHcccccccccEEccEEEEEccccccccccEEEEEEccccccHHHccccccEEEEEccEEcccccHHHHHHHHcEccccEEEEEEEccccEEEEEEEEEEEEEccEEEEEEcccccccccccEEEEEEccEcccHHHHHHHHHHHHHHHcccEEEEEccccccEcHHHHHHHHHHHccccEEEEEEEccEEEEEEEccccccccccccEEEEEccccccHHHHHHHHHHHccccEEEEcccccccEEEEEEEcccccEEEEEEEEEEcccccEHHHHcccccEEEccccHHHHccccccccccHHHHHccccccccc

melltassatfsplpsnfpsftfkatiskswkshpgIVEARLQGFLLRTRTTISKRLGiccnsvgpfkeEFLFQHFCQlnkgfssqcglISIRYRSsllkvrscsDRIRQCVSVLFVQLVFTAMLVTSTTialsetpslalsEENRLFLEAWRTIDRAyvdktfngqswFRYRENAlrnepmntrEETYMAIRKMLAtlddpftrflepekfnslrsgtqgaLTGVGlsigyptasdgssagLVVIssmpggpanragilsGDVILAiddtstesmgiYDAAerlqgpegspveltvrSGAEIRHLALTREkvslnpvksrlcvvpgpgkssprigyikltsfnqnaSGAVREAIDTLRsnsvnafvldlrdnsgglfpegIEIAKIWLDKGVIVyicdsrgvrdiydtdgtdalaasePLAVLVNKGTASASEILAGALkdnkravlfgeptygkgkiqsvfqlsdgsglAVTVAryetpahtdidkvgvipdhplpktfpkdedgfcgclqdsastcnmnggqlfar

melltassatfsplpsnfPSFTFKATISKSWKSHPGIVEARLQGFLLRTRTTISKRLGICCNSVGPFKEEFLFQHFCQLNKGFSSQCGLISIRYRSSLLKVRSCSDRIRQCVSVLFVQLVFTAMLVTSTTIalsetpslalseENRLFLEAWRTIDrayvdktfngqswfryrenalrnepmntREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAerlqgpegspveLTVRSGAEIRHLAltrekvslnpvksrlcvvpgpgkssprigYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPahtdidkvgvipdHPLPKTFPKDEDGFCGCLQDSAstcnmnggqlfar

*******************SFTFKATISKSWKSHPGIVEARLQGFLLRTRTTISKRLGICCNSVGPFKEEFLFQHFCQLNKGFSSQCGLISIRYRSSLLKVRSCSDRIRQCVSVLFVQLVFTAMLVTSTTIALSETPSLALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRN******EETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTA*****AGLVVISS*****ANRAGILSGDVILAIDDTST**MGIY********************GAEIRHLALTREKVSLNPVKSRLCVVPG*****PRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTFPKDEDGFCGCLQD***************

***************SNFPSFTFKATISKS**********RLQGFLLRTRTTISKRLGICCNSVGPFKEEFLFQHFCQLNKGFSS**********************IRQCVSVLFVQLVFTAMLVTSTTIA***********ENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGAEIRHLALTREKVSLNPVKSRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGVIVYICD****************AASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKT*****************************

********ATFSPLPSNFPSFTFKATISKSWKSHPGIVEARLQGFLLRTRTTISKRLGICCNSVGPFKEEFLFQHFCQLNKGFSSQCGLISIRYRSSLLKVRSCSDRIRQCVSVLFVQLVFTAMLVTSTTIALSETPSLALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGAEIRHLALTREKVSLNPVKSRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTFPKDEDGFCGCLQDSASTCNMNGGQLFAR

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		529	2.2.26 [Sep-21-2011]
O04073		464	C-terminal processing pep	N/A	no	0.712	0.812	0.510	1e-107
P42784		414	Carboxyl-terminal-process	yes	no	0.655	0.838	0.471	2e-90
Q55669		427	Carboxyl-terminal-process	N/A	no	0.691	0.857	0.458	2e-90
Q5HG01		496	Probable CtpA-like serine	yes	no	0.669	0.713	0.282	3e-40
Q8NWR2		496	Probable CtpA-like serine	yes	no	0.669	0.713	0.284	3e-40
Q6G9E1		496	Probable CtpA-like serine	yes	no	0.669	0.713	0.284	3e-40
Q6GGY8		496	Probable CtpA-like serine	yes	no	0.567	0.604	0.306	3e-40
Q2YXZ9		496	Probable CtpA-like serine	yes	no	0.546	0.582	0.314	4e-40
Q44879		434	Carboxy-terminal-processi	yes	no	0.601	0.732	0.312	5e-40
Q7A5M9		496	Probable CtpA-like serine	yes	no	0.546	0.582	0.314	5e-40

>sp\|O04073\|CTPA_SCEOB C-terminal processing peptidase, chloroplastic OS=Scenedesmus obliquus GN=ctpA PE=1 SV=1	Back alignment and function desciption

 Score =  390 bits (1001), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 271/390 (69%), Gaps = 13/390 (3%)

Query: 137 PSLALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKML 196
           P+ A++ E  LFLEAWR +DRAYVDK+FNGQSWF+ RE  L+ EPM+ R +TY AIRK+L
Sbjct: 74  PAQAVTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLL 133

Query: 197 ATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANR 256
           A LDDPFTRFLEP +  +LR GT G++TGVGL I Y     GS   +VV++  PGGPA +
Sbjct: 134 AVLDDPFTRFLEPSRLAALRRGTAGSVTGVGLEITY---DGGSGKDVVVLTPAPGGPAEK 190

Query: 257 AGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRS-GA--EIRHLALTREKV 313
           AG  +GDVI+ +D T+ + + +YD ++ LQG   S VE+ + + GA    R L LTR+KV
Sbjct: 191 AGARAGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKV 250

Query: 314 SLNPVKSRLC-----VVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVL 368
           ++NPV    C         PG +  ++GY++L +FN N + A ++A   L    V   VL
Sbjct: 251 TINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVL 310

Query: 369 DLRDNSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKG 428
           D+R+N GGLFP G+ +A++ +D+G +V I DS+G+RDIY  DG +++ ++ PL VLVN+G
Sbjct: 311 DIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADG-NSIDSATPLVVLVNRG 369

Query: 429 TASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDK 488
           TASASE+LAGALKD+KR ++ GE T+GKG IQ+V  LSDGSG+AVTVARY+TPA  DI+K
Sbjct: 370 TASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINK 429

Query: 489 VGVIPDHPL-PKTFPKDEDGFCGCLQDSAS 517
           +GV PD  L P+  P D +G C  L   A+
Sbjct: 430 IGVSPDVQLDPEVLPTDLEGVCRVLGSDAA 459

Protease involved in the C-terminal processing of the chloroplastic D1 protein of photosystem II. This proteolytic processing is necessary to allow the light-driven assembly of the tetranuclear manganese cluster, which is responsible for photosynthetic water oxidation.
Scenedesmus obliquus (taxid: 3088)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 1EC: 0EC: 2

>sp\|P42784\|CTPA_SYNP2 Carboxyl-terminal-processing protease OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ctpA PE=3 SV=2	Back alignment and function description

>sp\|Q55669\|CTPA_SYNY3 Carboxyl-terminal-processing protease OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ctpA PE=3 SV=1	Back alignment and function description

>sp\|Q5HG01\|CTPAL_STAAC Probable CtpA-like serine protease OS=Staphylococcus aureus (strain COL) GN=SACOL1455 PE=3 SV=1	Back alignment and function description

>sp\|Q8NWR2\|CTPAL_STAAW Probable CtpA-like serine protease OS=Staphylococcus aureus (strain MW2) GN=MW1310 PE=3 SV=1	Back alignment and function description

>sp\|Q6G9E1\|CTPAL_STAAS Probable CtpA-like serine protease OS=Staphylococcus aureus (strain MSSA476) GN=SAS1363 PE=3 SV=1	Back alignment and function description

>sp\|Q6GGY8\|CTPAL_STAAR Probable CtpA-like serine protease OS=Staphylococcus aureus (strain MRSA252) GN=SAR1432 PE=3 SV=1	Back alignment and function description

>sp\|Q2YXZ9\|CTPAL_STAAB Probable CtpA-like serine protease OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1275c PE=3 SV=1	Back alignment and function description

>sp\|Q44879\|CTPA_BARBK Carboxy-terminal-processing protease OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ctpA PE=3 SV=1	Back alignment and function description

>sp\|Q7A5M9\|CTPAL_STAAN Probable CtpA-like serine protease OS=Staphylococcus aureus (strain N315) GN=SA1253 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		529
225433320		497	PREDICTED: carboxyl-terminal-processing	0.826	0.879	0.798	0.0
224100001		404	predicted protein [Populus trichocarpa]	0.737	0.965	0.894	0.0
356574722		564	PREDICTED: carboxyl-terminal-processing	0.843	0.790	0.783	0.0
255554320		407	Carboxyl-terminal-processing protease pr	0.767	0.997	0.849	0.0
449458926		540	PREDICTED: C-terminal processing peptida	0.824	0.807	0.778	0.0
449531187		540	PREDICTED: C-terminal processing peptida	0.824	0.807	0.778	0.0
15236628		515	Peptidase S41 family protein [Arabidopsi	0.962	0.988	0.667	0.0
30684169		505	Peptidase S41 family protein [Arabidopsi	0.793	0.831	0.789	0.0
4210322		500	D1-processing protease [Arabidopsis thal	0.793	0.84	0.789	0.0
147773278		393	hypothetical protein VITISV_005100 [Viti	0.737	0.992	0.846	0.0

>gi\|225433320\|ref\|XP_002285561.1\| PREDICTED: carboxyl-terminal-processing protease [Vitis vinifera] gi\|296088261\|emb\|CBI35769.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/437 (79%), Positives = 388/437 (88%)

Query: 93  RYRSSLLKVRSCSDRIRQCVSVLFVQLVFTAMLVTSTTIALSETPSLALSEENRLFLEAW 152
           +Y +SL K  +CS++ +  VSV FV+LV   MLV S ++ +S  PS AL+EEN LFLEAW
Sbjct: 61  KYTASLQKELNCSEKFKHHVSVHFVRLVVGVMLVMSVSVGVSRPPSWALTEENLLFLEAW 120

Query: 153 RTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKF 212
           RTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETY+AI+KMLATLDDPFTRFLEP+KF
Sbjct: 121 RTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYIAIKKMLATLDDPFTRFLEPDKF 180

Query: 213 NSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTS 272
            SLRSGTQGALTGVGLSIGYPT  DGS AGL+VIS+ PGGPA+RAGILSGDVIL ID TS
Sbjct: 181 KSLRSGTQGALTGVGLSIGYPTGFDGSPAGLLVISASPGGPASRAGILSGDVILTIDGTS 240

Query: 273 TESMGIYDAAERLQGPEGSPVELTVRSGAEIRHLALTREKVSLNPVKSRLCVVPGPGKSS 332
           TE+MGIYDAAERLQGPEGS VELT+RSG E++ L+L RE+VSLNPVKSRLC +PG GK S
Sbjct: 241 TETMGIYDAAERLQGPEGSSVELTIRSGPEVKSLSLMRERVSLNPVKSRLCKMPGLGKDS 300

Query: 333 PRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKG 392
           P+IGYIKL SFNQNASGAV+EAI++LRSN VNAFVLDLRDNSGGLFPEG+EIAKIWL+KG
Sbjct: 301 PKIGYIKLASFNQNASGAVKEAIESLRSNDVNAFVLDLRDNSGGLFPEGVEIAKIWLEKG 360

Query: 393 VIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEP 452
           VIVYICD RG+RDIYDTDG+  +AASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEP
Sbjct: 361 VIVYICDGRGIRDIYDTDGSSVVAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEP 420

Query: 453 TYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTFPKDEDGFCGCL 512
           T+GKGKIQSVF+LSDGSGLAVTVARYETPAH DIDKVG+ PDHPLP  FPKD +GFCGCL
Sbjct: 421 TFGKGKIQSVFELSDGSGLAVTVARYETPAHIDIDKVGIAPDHPLPTPFPKDAEGFCGCL 480

Query: 513 QDSASTCNMNGGQLFAR 529
            D  S C +N  QLF+R
Sbjct: 481 MDPTSACYLNRVQLFSR 497

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224100001\|ref\|XP_002311704.1\| predicted protein [Populus trichocarpa] gi\|222851524\|gb\|EEE89071.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356574722\|ref\|XP_003555494.1\| PREDICTED: carboxyl-terminal-processing protease-like [Glycine max]	Back alignment and taxonomy information

>gi\|255554320\|ref\|XP_002518200.1\| Carboxyl-terminal-processing protease precursor, putative [Ricinus communis] gi\|223542796\|gb\|EEF44333.1\| Carboxyl-terminal-processing protease precursor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449458926\|ref\|XP_004147197.1\| PREDICTED: C-terminal processing peptidase, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449531187\|ref\|XP_004172569.1\| PREDICTED: C-terminal processing peptidase, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|15236628|ref|NP_193509.1| Peptidase S41 family protein [Arabidopsis thaliana] gi|15983456|gb|AAL11596.1|AF424602_1 AT4g17740/dl4905c [Arabidopsis thaliana] gi|2245133|emb|CAB10554.1| PSII D1 protein processing enzyme [Arabidopsis thaliana] gi|7268527|emb|CAB78777.1| PSII D1 protein processing enzyme [Arabidopsis thaliana] gi|15809808|gb|AAL06832.1| AT4g17740/dl4905c [Arabidopsis thaliana] gi|30102466|gb|AAP21151.1| At4g17740/dl4905c [Arabidopsis thaliana] gi|332658543|gb|AEE83943.1| Peptidase S41 family protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|30684169\|ref\|NP_849401.1\| Peptidase S41 family protein [Arabidopsis thaliana] gi\|332658544\|gb\|AEE83944.1\| Peptidase S41 family protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|4210322\|emb\|CAA10694.1\| D1-processing protease [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|147773278\|emb\|CAN62705.1\| hypothetical protein VITISV_005100 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		529
TAIR\|locus:2129411		515	AT4G17740 [Arabidopsis thalian	0.964	0.990	0.672	1.1e-179
UNIPROTKB\|P73458		423	prc "Carboxyl-terminal proteas	0.686	0.858	0.416	4.1e-72
UNIPROTKB\|P75023		462	ctpB "Carboxyl-terminal protea	0.659	0.755	0.398	8.1e-60
TAIR\|locus:2170443		489	AT5G46390 [Arabidopsis thalian	0.691	0.748	0.359	3.5e-52
TIGR_CMR\|CHY_0170		377	CHY_0170 "carboxyl-terminal pr	0.586	0.822	0.387	6.5e-51
TIGR_CMR\|GSU_1772		443	GSU_1772 "carboxy-terminal pro	0.567	0.677	0.356	7.9e-46
TIGR_CMR\|CJE_0618		444	CJE_0618 "carboxyl-terminal pr	0.561	0.668	0.345	3.6e-41
TIGR_CMR\|GSU_0969		450	GSU_0969 "carboxy-terminal pro	0.597	0.702	0.346	3.6e-41
TIGR_CMR\|CBU_1538		456	CBU_1538 "carboxyl-terminal pr	0.586	0.679	0.342	1.8e-39
TIGR_CMR\|SPO_3812		443	SPO_3812 "carboxyl-terminal pr	0.580	0.693	0.335	1.6e-38

TAIR\|locus:2129411 AT4G17740 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1744 (619.0 bits), Expect = 1.1e-179, P = 1.1e-179
 Identities = 359/534 (67%), Positives = 421/534 (78%)

Query:     1 MELLTASSATFSPLPSNFPSF---TFKATISKSWKSHPGIVEARLQGFLLRTRTTISKRL 57
             ME+L +SS   SP+    P+     F   + K W   P  +    +    R+R+ IS+  
Sbjct:     1 MEVLASSS--LSPISFTKPNKINPNFSIQV-KLWVKQPPKISKASKFSYARSRSNISRS- 56

Query:    58 GICCNSVGPFKEEFLFQHF-CQLNKGFSSQCGLISIRYRSSLLKVRSCSDRIRQCVSVLF 116
                 N+  P    F+   F C + +  + Q      R  S  + ++S S   RQ +SV  
Sbjct:    57 ----NAANP-GVVFVCNRFLCVIER--NDQ------RKLSGKVMMKS-SVNFRQNLSVAL 102

Query:   117 VQLVFTAMLVTSTTIALSETP-SLALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYREN 175
             V++V + +LV+S ++  +++P S  L+EEN LFLEAWRTIDRAY+DKTFNGQSWFRYRE 
Sbjct:   103 VRIV-SVLLVSSISVVTTDSPPSWGLTEENLLFLEAWRTIDRAYIDKTFNGQSWFRYRET 161

Query:   176 ALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTA 235
             ALRNEPMNTREETYMAI+KM+ATLDDPFTRFLEP KF SLRSGTQGA+TGVGLSIGYPTA
Sbjct:   162 ALRNEPMNTREETYMAIKKMVATLDDPFTRFLEPGKFKSLRSGTQGAVTGVGLSIGYPTA 221

Query:   236 SDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVEL 295
             SDG  AGLVVIS+ PGGPANRAGIL GDVI  ID+T+TE++ IYDAA+ LQGPEGS VEL
Sbjct:   222 SDGPPAGLVVISAAPGGPANRAGILPGDVIQGIDNTTTETLTIYDAAQMLQGPEGSAVEL 281

Query:   296 TVRSGAEIRHLALTREKVSLNPVKSRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAI 355
              +RSG E R L LTRE+VS+NPVKSRLC +PG G +SP+IGYIKLT+FNQNAS AVREAI
Sbjct:   282 AIRSGPETRLLTLTRERVSVNPVKSRLCELPGSGSNSPKIGYIKLTTFNQNASSAVREAI 341

Query:   356 DTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDAL 415
             +TLR N+VNAFVLDLRDNSGG FPEGIEIAK WLDKGVIVYICDSRGVRDIYDTDG++A+
Sbjct:   342 ETLRGNNVNAFVLDLRDNSGGSFPEGIEIAKFWLDKGVIVYICDSRGVRDIYDTDGSNAI 401

Query:   416 AASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTV 475
             A SEPLAVLVNKGTASASEILAGALKDNKRA+++GEPTYGKGKIQSVF+LSDGSGLAVTV
Sbjct:   402 ATSEPLAVLVNKGTASASEILAGALKDNKRALVYGEPTYGKGKIQSVFELSDGSGLAVTV 461

Query:   476 ARYETPAHTDIDKVGVIPDHPLPKTFPKDEDGFCGCLQDSASTCNMNGGQLFAR 529
             ARYETPAHTDIDKVGV PDHPLPK+FPKDE+ FCGCL+D  + C +N G LF+R
Sbjct:   462 ARYETPAHTDIDKVGVTPDHPLPKSFPKDEEAFCGCLKDPTAACYLNQGLLFSR 515

GO:0005576 "extracellular region" evidence=ISM

GO:0006508 "proteolysis" evidence=IEA

GO:0008236 "serine-type peptidase activity" evidence=IEA

GO:0035556 "intracellular signal transduction" evidence=ISS

GO:0009543 "chloroplast thylakoid lumen" evidence=IDA

GO:0031977 "thylakoid lumen" evidence=IDA

GO:0005739 "mitochondrion" evidence=IDA

GO:0009579 "thylakoid" evidence=IDA

GO:0006655 "phosphatidylglycerol biosynthetic process" evidence=RCA

UNIPROTKB\|P73458 prc "Carboxyl-terminal protease" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)]	Back alignment and assigned GO terms

UNIPROTKB\|P75023 ctpB "Carboxyl-terminal protease" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)]	Back alignment and assigned GO terms

TAIR\|locus:2170443 AT5G46390 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_0170 CHY_0170 "carboxyl-terminal protease" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_1772 GSU_1772 "carboxy-terminal processing protease" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|CJE_0618 CJE_0618 "carboxyl-terminal protease" [Campylobacter jejuni RM1221 (taxid:195099)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_0969 GSU_0969 "carboxy-terminal processing protease" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_1538 CBU_1538 "carboxyl-terminal protease family protein" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|SPO_3812 SPO_3812 "carboxyl-terminal protease family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.4.21	0.766
3rd Layer	3.4.21.102	0.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00020389001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (463 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	26N20_20	SubName- Full=Chromosome chr8 scaffold_68, whole genome shotgun sequence; (551 aa)	•		•	0.646
	GSVIVG00026401001	SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (468 aa)	•	•	•	0.617
	GSVIVG00031804001	SubName- Full=Chromosome chr18 scaffold_59, whole genome shotgun sequence; (450 aa)			•	0.505
	GSVIVG00000429001	SubName- Full=Chromosome chr2 scaffold_105, whole genome shotgun sequence; (534 aa)	•		•	0.486
	GSVIVG00021219001	RecName- Full=Uracil-DNA glycosylase; EC=3.2.2.-;; Excises uracil residues from the DNA which c [...] (328 aa)	•			0.434

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		529
PLN00049		389	PLN00049, PLN00049, carboxyl-terminal processing p	0.0
COG0793		406	COG0793, Prc, Periplasmic protease [Cell envelope	1e-107
TIGR00225		334	TIGR00225, prc, C-terminal peptidase (prc)	1e-103
cd07560		211	cd07560, Peptidase_S41_CPP, C-terminal processing	2e-77
TIGR03900		973	TIGR03900, prc_long_Delta, putative carboxyl-termi	6e-72
smart00245		192	smart00245, TSPc, tail specific protease	6e-70
pfam03572		166	pfam03572, Peptidase_S41, Peptidase family S41	2e-60
cd06567		224	cd06567, Peptidase_S41, C-terminal processing pept	1e-59
PRK11186		667	PRK11186, PRK11186, carboxy-terminal protease; Pro	3e-31
cd07563		250	cd07563, Peptidase_S41_IRBP, Interphotoreceptor re	8e-23
cd00988		85	cd00988, PDZ_CTP_protease, PDZ domain of C-termina	2e-21
cd07562		266	cd07562, Peptidase_S41_TRI, Tricorn protease; seri	3e-21
cd07561		256	cd07561, Peptidase_S41_CPP_like, C-terminal proces	4e-15
smart00228		85	smart00228, PDZ, Domain present in PSD-95, Dlg, an	3e-12
cd00136		70	cd00136, PDZ, PDZ domain, also called DHR (Dlg hom	1e-11
cd00989		79	cd00989, PDZ_metalloprotease, PDZ domain of bacter	6e-10
cd00992		82	cd00992, PDZ_signaling, PDZ domain found in a vari	3e-09
pfam00595		80	pfam00595, PDZ, PDZ domain (Also known as DHR or G	6e-09
cd00987		90	cd00987, PDZ_serine_protease, PDZ domain of tryspi	7e-09
pfam13180		81	pfam13180, PDZ_2, PDZ domain	5e-08
cd06567		224	cd06567, Peptidase_S41, C-terminal processing pept	8e-07
COG0265		347	COG0265, DegQ, Trypsin-like serine proteases, typi	2e-06
cd07560		211	cd07560, Peptidase_S41_CPP, C-terminal processing	9e-05
cd07562		266	cd07562, Peptidase_S41_TRI, Tricorn protease; seri	2e-04
TIGR02037		428	TIGR02037, degP_htrA_DO, periplasmic serine protea	9e-04
cd00991		79	cd00991, PDZ_archaeal_metalloprotease, PDZ domain	0.001
TIGR02037		428	TIGR02037, degP_htrA_DO, periplasmic serine protea	0.002
COG3975		558	COG3975, COG3975, Predicted protease with the C-te	0.002

>gnl\|CDD\|177681 PLN00049, PLN00049, carboxyl-terminal processing protease; Provisional	Back alignment and domain information

 Score =  745 bits (1924), Expect = 0.0
 Identities = 312/389 (80%), Positives = 346/389 (88%)

Query: 140 ALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATL 199
           AL+EEN LFLEAWRT+DRAYVDKTFNGQSWFRYRENAL+NEPMNTREETY AIRKMLATL
Sbjct: 1   ALTEENLLFLEAWRTVDRAYVDKTFNGQSWFRYRENALKNEPMNTREETYAAIRKMLATL 60

Query: 200 DDPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGI 259
           DDPFTRFLEPEKF SLRSGT+GA+TGVGL +GYPT SDG  AGLVV++  PGGPA RAGI
Sbjct: 61  DDPFTRFLEPEKFKSLRSGTKGAVTGVGLEVGYPTGSDGPPAGLVVVAPAPGGPAARAGI 120

Query: 260 LSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGAEIRHLALTREKVSLNPVK 319
             GDVILAID TSTE + +Y+AA+RLQGPEGS VELT+R G E R + LTREKVSLNPVK
Sbjct: 121 RPGDVILAIDGTSTEGLSLYEAADRLQGPEGSSVELTLRRGPETRLVTLTREKVSLNPVK 180

Query: 320 SRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFP 379
           SRLC VPGPG  SP+IGYIKLT+FNQNAS AV+EAI+TLR+N V+AFVLDLRDNSGGLFP
Sbjct: 181 SRLCEVPGPGAGSPKIGYIKLTTFNQNASSAVKEAIETLRANGVDAFVLDLRDNSGGLFP 240

Query: 380 EGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGA 439
            GIEIAK+WLDKGVIVYI DSRGVRDIYD DG+ A+A SEPLAVLVNKGTASASEILAGA
Sbjct: 241 AGIEIAKLWLDKGVIVYIADSRGVRDIYDADGSSAIATSEPLAVLVNKGTASASEILAGA 300

Query: 440 LKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPK 499
           LKDNKRAV+ GEPT+GKG IQSVF+LSDGSGLAVTVARY+TPA TDIDKVG+ PDHPLP+
Sbjct: 301 LKDNKRAVVLGEPTFGKGLIQSVFELSDGSGLAVTVARYQTPAGTDIDKVGITPDHPLPE 360

Query: 500 TFPKDEDGFCGCLQDSASTCNMNGGQLFA 528
           + PKDE+ FCGCL D A+ C +N  QLF+
Sbjct: 361 SLPKDEEAFCGCLADPAAACYLNAPQLFS 389

Length = 389

>gnl\|CDD\|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|232883 TIGR00225, prc, C-terminal peptidase (prc)	Back alignment and domain information

>gnl\|CDD\|143476 cd07560, Peptidase_S41_CPP, C-terminal processing peptidase; serine protease family S41	Back alignment and domain information

>gnl\|CDD\|234386 TIGR03900, prc_long_Delta, putative carboxyl-terminal-processing protease, deltaproteobacterial	Back alignment and domain information

>gnl\|CDD\|214582 smart00245, TSPc, tail specific protease	Back alignment and domain information

>gnl\|CDD\|217620 pfam03572, Peptidase_S41, Peptidase family S41	Back alignment and domain information

>gnl\|CDD\|143475 cd06567, Peptidase_S41, C-terminal processing peptidase family S41	Back alignment and domain information

>gnl\|CDD\|236873 PRK11186, PRK11186, carboxy-terminal protease; Provisional	Back alignment and domain information

>gnl\|CDD\|143479 cd07563, Peptidase_S41_IRBP, Interphotoreceptor retinoid-binding protein; serine protease family S41	Back alignment and domain information

>gnl\|CDD\|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts	Back alignment and domain information

>gnl\|CDD\|143478 cd07562, Peptidase_S41_TRI, Tricorn protease; serine protease family S41	Back alignment and domain information

>gnl\|CDD\|143477 cd07561, Peptidase_S41_CPP_like, C-terminal processing peptidase-like; serine protease family S41	Back alignment and domain information

>gnl\|CDD\|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2	Back alignment and domain information

>gnl\|CDD\|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif)	Back alignment and domain information

>gnl\|CDD\|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms	Back alignment and domain information

>gnl\|CDD\|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements	Back alignment and domain information

>gnl\|CDD\|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF)	Back alignment and domain information

>gnl\|CDD\|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis	Back alignment and domain information

>gnl\|CDD\|221961 pfam13180, PDZ_2, PDZ domain	Back alignment and domain information

>gnl\|CDD\|143475 cd06567, Peptidase_S41, C-terminal processing peptidase family S41	Back alignment and domain information

>gnl\|CDD\|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|143476 cd07560, Peptidase_S41_CPP, C-terminal processing peptidase; serine protease family S41	Back alignment and domain information

>gnl\|CDD\|143478 cd07562, Peptidase_S41_TRI, Tricorn protease; serine protease family S41	Back alignment and domain information

>gnl\|CDD\|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family	Back alignment and domain information

>gnl\|CDD\|238491 cd00991, PDZ_archaeal_metalloprotease, PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms	Back alignment and domain information

>gnl\|CDD\|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family	Back alignment and domain information

>gnl\|CDD\|226483 COG3975, COG3975, Predicted protease with the C-terminal PDZ domain [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		529
PLN00049		389	carboxyl-terminal processing protease; Provisional	100.0
COG0793		406	Prc Periplasmic protease [Cell envelope biogenesis	100.0
PRK11186		667	carboxy-terminal protease; Provisional	100.0
TIGR00225		334	prc C-terminal peptidase (prc). A C-terminal pepti	100.0
cd06567		224	Peptidase_S41 C-terminal processing peptidase fami	100.0
cd07562		266	Peptidase_S41_TRI Tricorn protease; serine proteas	100.0
cd07563		250	Peptidase_S41_IRBP Interphotoreceptor retinoid-bin	100.0
smart00245		192	TSPc tail specific protease. tail specific proteas	100.0
cd07560		211	Peptidase_S41_CPP C-terminal processing peptidase;	100.0
cd07561		256	Peptidase_S41_CPP_like C-terminal processing pepti	99.98
PF03572		169	Peptidase_S41: Peptidase family S41; InterPro: IPR	99.97
COG3975		558	Predicted protease with the C-terminal PDZ domain	99.66
PF13180		82	PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_	99.31
cd00988		85	PDZ_CTP_protease PDZ domain of C-terminal processi	99.19
cd00991		79	PDZ_archaeal_metalloprotease PDZ domain of archaea	98.94
cd00989		79	PDZ_metalloprotease PDZ domain of bacterial and pl	98.92
cd00136		70	PDZ PDZ domain, also called DHR (Dlg homologous re	98.89
cd00990		80	PDZ_glycyl_aminopeptidase PDZ domain associated wi	98.87
PF14684		70	Tricorn_C1: Tricorn protease C1 domain; PDB: 1N6F_	98.79
cd00986		79	PDZ_LON_protease PDZ domain of ATP-dependent LON s	98.79
PF00595		81	PDZ: PDZ domain (Also known as DHR or GLGF) Coordi	98.69
cd00987		90	PDZ_serine_protease PDZ domain of tryspin-like ser	98.59
smart00228		85	PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als	98.47
cd00992		82	PDZ_signaling PDZ domain found in a variety of Eum	98.45
PF14685		88	Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6	98.41
TIGR00054		420	RIP metalloprotease RseP. A model that detects fra	98.33
PRK10139		455	serine endoprotease; Provisional	98.32
PRK10898		353	serine endoprotease; Provisional	98.29
TIGR02038		351	protease_degS periplasmic serine pepetdase DegS. T	98.29
TIGR01713		259	typeII_sec_gspC general secretion pathway protein	98.28
PRK10779		449	zinc metallopeptidase RseP; Provisional	98.27
TIGR02037		428	degP_htrA_DO periplasmic serine protease, Do/DeqQ	98.23
PRK10779		449	zinc metallopeptidase RseP; Provisional	98.15
PRK10942		473	serine endoprotease; Provisional	98.14
TIGR02860		402	spore_IV_B stage IV sporulation protein B. SpoIVB,	98.02
TIGR02037		428	degP_htrA_DO periplasmic serine protease, Do/DeqQ	97.98
PRK10139		455	serine endoprotease; Provisional	97.96
PF04495		138	GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro:	97.95
TIGR03279		433	cyano_FeS_chp putative FeS-containing Cyanobacteri	97.89
PRK10942		473	serine endoprotease; Provisional	97.85
KOG3129		231	consensus 26S proteasome regulatory complex, subun	97.68
KOG3209		984	consensus WW domain-containing protein [General fu	97.66
TIGR00054		420	RIP metalloprotease RseP. A model that detects fra	97.59
COG0265		347	DegQ Trypsin-like serine proteases, typically peri	97.51
KOG3553		124	consensus Tax interaction protein TIP1 [Cell wall/	97.49
KOG3550		207	consensus Receptor targeting protein Lin-7 [Extrac	97.46
COG3480		342	SdrC Predicted secreted protein containing a PDZ d	97.25
KOG3209		984	consensus WW domain-containing protein [General fu	96.91
PRK09681		276	putative type II secretion protein GspC; Provision	96.89
KOG1421		955	consensus Predicted signaling-associated protein (	96.69
KOG3651		429	consensus Protein kinase C, alpha binding protein	96.46
KOG3549		505	consensus Syntrophins (type gamma) [Extracellular	96.3
KOG3552		1298	consensus FERM domain protein FRM-8 [General funct	96.26
KOG1892		1629	consensus Actin filament-binding protein Afadin [C	96.07
KOG3580		1027	consensus Tight junction proteins [Signal transduc	96.01
KOG3542		1283	consensus cAMP-regulated guanine nucleotide exchan	95.93
KOG3532		1051	consensus Predicted protein kinase [General functi	95.55
KOG1320		473	consensus Serine protease [Posttranslational modif	95.42
cd07021		178	Clp_protease_NfeD_like Nodulation formation effici	94.95
KOG3571		626	consensus Dishevelled 3 and related proteins [Gene	94.81
KOG3580		1027	consensus Tight junction proteins [Signal transduc	94.73
KOG3605		829	consensus Beta amyloid precursor-binding protein [	94.69
KOG3551		506	consensus Syntrophins (type beta) [Extracellular s	94.62
COG3031		275	PulC Type II secretory pathway, component PulC [In	94.57
KOG0609		542	consensus Calcium/calmodulin-dependent serine prot	93.46
KOG3606		358	consensus Cell polarity protein PAR6 [Signal trans	92.75
PF12812		78	PDZ_1: PDZ-like domain	92.61
KOG0606		1205	consensus Microtubule-associated serine/threonine	92.37
cd07020		187	Clp_protease_NfeD_1 Nodulation formation efficienc	91.2
COG0750		375	Predicted membrane-associated Zn-dependent proteas	90.83
KOG3834		462	consensus Golgi reassembly stacking protein GRASP6	90.82
KOG3605		829	consensus Beta amyloid precursor-binding protein [	90.29
cd07015		172	Clp_protease_NfeD Nodulation formation efficiency	86.18
KOG1738		638	consensus Membrane-associated guanylate kinase-int	85.86
KOG3834		462	consensus Golgi reassembly stacking protein GRASP6	83.59
cd00394		161	Clp_protease_like Caseinolytic protease (ClpP) is	83.29
TIGR00706		207	SppA_dom signal peptide peptidase SppA, 36K type.	80.9

>PLN00049 carboxyl-terminal processing protease; Provisional	Back alignment and domain information

Probab=100.00  E-value=2.8e-67  Score=554.01  Aligned_cols=387  Identities=80%  Similarity=1.272  Sum_probs=344.6

Q ss_pred             chhHHHHHHHHHHHHHHcCCCCCCCCChHHHHHHHhccCCCCCHHHHHHHHHHHHHhcCCCCccccChhhhhhhccccCC
Q 009668          142 SEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQG  221 (529)
Q Consensus       142 s~~~~~fd~v~~~l~~~Y~~~~~~g~~w~~~~~~~~~~~~~~~~~~f~~~i~~~l~~L~Dpht~~l~~~~~~~~~~~~~~  221 (529)
                      ++.+++|+++|++++++|+++.++|++|+++++.+.....+++.++++.++++|+++|+|||+.|++++++..+.....+
T Consensus         3 ~~~~~~f~e~w~~v~~~~~d~~~~g~dW~~~~e~y~~~~~~~~~~~~~~~i~~ml~~L~D~hs~y~~~~~~~~~~~~~~~   82 (389)
T PLN00049          3 TEENLLFLEAWRTVDRAYVDKTFNGQSWFRYRENALKNEPMNTREETYAAIRKMLATLDDPFTRFLEPEKFKSLRSGTKG   82 (389)
T ss_pred             ccHHHHHHHHHHHHHHHHcCccccccCHHHHHHHHhhccCCCcHHHHHHHHHHHHhhCCCCcccCcCHHHHHHHHHhccC
Confidence            57889999999999999999999999999999999887777788899999999999999999999999998877666678


Q ss_pred             cceeeeEEEeecCCCCCCCCcEEEEEecCCCcccCCCCCCCCEEEEECCEecCCCCHHHHHHHhcCCCCCcEEEEEeeCC
Q 009668          222 ALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGA  301 (529)
Q Consensus       222 ~~~glG~~~~~~~~~~~~~~~~~V~~V~~gsPA~~aGL~~GD~IlaInG~~v~~~~~~~~~~~l~g~~G~~v~ltv~r~g  301 (529)
                      .+.|+|+.+...........+++|..|.++|||+++||++||+|++|||+++.++...++..++++..|+.+.+++.|++
T Consensus        83 ~~~GiG~~~~~~~~~~~~~~g~~V~~V~~~SPA~~aGl~~GD~Iv~InG~~v~~~~~~~~~~~l~g~~g~~v~ltv~r~g  162 (389)
T PLN00049         83 AVTGVGLEVGYPTGSDGPPAGLVVVAPAPGGPAARAGIRPGDVILAIDGTSTEGLSLYEAADRLQGPEGSSVELTLRRGP  162 (389)
T ss_pred             CceEEEEEEEEccCCCCccCcEEEEEeCCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHhcCCCCEEEEEEEECC
Confidence            89999999876422111112789999999999999999999999999999999887777888888889999999999999


Q ss_pred             eeEEEEEeeeccccccccceeeecCCCCCCCCceEEEEecccccchhHHHHHHHHHHhhCCCCeEEEEcCCCCCCChHHH
Q 009668          302 EIRHLALTREKVSLNPVKSRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEG  381 (529)
Q Consensus       302 ~~~~v~l~r~~~~~~~v~~~~~~~~~~~~~~~~igYl~i~sF~~~~~~~l~~~l~~l~~~~~~~LIIDLR~N~GG~~~~~  381 (529)
                      +.++++++|..+..+|+....+........+++||||+|++|...+.+++.+++++++++++++||||||+|+||.+..+
T Consensus       163 ~~~~~~l~r~~v~~~~v~~~~~~~~~~~~~~~~IgYi~i~~F~~~~~~~~~~~l~~l~~~~~~glIlDLR~N~GG~~~~a  242 (389)
T PLN00049        163 ETRLVTLTREKVSLNPVKSRLCEVPGPGAGSPKIGYIKLTTFNQNASSAVKEAIETLRANGVDAFVLDLRDNSGGLFPAG  242 (389)
T ss_pred             EEEEEEEEeeeEeccceeeEEEeeccccCCCCCEEEEEeccccchhHHHHHHHHHHHHHCCCCEEEEEcCCCCCCCHHHH
Confidence            99999999999888888776543211112346899999999999889999999999999999999999999999999999


Q ss_pred             HHHHHhhcCCCcEEEEEcCCCceeeeecCCCCcccCCCCEEEEECCCCCCHHHHHHHHHhcCCCeEEEccCCCCCceeee
Q 009668          382 IEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQS  461 (529)
Q Consensus       382 ~~l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gpv~VL~d~~TaSAaE~fa~~lk~~~~a~iVGe~T~G~~~~~~  461 (529)
                      ..++++|++++.+++...+++..+.+...+.....+.+|++||||++||||||+|+.+||+++++++||++|+|++..|.
T Consensus       243 ~~ia~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PvvVLvn~~TaSasEi~a~alk~~~~~~vvG~~T~Gkg~~q~  322 (389)
T PLN00049        243 IEIAKLWLDKGVIVYIADSRGVRDIYDADGSSAIATSEPLAVLVNKGTASASEILAGALKDNKRAVVLGEPTFGKGLIQS  322 (389)
T ss_pred             HHHHHHhcCCCcEEEEecCCCceeEEecCCCccccCCCCEEEEECCCCccHHHHHHHHHhhCCCeEEEecCCcCCcccce
Confidence            99999999999888776666655555554433345789999999999999999999999999999999999999999999


Q ss_pred             EEECCCCceEEEEeeEEEcCCCcccCCCCcccceEcCCCCCCChhhHhhhccCccccccccCCcccc
Q 009668          462 VFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTFPKDEDGFCGCLQDSASTCNMNGGQLFA  528 (529)
Q Consensus       462 ~~~L~~G~~l~lt~~~~~~p~G~~~e~~GV~PDi~V~~~~~~~~~~l~~~l~d~~~~~~~~~~~~~~  528 (529)
                      .++|++|+.+++|+++|++|+|..+|+.||+||++||..++.++++|++|+.||..+|+.++-|||+
T Consensus       323 ~~~L~dG~~l~lt~~~~~~p~G~~ie~~Gi~PDi~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  389 (389)
T PLN00049        323 VFELSDGSGLAVTVARYQTPAGTDIDKVGITPDHPLPESLPKDEEAFCGCLADPAAACYLNAPQLFS  389 (389)
T ss_pred             eEEeCCCCEEEEEEEEEECCCCCCcCCCCcCCCeECCCCCCcchHHHHHHhhcchhhcccchhhhcC
Confidence            9999999999999999999999999999999999999999999999999999999999999999985

>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK11186 carboxy-terminal protease; Provisional	Back alignment and domain information

>TIGR00225 prc C-terminal peptidase (prc)	Back alignment and domain information

>cd06567 Peptidase_S41 C-terminal processing peptidase family S41	Back alignment and domain information

>cd07562 Peptidase_S41_TRI Tricorn protease; serine protease family S41	Back alignment and domain information

>cd07563 Peptidase_S41_IRBP Interphotoreceptor retinoid-binding protein; serine protease family S41	Back alignment and domain information

>smart00245 TSPc tail specific protease	Back alignment and domain information

>cd07560 Peptidase_S41_CPP C-terminal processing peptidase; serine protease family S41	Back alignment and domain information

>cd07561 Peptidase_S41_CPP_like C-terminal processing peptidase-like; serine protease family S41	Back alignment and domain information

>PF03572 Peptidase_S41: Peptidase family S41; InterPro: IPR005151 This group of putative serine peptidases belong to the MEROPS peptidase family S41 (C-terminal processing peptidase family, clan SM)	Back alignment and domain information

>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only]	Back alignment and domain information

>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C	Back alignment and domain information

>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts	Back alignment and domain information

>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms	Back alignment and domain information

>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms	Back alignment and domain information

>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif)	Back alignment and domain information

>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases	Back alignment and domain information

>PF14684 Tricorn_C1: Tricorn protease C1 domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A	Back alignment and domain information

>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases	Back alignment and domain information

>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ]	Back alignment and domain information

>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis	Back alignment and domain information

>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2	Back alignment and domain information

>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements	Back alignment and domain information

>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A	Back alignment and domain information

>TIGR00054 RIP metalloprotease RseP	Back alignment and domain information

>PRK10139 serine endoprotease; Provisional	Back alignment and domain information

>PRK10898 serine endoprotease; Provisional	Back alignment and domain information

>TIGR02038 protease_degS periplasmic serine pepetdase DegS	Back alignment and domain information

>TIGR01713 typeII_sec_gspC general secretion pathway protein C	Back alignment and domain information

>PRK10779 zinc metallopeptidase RseP; Provisional	Back alignment and domain information

>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family	Back alignment and domain information

>PRK10779 zinc metallopeptidase RseP; Provisional	Back alignment and domain information

>PRK10942 serine endoprotease; Provisional	Back alignment and domain information

>TIGR02860 spore_IV_B stage IV sporulation protein B	Back alignment and domain information

>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family	Back alignment and domain information

>PRK10139 serine endoprotease; Provisional	Back alignment and domain information

>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous	Back alignment and domain information

>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase	Back alignment and domain information

>PRK10942 serine endoprotease; Provisional	Back alignment and domain information

>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3209 consensus WW domain-containing protein [General function prediction only]	Back alignment and domain information

>TIGR00054 RIP metalloprotease RseP	Back alignment and domain information

>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures]	Back alignment and domain information

>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG3209 consensus WW domain-containing protein [General function prediction only]	Back alignment and domain information

>PRK09681 putative type II secretion protein GspC; Provisional	Back alignment and domain information

>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only]	Back alignment and domain information

>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures]	Back alignment and domain information

>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only]	Back alignment and domain information

>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton]	Back alignment and domain information

>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms]	Back alignment and domain information

>KOG3532 consensus Predicted protein kinase [General function prediction only]	Back alignment and domain information

>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease	Back alignment and domain information

>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only]	Back alignment and domain information

>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only]	Back alignment and domain information

>KOG3551 consensus Syntrophins (type beta) [Extracellular structures]	Back alignment and domain information

>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms]	Back alignment and domain information

>PF12812 PDZ_1: PDZ-like domain	Back alignment and domain information

>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease	Back alignment and domain information

>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only]	Back alignment and domain information

>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease	Back alignment and domain information

>KOG1738 consensus Membrane-associated guanylate kinase-interacting protein/connector enhancer of KSR-like [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease	Back alignment and domain information

>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		529
1fc7_A		388	Photosystem Ii D1 C-Terminal Processing Protease Le		1e-107
1fc6_A		388	Photosystem Ii D1 C-Terminal Processing Protease Le		1e-105

>pdb|1FC7|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388

Back alignment and structure

Iteration: 1

Score = 385 bits (990), Expect = e-107, Method: Compositional matrix adjust. Identities = 197/386 (51%), Positives = 268/386 (69%), Gaps = 13/386 (3%) Query: 141 LSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLD 200 ++ E LFLEAWR +DRAYVDK+FNGQSWF+ RE L+ EPM+ R +TY AIRK+LA LD Sbjct: 2 VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLD 61 Query: 201 DPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGIL 260 DPFTRFLEP + +LR GT G++TGVGL I Y GS +VV++ PGGPA +AG Sbjct: 62 DPFTRFLEPSRLAALRRGTAGSVTGVGLEITY---DGGSGKDVVVLTPAPGGPAEKAGAR 118 Query: 261 SGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRS-GA--EIRHLALTREKVSLNP 317 +GDVI+ +D T+ + + +YD ++ LQG S VE+ + + GA R L LTR+KV++NP Sbjct: 119 AGDVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINP 178 Query: 318 VKSRLC-----VVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRD 372 V C PG + ++GY++L +FN N + A ++A L V VLD+R+ Sbjct: 179 VTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRN 238 Query: 373 NSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASA 432 N GGLFP G+ +A++ +D+G +V I DS+G+RDIY DG +++ ++ PL VLVN+GTASA Sbjct: 239 NGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADG-NSIDSATPLVVLVNRGTASA 297 Query: 433 SEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVI 492 SE+LAGALKD+KR ++ GE T+GKG IQ+V LSDGSG+AVTVARY+TPA DI+K+GV Sbjct: 298 SEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVS 357 Query: 493 PDHPL-PKTFPKDEDGFCGCLQDSAS 517 PD L P+ P D +G C L A+ Sbjct: 358 PDVQLDPEVLPTDLEGVCRVLGSDAA 383

PyMOL of 1fc7

>pdb|1FC6|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		529
1fc6_A		388	Photosystem II D1 protease; D1 C-terminal processi	1e-170
3k50_A		403	Putative S41 protease; structural genomics, joint	5e-79
1k32_A		1045	Tricorn protease; protein degradation, substrate g	2e-67
1j7x_A		302	IRBP, interphotoreceptor retinoid-binding protein;	2e-57
3dor_A		583	Protein CT_858, CPAF; mature CPAF, dimer, transfer	2e-42
1w9e_A		166	Syntenin 1; cell adhesion, adhesion/complex, PDZ d	6e-18
2eeg_A		94	PDZ and LIM domain protein 4; PDZ domain, structur	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
1m5z_A		91	GRIP, AMPA receptor interacting protein; six beta-	5e-09
2pzd_A		113	Serine protease HTRA2; PDZ domain, apoptosis, mito	5e-09
2uzc_A		88	Human pdlim5, PDZ and LIM domain 5; metal-binding,	6e-09
2jil_A		97	GRIP1 protein, glutamate receptor interacting prot	7e-09
2d92_A		108	INAD-like protein; PDZ domain, inadl protein, hina	8e-09
1v5l_A		103	PDZ and LIM domain 3; actinin alpha 2 associated L	8e-09
2i04_A		85	Membrane-associated guanylate kinase, WW and PDZ d	8e-09
2w4f_A		97	Protein LAP4; structural protein, phosphoprotein,	9e-09
2p3w_A		112	Probable serine protease HTRA3; PDZ domain, phage	9e-09
3khf_A		99	Microtubule-associated serine/threonine-protein ki	1e-08
1rgw_A		85	ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK,	1e-08
2pa1_A		87	PDZ and LIM domain protein 2; PDZ domain, structur	1e-08
2ego_A		96	General receptor for phosphoinositides 1- associat	1e-08
2q3g_A		89	PDZ and LIM domain protein 7; structural genomics,	1e-08
2qt5_A		200	Glutamate receptor-interacting protein 1; PDZ-pept	2e-08
2qt5_A		200	Glutamate receptor-interacting protein 1; PDZ-pept	1e-05
2eaq_A		90	LIM domain only protein 7; conserved hypothetical	2e-08
2eei_A		106	PDZ domain-containing protein 1; regulatory factor	2e-08
1wif_A		126	RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s	2e-08
2jre_A		108	C60-1 PDZ domain peptide; de novo protein; NMR {Sy	3e-08
1wf7_A		103	Enigma homologue protein; PDZ domain, structural g	3e-08
2awx_A		105	Synapse associated protein 97; membrane protein, s	3e-08
2pkt_A		91	PDZ and LIM domain protein 1; PDZ domain, structur	4e-08
2jxo_A		98	Ezrin-radixin-moesin-binding phosphoprotein 50; nh	4e-08
2fe5_A		94	Presynaptic protein SAP102; PDZ domain, DLG3, huma	4e-08
1y8t_A		324	Hypothetical protein RV0983; serine protease, stru	4e-08
1x5q_A		110	LAP4 protein; PDZ domain, scribble homolog protein	4e-08
1vb7_A		94	PDZ and LIM domain 2; PDZ domain PDZ-LIM protein,	4e-08
2iwn_A		97	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	4e-08
3gsl_A		196	Disks large homolog 4; PDZ domain, tandem, PSD-95,	5e-08
3gsl_A		196	Disks large homolog 4; PDZ domain, tandem, PSD-95,	9e-07
1g9o_A		91	NHE-RF; PDZ domain, complex, signaling protein; 1.	5e-08
2dlu_A		111	INAD-like protein; PDZ domain, inadl protein, hina	5e-08
2dkr_A		93	LIN-7 homolog B; LIN-7B, PDZ, structural genomics,	8e-08
3tsv_A		124	Tight junction protein ZO-1; PDZ, scaffolding, JAM	9e-08
2kpk_A		129	Membrane-associated guanylate kinase, WW and PDZ c	9e-08
3k1r_A		192	Harmonin; protein-protein complex, alternative spl	9e-08
2zpm_A		91	Regulator of sigma E protease; metalloproteinase,	1e-07
2i1n_A		102	Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig	1e-07
1ueq_A		123	Membrane associated guanylate kinase inverted-2 (M	1e-07
2jik_A		101	Synaptojanin-2 binding protein; transmembrane, out	1e-07
2kv8_A		83	RGS12, regulator of G-protein signaling 12; PDZ do	1e-07
2fne_A		117	Multiple PDZ domain protein; structural protein, s	1e-07
2v90_A		96	PDZ domain-containing protein 3; membrane, protein	1e-07
2kjd_A		128	Sodium/hydrogen exchange regulatory cofactor NHE-	1e-07
1ihj_A		98	INAD; intermolecular disulfide bond, PDZ domain, s	1e-07
2he4_A		90	Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p	2e-07
2vz5_A		139	TAX1-binding protein 3; WNT signaling pathway, pro	2e-07
2byg_A		117	Channel associated protein of synapse-110; DLG2, P	2e-07
2i4s_A		105	General secretion pathway protein C; EPSC, GSPC, P	2e-07
2fcf_A		103	Multiple PDZ domain protein; adaptor molecule, pro	2e-07
4fgm_A		597	Aminopeptidase N family protein; structural genomi	2e-07
2vsp_A		91	PDZ domain-containing protein 1; membrane, cytopla	2e-07
1uit_A		117	Human discs large 5 protein; PDZ domain, HDLG5, ma	2e-07
2krg_A		216	Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a	2e-07
3e17_A		88	Tight junction protein ZO-2; domain swapping, alte	2e-07
2g5m_B		113	Neurabin-2; spinophilin, PDZ domain, CNS, synaptic	2e-07
3i4w_A		104	Disks large homolog 4; alpha and beta protein, alt	2e-07
2koj_A		111	Partitioning defective 3 homolog; PDZ domain, stru	2e-07
1p1d_A		196	PDZ45, glutamate receptor interacting protein; PDZ	2e-07
1p1d_A		196	PDZ45, glutamate receptor interacting protein; PDZ	2e-06
3qe1_A		107	Sorting nexin-27, G protein-activated inward RECT	2e-07
2q9v_A		90	Membrane-associated guanylate kinase, WW and PDZ c	3e-07
1n7e_A		97	AMPA receptor interacting protein GRIP; PDZ, prote	3e-07
2vsv_A		109	Rhophilin-2; scaffold protein, RHO GTPase binding,	3e-07
3cyy_A		92	Tight junction protein ZO-1; protein-ligand comple	3e-07
2edz_A		114	PDZ domain-containing protein 1; CFTR-associated p	3e-07
2iwq_A		123	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	3e-07
2eno_A		120	Synaptojanin-2-binding protein; mitochondrial oute	3e-07
1uew_A		114	Membrane associated guanylate kinase inverted-2 (M	3e-07
2kom_A		121	Partitioning defective 3 homolog; PAR-3B, PDZ doma	3e-07
1vae_A		111	Rhophilin 2, rhophilin, RHO GTPase binding protein	4e-07
2qkv_A		96	Inactivation-NO-after-potential D protein; PDZ dom	4e-07
1v62_A		117	KIAA1719 protein; structural genomics, synaptic tr	4e-07
1i16_A		130	Interleukin 16, LCF; cytokine, lymphocyte chemoatt	4e-07
2dc2_A		103	GOPC, golgi associated PDZ and coiled-coil motif c	4e-07
2rcz_A		81	Tight junction protein ZO-1; PDZ, domain-swapping,	4e-07
1b8q_A		127	Protein (neuronal nitric oxide synthase); PDZ doma	5e-07
1wfv_A		103	Membrane associated guanylate kinase inverted-2; a	5e-07
2gzv_A		114	PRKCA-binding protein; protein kinase C, PDZ domai	5e-07
2r4h_A		112	Membrane-associated guanylate kinase, WW and PDZ c	5e-07
2i6v_A		87	General secretion pathway protein C; EPSC, GSPC, P	6e-07
1v5q_A		122	GRIP1 homolog, glutamate receptor interacting prot	6e-07
2ehr_A		117	INAD-like protein; PDZ domain, inadl protein, hina	6e-07
2qg1_A		92	Multiple PDZ domain protein; MPDZ, MUPP1, structur	7e-07
3suz_A		388	Amyloid beta A4 precursor protein-binding family 2	7e-07
3suz_A		388	Amyloid beta A4 precursor protein-binding family 2	4e-05
2vwr_A		95	Ligand of NUMB protein X 2; protein-binding, metal	7e-07
3axa_A		106	Afadin, nectin-3, protein AF-6; PDZ domain, fusion	7e-07
2f5y_A		91	Regulator of G-protein signalling 3 isoform 1; PDZ	8e-07
3ngh_A		106	PDZ domain-containing protein 1; adaptor protein,	8e-07
2lob_A		112	Golgi-associated PDZ and coiled-coil motif-contai	8e-07
2opg_A		98	Multiple PDZ domain protein; structural protein, s	8e-07
3egg_C		170	Spinophilin; PP1, serine/threonine phosphatase, po	8e-07
2daz_A		124	INAD-like protein; PDZ domain, inadl protein, hina	9e-07
2dm8_A		116	INAD-like protein; PDZ domain, inadl protein, hina	9e-07
3hpk_A		125	Protein interacting with PRKCA 1; oxidized, PDZ do	1e-06
2la8_A		106	Inactivation-NO-after-potential D protein, KON-TI	1e-06
1um7_A		113	Synapse-associated protein 102; PDZ, discs large h	1e-06
1lcy_A		325	HTRA2 serine protease; apoptosis, PDZ domain, casp	1e-06
2dls_A		93	PDZ-rhogef, RHO guanine nucleotide exchange factor	1e-06
1wf8_A		107	Neurabin-I; PDZ domain, structural genomics, NPPSF	1e-06
1um1_A		110	KIAA1849 protein, RSGI RUH-007; PDZ domain, human	1e-06
3gge_A		95	PDZ domain-containing protein GIPC2; structural ge	1e-06
1tp5_A		119	Presynaptic density protein 95; PDZ-peptide ligand	1e-06
2hga_A		125	Conserved protein MTH1368; GFT structural genomics	2e-06
3num_A		332	Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom	2e-06
1uf1_A		128	KIAA1526 protein; PDZ domain, structural genomics,	2e-06
2djt_A		104	Unnamed protein product; PDZ domain, structural ge	2e-06
2z17_A		104	Pleckstrin homology SEC7 and coiled-coil domains-	2e-06
2edv_A		96	FERM and PDZ domain-containing protein 1; cytoskel	2e-06
2kjp_A		91	Uncharacterized protein YLBL; mixed alpha-beta pro	2e-06
1d5g_A		96	Human phosphatase HPTP1E; protein-peptide complex,	2e-06
2yt7_A		101	Amyloid beta A4 precursor protein-binding family A	2e-06
1q7x_A		108	PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str	2e-06
3r68_A		95	Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P	2e-06
2iwo_A		120	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	2e-06
2kl1_A		94	YLBL protein; structure genomics, structural genom	2e-06
2yuy_A		126	RHO GTPase activating protein 21; PDZ domain, stru	2e-06
1wha_A		105	KIAA0147 protein, scribble; PDZ domain, cellular s	2e-06
1te0_A		318	Protease DEGS; two domains, serine protease, PDZ,	2e-06
1uep_A		103	Membrane associated guanylate kinase inverted-2 (M	3e-06
1q3o_A		109	Shank1; PDZ, GKAP, peptide binding protein; 1.80A	3e-06
2l97_A		134	HTRA, putative serine protease; HTRA-PDZ, protein	3e-06
1whd_A		100	RGS3, regulator of G-protein signaling 3; PDZ doma	3e-06
3rle_A		209	Golgi reassembly-stacking protein 2; PDZ, tether,	3e-06
3rle_A		209	Golgi reassembly-stacking protein 2; PDZ, tether,	1e-05
2eeh_A		100	PDZ domain-containing protein 7; structural genomi	3e-06
3pv2_A		451	DEGQ; trypsin fold, PDZ domain, chaperone protease	4e-06
3pv2_A		451	DEGQ; trypsin fold, PDZ domain, chaperone protease	7e-06
3r0h_A		206	INAD, inactivation-NO-after-potential D protein; p	4e-06
2h2b_A		107	Tight junction protein ZO-1; PDZ domain, phage der	4e-06
1qau_A		112	Neuronal nitric oxide synthase (residues 1-130); b	5e-06
1wg6_A		127	Hypothetical protein (riken cDNA 2810455B10); stru	5e-06
1qav_A		90	Alpha-1 syntrophin (residues 77-171); beta-finger,	5e-06
2d90_A		102	PDZ domain containing protein 1; structural genomi	5e-06
1ky9_A		448	Protease DO, DEGP, HTRA; protein quality control,	5e-06
1ky9_A		448	Protease DO, DEGP, HTRA; protein quality control,	7e-06
1r6j_A		82	Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap	6e-06
4a8c_A		436	Periplasmic PH-dependent serine endoprotease DEGQ;	6e-06
4a8c_A		436	Periplasmic PH-dependent serine endoprotease DEGQ;	9e-06
3stj_A		345	Protease DEGQ; serine protease, PDZ domain, protea	7e-06
3bpu_A		88	Membrane-associated guanylate kinase, WW and PDZ c	8e-06
2xkx_A		721	Disks large homolog 4; structural protein, scaffol	8e-06
2xkx_A		721	Disks large homolog 4; structural protein, scaffol	2e-04
3cbz_A		108	Dishevelled-2; PDZ domain, phage derived high affi	9e-06
3id1_A		95	Regulator of sigma E protease; hydrolase, cell inn	1e-05
2dmz_A		129	INAD-like protein; PDZ domain, inadl protein, hina	1e-05
1wh1_A		124	KIAA1095 protein; PDZ domain, structural genomics,	1e-05
2ejy_A		97	55 kDa erythrocyte membrane protein; GPC, maguk, P	1e-05
1ujd_A		117	KIAA0559 protein; PDZ domain, structural genomics,	1e-05
3b76_A		118	E3 ubiquitin-protein ligase LNX; PDZ, bound ligand	1e-05
1uez_A		101	KIAA1526 protein; PDZ domain, structural genomics,	1e-05
1uhp_A		107	Hypothetical protein KIAA1095; PDZ domain, semapho	1e-05
1ujv_A		96	Membrane associated guanylate kinase inverted-2 (M	2e-05
1v6b_A		118	Harmonin isoform A1; structural genomics, usher sy	2e-05
3l4f_D		132	SH3 and multiple ankyrin repeat domains protein 1;	2e-05
2csj_A		117	TJP2 protein; PDZ domain, structural genomics, NPP	2e-05
3o46_A		93	Maguk P55 subfamily member 7; PDZ domain, structur	2e-05
3soe_A		113	Membrane-associated guanylate kinase, WW and PDZ c	2e-05
1wi2_A		104	Riken cDNA 2700099C19; structural genomics, riken	3e-05
2db5_A		128	INAD-like protein; PDZ domain, hinadl, PALS1- asso	3e-05
1x5n_A		114	Harmonin; PDZ domain, usher syndrome 1C protein, a	4e-05
1x6d_A		119	Interleukin-16; PDZ domain, lymphocyte chemoattrac	5e-05
1uju_A		111	Scribble; PDZ domain, cellular signaling, structur	5e-05
2d8i_A		114	T-cell lymphoma invasion and metastasis 1 variant;	7e-05
1ufx_A		103	KIAA1526 protein; PDZ domain, structural genomics,	7e-05
3kzd_A		94	TIAM-1, T-lymphoma invasion and metastasis-inducin	8e-05
2o2t_A		117	Multiple PDZ domain protein; structural protein, s	8e-05
3i18_A		100	LMO2051 protein; alpha-beta protein, structural ge	8e-05
1y7n_A		90	Amyloid beta A4 precursor protein-binding family A	8e-05
1nf3_C		128	PAR-6B; semi-CRIB motif, switch I and II, PDZ doma	1e-04
3qo6_A		348	Protease DO-like 1, chloroplastic; protease, HTRA,	1e-04
1wi4_A		109	Synip, syntaxin binding protein 4; syntaxin4-inter	1e-04
1kwa_A		88	Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca	2e-04
1wfg_A		131	Regulating synaptic membrane exocytosis protein 2;	2e-04
3nfk_A		107	Tyrosine-protein phosphatase non-receptor type 4;	2e-04
1va8_A		113	Maguk P55 subfamily member 5; PDZ domain, palmitoy	2e-04
1n7t_A		103	99-MER peptide of densin-180-like protein; PDZ dom	3e-04
2edp_A		100	Fragment, shroom family member 4; APX/shroom famil	3e-04
1mfg_A		95	ERB-B2 interacting protein; PDZ domain, protein-pe	3e-04

>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388	Back alignment and structure

 Score =  486 bits (1253), Expect = e-170
 Identities = 197/386 (51%), Positives = 265/386 (68%), Gaps = 13/386 (3%)

Query: 141 LSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLD 200
           ++ E  LFLEAWR +DRAYVDK+FNGQSWF+ RE  L+ EPM+ R +TY AIRKMLA LD
Sbjct: 2   VTSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLD 61

Query: 201 DPFTRFLEPEKFNSLRSGTQGALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGIL 260
           DPFTRFLEP +  +LR GT G++TGVGL I Y     GS   +VV++  PGGPA +AG  
Sbjct: 62  DPFTRFLEPSRLAALRRGTAGSVTGVGLEITYD---GGSGKDVVVLTPAPGGPAEKAGAR 118

Query: 261 SGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVR---SGAEIRHLALTREKVSLNP 317
           +GDVI+ +D T+ + M +YD ++ LQG   S VE+ +    + +  R L LTR+KV++NP
Sbjct: 119 AGDVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINP 178

Query: 318 VKSRLC-----VVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRD 372
           V    C         PG +  ++GY++L +FN N + A ++A   L    V   VLD+R+
Sbjct: 179 VTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRN 238

Query: 373 NSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASA 432
           N GGLFP G+ +A++ +D+G +V I DS+G+RDIY  DG   + ++ PL VLVN+GTASA
Sbjct: 239 NGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGNS-IDSATPLVVLVNRGTASA 297

Query: 433 SEILAGALKDNKRAVLFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVI 492
           SE+LAGALKD+KR ++ GE T+GKG IQ+V  LSDGSG+AVTVARY+TPA  DI+K+GV 
Sbjct: 298 SEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVS 357

Query: 493 PDHPL-PKTFPKDEDGFCGCLQDSAS 517
           PD  L P+  P D +G C  L   A+
Sbjct: 358 PDVQLDPEVLPTDLEGVCRVLGSDAA 383

PyMOL of 1fc6

>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045	Back alignment and structure

>1j7x_A IRBP, interphotoreceptor retinoid-binding protein; beta BETA alpha spiral, transport protein; 1.80A {Xenopus laevis} SCOP: c.14.1.2 Length = 302	Back alignment and structure

>3dor_A Protein CT_858, CPAF; mature CPAF, dimer, transferase; 2.20A {Chlamydia trachomatis} PDB: 3dpm_A* 3dpn_A 3dja_A Length = 583	Back alignment and structure

>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166	Back alignment and structure

>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91	Back alignment and structure

>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113	Back alignment and structure

>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88	Back alignment and structure

>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97	Back alignment and structure

>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108	Back alignment and structure

>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85	Back alignment and structure

>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97	Back alignment and structure

>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112	Back alignment and structure

>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99	Back alignment and structure

>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85	Back alignment and structure

>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87	Back alignment and structure

>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96	Back alignment and structure

>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89	Back alignment and structure

>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200	Back alignment and structure

>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200	Back alignment and structure

>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90	Back alignment and structure

>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106	Back alignment and structure

>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126	Back alignment and structure

>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108	Back alignment and structure

>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105	Back alignment and structure

>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91	Back alignment and structure

>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98	Back alignment and structure

>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94	Back alignment and structure

>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324	Back alignment and structure

>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110	Back alignment and structure

>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94	Back alignment and structure

>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97	Back alignment and structure

>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196	Back alignment and structure

>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196	Back alignment and structure

>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91	Back alignment and structure

>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111	Back alignment and structure

>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93	Back alignment and structure

>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124	Back alignment and structure

>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129	Back alignment and structure

>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192	Back alignment and structure

>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91	Back alignment and structure

>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102	Back alignment and structure

>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123	Back alignment and structure

>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101	Back alignment and structure

>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96	Back alignment and structure

>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128	Back alignment and structure

>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98	Back alignment and structure

>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90	Back alignment and structure

>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139	Back alignment and structure

>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105	Back alignment and structure

>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597	Back alignment and structure

>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91	Back alignment and structure

>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216	Back alignment and structure

>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88	Back alignment and structure

>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113	Back alignment and structure

>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104	Back alignment and structure

>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111	Back alignment and structure

>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196	Back alignment and structure

>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196	Back alignment and structure

>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90	Back alignment and structure

>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97	Back alignment and structure

>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109	Back alignment and structure

>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92	Back alignment and structure

>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114	Back alignment and structure

>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123	Back alignment and structure

>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120	Back alignment and structure

>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114	Back alignment and structure

>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121	Back alignment and structure

>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111	Back alignment and structure

>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96	Back alignment and structure

>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130	Back alignment and structure

>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103	Back alignment and structure

>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81	Back alignment and structure

>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127	Back alignment and structure

>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114	Back alignment and structure

>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112	Back alignment and structure

>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87	Back alignment and structure

>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122	Back alignment and structure

>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117	Back alignment and structure

>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92	Back alignment and structure

>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388	Back alignment and structure

>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388	Back alignment and structure

>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95	Back alignment and structure

>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106	Back alignment and structure

>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91	Back alignment and structure

>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106	Back alignment and structure

>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112	Back alignment and structure

>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98	Back alignment and structure

>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170	Back alignment and structure

>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124	Back alignment and structure

>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116	Back alignment and structure

>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125	Back alignment and structure

>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106	Back alignment and structure

>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113	Back alignment and structure

>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325	Back alignment and structure

>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93	Back alignment and structure

>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107	Back alignment and structure

>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110	Back alignment and structure

>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95	Back alignment and structure

>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119	Back alignment and structure

>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125	Back alignment and structure

>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332	Back alignment and structure

>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128	Back alignment and structure

>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104	Back alignment and structure

>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104	Back alignment and structure

>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96	Back alignment and structure

>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91	Back alignment and structure

>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96	Back alignment and structure

>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101	Back alignment and structure

>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108	Back alignment and structure

>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95	Back alignment and structure

>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120	Back alignment and structure

>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94	Back alignment and structure

>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126	Back alignment and structure

>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105	Back alignment and structure

>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318	Back alignment and structure

>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109	Back alignment and structure

>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134	Back alignment and structure

>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100	Back alignment and structure

>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209	Back alignment and structure

>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209	Back alignment and structure

>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100	Back alignment and structure

>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451	Back alignment and structure

>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451	Back alignment and structure

>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206	Back alignment and structure

>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107	Back alignment and structure

>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112	Back alignment and structure

>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127	Back alignment and structure

>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90	Back alignment and structure

>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102	Back alignment and structure

>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448	Back alignment and structure

>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448	Back alignment and structure

>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82	Back alignment and structure

>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436	Back alignment and structure

>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436	Back alignment and structure

>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345	Back alignment and structure

>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88	Back alignment and structure

>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721	Back alignment and structure

>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721	Back alignment and structure

>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108	Back alignment and structure

>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95	Back alignment and structure

>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129	Back alignment and structure

>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124	Back alignment and structure

>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97	Back alignment and structure

>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118	Back alignment and structure

>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101	Back alignment and structure

>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107	Back alignment and structure

>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96	Back alignment and structure

>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118	Back alignment and structure

>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132	Back alignment and structure

>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117	Back alignment and structure

>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93	Back alignment and structure

>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113	Back alignment and structure

>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104	Back alignment and structure

>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128	Back alignment and structure

>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114	Back alignment and structure

>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119	Back alignment and structure

>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111	Back alignment and structure

>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114	Back alignment and structure

>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103	Back alignment and structure

>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94	Back alignment and structure

>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117	Back alignment and structure

>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100	Back alignment and structure

>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90	Back alignment and structure

>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128	Back alignment and structure

>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348	Back alignment and structure

>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109	Back alignment and structure

>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88	Back alignment and structure

>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131	Back alignment and structure

>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107	Back alignment and structure

>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113	Back alignment and structure

>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103	Back alignment and structure

>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100	Back alignment and structure

>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		529
1fc6_A		388	Photosystem II D1 protease; D1 C-terminal processi	100.0
1k32_A		1045	Tricorn protease; protein degradation, substrate g	100.0
3k50_A		403	Putative S41 protease; structural genomics, joint	100.0
3dor_A		583	Protein CT_858, CPAF; mature CPAF, dimer, transfer	100.0
1j7x_A		302	IRBP, interphotoreceptor retinoid-binding protein;	99.97
4fgm_A		597	Aminopeptidase N family protein; structural genomi	99.71
2kom_A		121	Partitioning defective 3 homolog; PAR-3B, PDZ doma	99.32
2koj_A		111	Partitioning defective 3 homolog; PDZ domain, stru	99.28
2edz_A		114	PDZ domain-containing protein 1; CFTR-associated p	99.17
2byg_A		117	Channel associated protein of synapse-110; DLG2, P	99.15
2r4h_A		112	Membrane-associated guanylate kinase, WW and PDZ c	99.11
1qau_A		112	Neuronal nitric oxide synthase (residues 1-130); b	99.09
2vz5_A		139	TAX1-binding protein 3; WNT signaling pathway, pro	99.08
2jre_A		108	C60-1 PDZ domain peptide; de novo protein; NMR {Sy	99.08
2jxo_A		98	Ezrin-radixin-moesin-binding phosphoprotein 50; nh	99.06
2v90_A		96	PDZ domain-containing protein 3; membrane, protein	99.04
2dm8_A		116	INAD-like protein; PDZ domain, inadl protein, hina	99.03
2w4f_A		97	Protein LAP4; structural protein, phosphoprotein,	99.03
1wfv_A		103	Membrane associated guanylate kinase inverted-2; a	99.02
2pkt_A		91	PDZ and LIM domain protein 1; PDZ domain, structur	99.02
1x5q_A		110	LAP4 protein; PDZ domain, scribble homolog protein	99.01
3b76_A		118	E3 ubiquitin-protein ligase LNX; PDZ, bound ligand	99.01
1wg6_A		127	Hypothetical protein (riken cDNA 2810455B10); stru	99.01
2he4_A		90	Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p	99.0
2eaq_A		90	LIM domain only protein 7; conserved hypothetical	98.99
2pa1_A		87	PDZ and LIM domain protein 2; PDZ domain, structur	98.99
2vsp_A		91	PDZ domain-containing protein 1; membrane, cytopla	98.98
2dls_A		93	PDZ-rhogef, RHO guanine nucleotide exchange factor	98.97
1g9o_A		91	NHE-RF; PDZ domain, complex, signaling protein; 1.	98.97
1n7e_A		97	AMPA receptor interacting protein GRIP; PDZ, prote	98.97
3l4f_D		132	SH3 and multiple ankyrin repeat domains protein 1;	98.96
1uep_A		103	Membrane associated guanylate kinase inverted-2 (M	98.96
2kjp_A		91	Uncharacterized protein YLBL; mixed alpha-beta pro	98.96
2yuy_A		126	RHO GTPase activating protein 21; PDZ domain, stru	98.96
2iwq_A		123	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	98.95
2l97_A		134	HTRA, putative serine protease; HTRA-PDZ, protein	98.95
1d5g_A		96	Human phosphatase HPTP1E; protein-peptide complex,	98.95
2awx_A		105	Synapse associated protein 97; membrane protein, s	98.95
1r6j_A		82	Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap	98.95
3bpu_A		88	Membrane-associated guanylate kinase, WW and PDZ c	98.95
1b8q_A		127	Protein (neuronal nitric oxide synthase); PDZ doma	98.94
2uzc_A		88	Human pdlim5, PDZ and LIM domain 5; metal-binding,	98.94
3i18_A		100	LMO2051 protein; alpha-beta protein, structural ge	98.94
3sfj_A		104	TAX1-binding protein 3; PDZ:peptide complex, signa	98.94
1v6b_A		118	Harmonin isoform A1; structural genomics, usher sy	98.94
2kl1_A		94	YLBL protein; structure genomics, structural genom	98.94
2opg_A		98	Multiple PDZ domain protein; structural protein, s	98.94
1wh1_A		124	KIAA1095 protein; PDZ domain, structural genomics,	98.93
2dmz_A		129	INAD-like protein; PDZ domain, inadl protein, hina	98.92
2db5_A		128	INAD-like protein; PDZ domain, hinadl, PALS1- asso	98.92
2q3g_A		89	PDZ and LIM domain protein 7; structural genomics,	98.92
1kwa_A		88	Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca	98.92
2jil_A		97	GRIP1 protein, glutamate receptor interacting prot	98.92
2qkv_A		96	Inactivation-NO-after-potential D protein; PDZ dom	98.92
2djt_A		104	Unnamed protein product; PDZ domain, structural ge	98.92
3ngh_A		106	PDZ domain-containing protein 1; adaptor protein,	98.91
2f5y_A		91	Regulator of G-protein signalling 3 isoform 1; PDZ	98.91
2d90_A		102	PDZ domain containing protein 1; structural genomi	98.9
1ihj_A		98	INAD; intermolecular disulfide bond, PDZ domain, s	98.9
1um1_A		110	KIAA1849 protein, RSGI RUH-007; PDZ domain, human	98.9
1i16_A		130	Interleukin 16, LCF; cytokine, lymphocyte chemoatt	98.9
1uez_A		101	KIAA1526 protein; PDZ domain, structural genomics,	98.89
2iwo_A		120	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	98.89
4amh_A		106	Disks large homolog 1; permutation, protein foldin	98.89
3cyy_A		92	Tight junction protein ZO-1; protein-ligand comple	98.89
1w9e_A		166	Syntenin 1; cell adhesion, adhesion/complex, PDZ d	98.89
2kjd_A		128	Sodium/hydrogen exchange regulatory cofactor NHE-	98.88
2iwn_A		97	Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP	98.88
2i04_A		85	Membrane-associated guanylate kinase, WW and PDZ d	98.87
1wif_A		126	RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s	98.87
2vwr_A		95	Ligand of NUMB protein X 2; protein-binding, metal	98.87
2eeh_A		100	PDZ domain-containing protein 7; structural genomi	98.87
3r68_A		95	Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P	98.87
3axa_A		106	Afadin, nectin-3, protein AF-6; PDZ domain, fusion	98.86
1rgw_A		85	ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK,	98.86
2vsv_A		109	Rhophilin-2; scaffold protein, RHO GTPase binding,	98.86
1wf7_A		103	Enigma homologue protein; PDZ domain, structural g	98.86
2jik_A		101	Synaptojanin-2 binding protein; transmembrane, out	98.85
2zpm_A		91	Regulator of sigma E protease; metalloproteinase,	98.85
2pzd_A		113	Serine protease HTRA2; PDZ domain, apoptosis, mito	98.84
1m5z_A		91	GRIP, AMPA receptor interacting protein; six beta-	98.84
2g5m_B		113	Neurabin-2; spinophilin, PDZ domain, CNS, synaptic	98.84
2fne_A		117	Multiple PDZ domain protein; structural protein, s	98.84
2qg1_A		92	Multiple PDZ domain protein; MPDZ, MUPP1, structur	98.84
2fcf_A		103	Multiple PDZ domain protein; adaptor molecule, pro	98.84
2o2t_A		117	Multiple PDZ domain protein; structural protein, s	98.84
2i1n_A		102	Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig	98.83
2eeg_A		94	PDZ and LIM domain protein 4; PDZ domain, structur	98.83
2fe5_A		94	Presynaptic protein SAP102; PDZ domain, DLG3, huma	98.83
2kv8_A		83	RGS12, regulator of G-protein signaling 12; PDZ do	98.83
1ujv_A		96	Membrane associated guanylate kinase inverted-2 (M	98.83
3khf_A		99	Microtubule-associated serine/threonine-protein ki	98.83
1whd_A		100	RGS3, regulator of G-protein signaling 3; PDZ doma	98.83
3tsv_A		124	Tight junction protein ZO-1; PDZ, scaffolding, JAM	98.82
2yt7_A		101	Amyloid beta A4 precursor protein-binding family A	98.82
1va8_A		113	Maguk P55 subfamily member 5; PDZ domain, palmitoy	98.82
1wi4_A		109	Synip, syntaxin binding protein 4; syntaxin4-inter	98.82
2ejy_A		97	55 kDa erythrocyte membrane protein; GPC, maguk, P	98.81
1wi2_A		104	Riken cDNA 2700099C19; structural genomics, riken	98.8
1v5q_A		122	GRIP1 homolog, glutamate receptor interacting prot	98.8
1ueq_A		123	Membrane associated guanylate kinase inverted-2 (M	98.8
1ujd_A		117	KIAA0559 protein; PDZ domain, structural genomics,	98.8
2yub_A		118	LIMK-2, LIM domain kinase 2; PDZ domain, structura	98.8
1uew_A		114	Membrane associated guanylate kinase inverted-2 (M	98.8
3o46_A		93	Maguk P55 subfamily member 7; PDZ domain, structur	98.79
3cbz_A		108	Dishevelled-2; PDZ domain, phage derived high affi	98.79
2h2b_A		107	Tight junction protein ZO-1; PDZ domain, phage der	98.79
3qik_A		101	Phosphatidylinositol 3,4,5-trisphosphate-dependen	98.79
1uf1_A		128	KIAA1526 protein; PDZ domain, structural genomics,	98.79
2p3w_A		112	Probable serine protease HTRA3; PDZ domain, phage	98.78
1v5l_A		103	PDZ and LIM domain 3; actinin alpha 2 associated L	98.78
3id1_A		95	Regulator of sigma E protease; hydrolase, cell inn	98.78
1q7x_A		108	PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str	98.78
1wha_A		105	KIAA0147 protein, scribble; PDZ domain, cellular s	98.78
1q3o_A		109	Shank1; PDZ, GKAP, peptide binding protein; 1.80A	98.77
3r0h_A		206	INAD, inactivation-NO-after-potential D protein; p	98.77
2d92_A		108	INAD-like protein; PDZ domain, inadl protein, hina	98.77
3i4w_A		104	Disks large homolog 4; alpha and beta protein, alt	98.77
3suz_A		388	Amyloid beta A4 precursor protein-binding family 2	98.76
1uit_A		117	Human discs large 5 protein; PDZ domain, HDLG5, ma	98.76
2kpk_A		129	Membrane-associated guanylate kinase, WW and PDZ c	98.76
1wfg_A		131	Regulating synaptic membrane exocytosis protein 2;	98.76
2dlu_A		111	INAD-like protein; PDZ domain, inadl protein, hina	98.75
1vb7_A		94	PDZ and LIM domain 2; PDZ domain PDZ-LIM protein,	98.75
1x6d_A		119	Interleukin-16; PDZ domain, lymphocyte chemoattrac	98.75
2e7k_A		91	Maguk P55 subfamily member 2; PDZ domain, MPP2 pro	98.75
2q9v_A		90	Membrane-associated guanylate kinase, WW and PDZ c	98.75
2ego_A		96	General receptor for phosphoinositides 1- associat	98.75
2la8_A		106	Inactivation-NO-after-potential D protein, KON-TI	98.74
1y8t_A		324	Hypothetical protein RV0983; serine protease, stru	98.74
1wf8_A		107	Neurabin-I; PDZ domain, structural genomics, NPPSF	98.73
2i6v_A		87	General secretion pathway protein C; EPSC, GSPC, P	98.73
1y7n_A		90	Amyloid beta A4 precursor protein-binding family A	98.73
2dkr_A		93	LIN-7 homolog B; LIN-7B, PDZ, structural genomics,	98.73
1v62_A		117	KIAA1719 protein; structural genomics, synaptic tr	98.72
1nf3_C		128	PAR-6B; semi-CRIB motif, switch I and II, PDZ doma	98.72
1qav_A		90	Alpha-1 syntrophin (residues 77-171); beta-finger,	98.72
3egg_C		170	Spinophilin; PP1, serine/threonine phosphatase, po	98.72
1mfg_A		95	ERB-B2 interacting protein; PDZ domain, protein-pe	98.72
2edp_A		100	Fragment, shroom family member 4; APX/shroom famil	98.72
2eno_A		120	Synaptojanin-2-binding protein; mitochondrial oute	98.7
2rcz_A		81	Tight junction protein ZO-1; PDZ, domain-swapping,	98.69
3qe1_A		107	Sorting nexin-27, G protein-activated inward RECT	98.69
1uhp_A		107	Hypothetical protein KIAA1095; PDZ domain, semapho	98.68
2ehr_A		117	INAD-like protein; PDZ domain, inadl protein, hina	98.68
2daz_A		124	INAD-like protein; PDZ domain, inadl protein, hina	98.68
1n7t_A		103	99-MER peptide of densin-180-like protein; PDZ dom	98.67
1te0_A		318	Protease DEGS; two domains, serine protease, PDZ,	98.67
2csj_A		117	TJP2 protein; PDZ domain, structural genomics, NPP	98.67
1x5n_A		114	Harmonin; PDZ domain, usher syndrome 1C protein, a	98.66
2i4s_A		105	General secretion pathway protein C; EPSC, GSPC, P	98.66
3k1r_A		192	Harmonin; protein-protein complex, alternative spl	98.65
3kzd_A		94	TIAM-1, T-lymphoma invasion and metastasis-inducin	98.65
3soe_A		113	Membrane-associated guanylate kinase, WW and PDZ c	98.65
2qbw_A		195	PDZ-fibronectin fusion protein; fibronectin PDZ, u	98.64
4e34_A		87	Golgi-associated PDZ and coiled-coil motif-contai	98.64
1tp5_A		119	Presynaptic density protein 95; PDZ-peptide ligand	98.63
2cs5_A		119	Tyrosine-protein phosphatase, non-receptor type 4;	98.63
3e17_A		88	Tight junction protein ZO-2; domain swapping, alte	98.63
2eei_A		106	PDZ domain-containing protein 1; regulatory factor	98.63
3nfk_A		107	Tyrosine-protein phosphatase non-receptor type 4;	98.63
2edv_A		96	FERM and PDZ domain-containing protein 1; cytoskel	98.63
2z17_A		104	Pleckstrin homology SEC7 and coiled-coil domains-	98.62
3stj_A		345	Protease DEGQ; serine protease, PDZ domain, protea	98.62
1p1d_A		196	PDZ45, glutamate receptor interacting protein; PDZ	98.61
3hpk_A		125	Protein interacting with PRKCA 1; oxidized, PDZ do	98.6
2dc2_A		103	GOPC, golgi associated PDZ and coiled-coil motif c	98.58
1uju_A		111	Scribble; PDZ domain, cellular signaling, structur	98.58
2krg_A		216	Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a	98.57
2hga_A		125	Conserved protein MTH1368; GFT structural genomics	98.57
2gzv_A		114	PRKCA-binding protein; protein kinase C, PDZ domai	98.56
1vae_A		111	Rhophilin 2, rhophilin, RHO GTPase binding protein	98.55
1ufx_A		103	KIAA1526 protein; PDZ domain, structural genomics,	98.55
3gsl_A		196	Disks large homolog 4; PDZ domain, tandem, PSD-95,	98.54
2qt5_A		200	Glutamate receptor-interacting protein 1; PDZ-pept	98.54
3qo6_A		348	Protease DO-like 1, chloroplastic; protease, HTRA,	98.51
1lcy_A		325	HTRA2 serine protease; apoptosis, PDZ domain, casp	98.49
2lob_A		112	Golgi-associated PDZ and coiled-coil motif-contai	97.89
3tsz_A		391	Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol	98.49
1um7_A		113	Synapse-associated protein 102; PDZ, discs large h	98.47
2d8i_A		114	T-cell lymphoma invasion and metastasis 1 variant;	98.45
3gge_A		95	PDZ domain-containing protein GIPC2; structural ge	98.44
3pv2_A		451	DEGQ; trypsin fold, PDZ domain, chaperone protease	98.44
3r0h_A		206	INAD, inactivation-NO-after-potential D protein; p	98.39
3rle_A		209	Golgi reassembly-stacking protein 2; PDZ, tether,	98.38
3gsl_A		196	Disks large homolog 4; PDZ domain, tandem, PSD-95,	98.38
1z87_A		263	Alpha-1-syntrophin; protein binding; NMR {Mus musc	98.38
2qt5_A		200	Glutamate receptor-interacting protein 1; PDZ-pept	98.36
4a8c_A		436	Periplasmic PH-dependent serine endoprotease DEGQ;	98.35
3rle_A		209	Golgi reassembly-stacking protein 2; PDZ, tether,	98.34
3shw_A		468	Tight junction protein ZO-1; PDZ-SH3-GUK supramodu	98.33
2xkx_A		721	Disks large homolog 4; structural protein, scaffol	98.31
3num_A		332	Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom	98.28
4a8c_A		436	Periplasmic PH-dependent serine endoprotease DEGQ;	98.21
3pv2_A		451	DEGQ; trypsin fold, PDZ domain, chaperone protease	98.18
1p1d_A		196	PDZ45, glutamate receptor interacting protein; PDZ	98.17
1ky9_A		448	Protease DO, DEGP, HTRA; protein quality control,	98.14
4fln_A		539	Protease DO-like 2, chloroplastic; protease, DEG,	98.04
1ky9_A		448	Protease DO, DEGP, HTRA; protein quality control,	97.76
2xkx_A		721	Disks large homolog 4; structural protein, scaffol	97.74
1w9e_A		166	Syntenin 1; cell adhesion, adhesion/complex, PDZ d	97.66
3suz_A		388	Amyloid beta A4 precursor protein-binding family 2	97.31
4fln_A		539	Protease DO-like 2, chloroplastic; protease, DEG,	96.02
3viv_A		230	441AA long hypothetical NFED protein; protein-pept	88.7
1y7o_A		218	ATP-dependent CLP protease proteolytic subunit; hy	80.11

>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A	Back alignment and structure

Probab=100.00  E-value=1.4e-60  Score=502.87  Aligned_cols=371  Identities=53%  Similarity=0.934  Sum_probs=323.5

Q ss_pred             chhHHHHHHHHHHHHHHcCCCCCCCCChHHHHHHHhccCCCCCHHHHHHHHHHHHHhcCCCCccccChhhhhhhccccCC
Q 009668          142 SEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQG  221 (529)
Q Consensus       142 s~~~~~fd~v~~~l~~~Y~~~~~~g~~w~~~~~~~~~~~~~~~~~~f~~~i~~~l~~L~Dpht~~l~~~~~~~~~~~~~~  221 (529)
                      ++.++.|+++|+.++++|+++.+++.+|+++++.+.+...+++.++++.++.+|+++|+|||+.|++++++..+.....+
T Consensus         3 ~~~~~~f~~~w~~i~~~y~~~~~~~~dW~~~~~~y~~~~~~~~~~~~~~~i~~ml~~L~D~hs~~~~~~~~~~~~~~~~g   82 (388)
T 1fc6_A            3 TSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRGTAG   82 (388)
T ss_dssp             CHHHHHHHHHHHHHHHHCSCTTGGGCCHHHHHHHHHHHSCCSSHHHHHHHHHHHHHTTCCTTCEEECHHHHHHHHHCSSS
T ss_pred             ccHHHHHHHHHHHHHHHHhcccccCccHHHHHHHhhhccCCCCHHHHHHHHHHHHHhcCCCcceecCHHHHHHHHHhhcC
Confidence            56788999999999999999999999999999998763456778999999999999999999999999998887777778


Q ss_pred             cceeeeEEEeecCCCCCCCCcEEEEEecCCCcccCCCCCCCCEEEEECCEecCCCCHHHHHHHhcCCCCCcEEEEEeeCC
Q 009668          222 ALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGA  301 (529)
Q Consensus       222 ~~~glG~~~~~~~~~~~~~~~~~V~~V~~gsPA~~aGL~~GD~IlaInG~~v~~~~~~~~~~~l~g~~G~~v~ltv~r~g  301 (529)
                      .+.|+|+.+....   ..+++++|..|.++|||+++||++||+|++|||+++.++..+++..++++.+|++++|+|.|++
T Consensus        83 ~~~giG~~~~~~~---~~~~~~~V~~v~~~spA~~aGl~~GD~I~~Ing~~v~~~~~~~~~~~l~~~~g~~v~l~v~r~g  159 (388)
T 1fc6_A           83 SVTGVGLEITYDG---GSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLHAPG  159 (388)
T ss_dssp             SCBBCSEEEEECT---TCSSCEEEEEECTTSHHHHTTCCTTCEEEEETTEECTTCCHHHHHHHHCBSTTCEEEEEEEETT
T ss_pred             ceEEEEEEEEEee---cCCCcEEEEEeCCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHhcCCCCEEEEEEEeCC
Confidence            8999999987531   0135799999999999999999999999999999999988788888999999999999999998


Q ss_pred             e---eEEEEEeeeccccccccceeee------cCCCCCCCCceEEEEecccccchhHHHHHHHHHHhhCCCCeEEEEcCC
Q 009668          302 E---IRHLALTREKVSLNPVKSRLCV------VPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRD  372 (529)
Q Consensus       302 ~---~~~v~l~r~~~~~~~v~~~~~~------~~~~~~~~~~igYl~i~sF~~~~~~~l~~~l~~l~~~~~~~LIIDLR~  372 (529)
                      +   .++++|++..+..+++....++      .. ....+++||||+|++|...+.+++.+++.+++++++++||||||+
T Consensus       160 ~~~~~~~~~l~r~~i~~~~v~~~~~~~~~~~~~~-~~~~~~~igYi~i~~F~~~~~~~~~~~l~~l~~~~~~~lIlDLR~  238 (388)
T 1fc6_A          160 APSNTRTLQLTRQKVTINPVTFTTCSNVAAAALP-PGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRN  238 (388)
T ss_dssp             EEEEEEEEEEECBCCCCCCEEEEEECSCCGGGSC-TTCSSSCEEEEEECCBSTTHHHHHHHHHHHHHHTTCSEEEEECTT
T ss_pred             CCcceEEEEEEEceeecCceeeeeeccccccccc-cccCCCCEEEEEeCccCcchHHHHHHHHHHHHhCCCCeEEEEcCC
Confidence            7   8899999999888888765532      00 023357999999999998888999999999988899999999999


Q ss_pred             CCCCChHHHHHHHHhhcCCCcEEEEEcCCCceeeeecCCCCcccCCCCEEEEECCCCCCHHHHHHHHHhcCCCeEEEccC
Q 009668          373 NSGGLFPEGIEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEP  452 (529)
Q Consensus       373 N~GG~~~~~~~l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gpv~VL~d~~TaSAaE~fa~~lk~~~~a~iVGe~  452 (529)
                      |+||++..+..++++|++++.+++++.+.+..+.|...+. ...+.+|++||||++||||||+||++||+++++++||++
T Consensus       239 N~GG~~~~~~~~~~~f~~~~~i~~~~~r~~~~~~~~~~~~-~~~~~~pv~VLvn~~taSasEi~a~al~~~~~~~~vG~~  317 (388)
T 1fc6_A          239 NGGGLFPAGVNVARMLVDRGDLVLIADSQGIRDIYSADGN-SIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGER  317 (388)
T ss_dssp             CCCBCHHHHHHHHHHHCSSSEEEEEEETTEEEEEEECCSC-CSCSSSCEEEEECTTCCTHHHHHHHHHHHTTSEEEEESC
T ss_pred             CCCCCHHHHHHHHHHHcCCCcEEEEecCCCceeEEecCCc-cccCCCCEEEEeCCCCccHHHHHHHHHhhCCCEEEEeec
Confidence            9999999999999999999998888877776666655432 234889999999999999999999999999999999999


Q ss_pred             CCCCceeeeEEECCCCceEEEEeeEEEcCCCcccCCCCcccceEcCCCC-CCChhhHh---hhccCccc
Q 009668          453 TYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTF-PKDEDGFC---GCLQDSAS  517 (529)
Q Consensus       453 T~G~~~~~~~~~L~~G~~l~lt~~~~~~p~G~~~e~~GV~PDi~V~~~~-~~~~~~l~---~~l~d~~~  517 (529)
                      |+|++.+|..++||+|+.+.+|++++++|+|+.+|+.||.|||+|+.+. +.....++   ...+||++
T Consensus       318 T~Gkg~~~~~~~L~~g~~l~~t~~~~~~p~G~~~~~~Gi~PDi~v~~~~~~~~~~~~~~~~~~~~Dpql  386 (388)
T 1fc6_A          318 TFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSDAAPRL  386 (388)
T ss_dssp             CCCCCEEEEEEECTTSCEEEEEEEEEECTTSCBCTTTCCCCSEECCTTSSCSSHHHHHHHHHSTTCCCC
T ss_pred             CCCCCeeeeEEEcCCCCEEEEEEEEEEcCCCCCccCCCcCCCEEeCCcccchhhhhhhhhcCCccchhh
Confidence            9999999999999999999999999999999999999999999998774 44445552   34566654

PyMOL of 1fc6

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>3dor_A Protein CT_858, CPAF; mature CPAF, dimer, transferase; 2.20A {Chlamydia trachomatis} PDB: 3dpm_A* 3dpn_A 3dja_A	Back alignment and structure

>1j7x_A IRBP, interphotoreceptor retinoid-binding protein; beta BETA alpha spiral, transport protein; 1.80A {Xenopus laevis} SCOP: c.14.1.2	Back alignment and structure

>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR}	Back alignment and structure

>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens}	Back alignment and structure

>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A	Back alignment and structure

>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus}	Back alignment and structure

>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens}	Back alignment and structure

>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B	Back alignment and structure

>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A	Back alignment and structure

>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic}	Back alignment and structure

>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens}	Back alignment and structure

>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens}	Back alignment and structure

>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens}	Back alignment and structure

>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A*	Back alignment and structure

>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens}	Back alignment and structure

>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A	Back alignment and structure

>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A	Back alignment and structure

>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens}	Back alignment and structure

>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A	Back alignment and structure

>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A	Back alignment and structure

>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A	Back alignment and structure

>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A	Back alignment and structure

>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A	Back alignment and structure

>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus}	Back alignment and structure

>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis}	Back alignment and structure

>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens}	Back alignment and structure

>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae}	Back alignment and structure

>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A	Back alignment and structure

>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A	Back alignment and structure

>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A	Back alignment and structure

>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens}	Back alignment and structure

>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1	Back alignment and structure

>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens}	Back alignment and structure

>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A	Back alignment and structure

>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A	Back alignment and structure

>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans}	Back alignment and structure

>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens}	Back alignment and structure

>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens}	Back alignment and structure

>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens}	Back alignment and structure

>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A	Back alignment and structure

>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0	Back alignment and structure

>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1	Back alignment and structure

>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2	Back alignment and structure

>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A	Back alignment and structure

>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens}	Back alignment and structure

>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens}	Back alignment and structure

>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A	Back alignment and structure

>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens}	Back alignment and structure

>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens}	Back alignment and structure

>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus}	Back alignment and structure

>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens}	Back alignment and structure

>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A*	Back alignment and structure

>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A	Back alignment and structure

>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A	Back alignment and structure

>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens}	Back alignment and structure

>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A	Back alignment and structure

>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A	Back alignment and structure

>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4	Back alignment and structure

>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1	Back alignment and structure

>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus}	Back alignment and structure

>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens}	Back alignment and structure

>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens}	Back alignment and structure

>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A	Back alignment and structure

>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A	Back alignment and structure

>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A	Back alignment and structure

>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A	Back alignment and structure

>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens}	Back alignment and structure

>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A	Back alignment and structure

>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0	Back alignment and structure

>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A	Back alignment and structure

>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A	Back alignment and structure

>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens}	Back alignment and structure

>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens}	Back alignment and structure

>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A	Back alignment and structure

>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A*	Back alignment and structure

>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster}	Back alignment and structure

>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A	Back alignment and structure

>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A	Back alignment and structure

>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A	Back alignment and structure

>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A	Back alignment and structure

>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2	Back alignment and structure

>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens}	Back alignment and structure

>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A	Back alignment and structure

>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster}	Back alignment and structure

>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A	Back alignment and structure

>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5	Back alignment and structure

>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A	Back alignment and structure

>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A	Back alignment and structure

>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A	Back alignment and structure

>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A	Back alignment and structure

>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A	Back alignment and structure

>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens}	Back alignment and structure

>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A	Back alignment and structure

>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A	Back alignment and structure

>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A	Back alignment and structure

>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5	Back alignment and structure

>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A	Back alignment and structure

>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A	Back alignment and structure

>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens}	Back alignment and structure

>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A	Back alignment and structure

>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A	Back alignment and structure

>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A	Back alignment and structure

>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens}	Back alignment and structure

>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A	Back alignment and structure

>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens}	Back alignment and structure

>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli}	Back alignment and structure

>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A	Back alignment and structure

>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A	Back alignment and structure

>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens}	Back alignment and structure

>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens}	Back alignment and structure

>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6	Back alignment and structure

>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A	Back alignment and structure

>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1	Back alignment and structure

>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A	Back alignment and structure

>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus}	Back alignment and structure

>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana}	Back alignment and structure

>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1	Back alignment and structure

>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens}	Back alignment and structure

>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A	Back alignment and structure

>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1	Back alignment and structure

>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens}	Back alignment and structure

>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A	Back alignment and structure

>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster}	Back alignment and structure

>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A	Back alignment and structure

>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A	Back alignment and structure

>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus}	Back alignment and structure

>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus}	Back alignment and structure

>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A	Back alignment and structure

>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A	Back alignment and structure

>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens}	Back alignment and structure

>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus}	Back alignment and structure

>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A	Back alignment and structure

>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A	Back alignment and structure

>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A	Back alignment and structure

>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A	Back alignment and structure

>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A	Back alignment and structure

>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana}	Back alignment and structure

>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A	Back alignment and structure

>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus}	Back alignment and structure

>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A	Back alignment and structure

>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A	Back alignment and structure

>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana}	Back alignment and structure

>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A	Back alignment and structure

>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		529
d1fc6a4		294	c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-	3e-46
d1fc6a4		294	c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-	7e-29
d1j7xa_		302	c.14.1.2 (A:) Interphotoreceptor retinoid-binding	3e-35
d1k32a4		291	c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {	4e-30
d1k32a4		291	c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {	6e-16
d1fc6a3		92	b.36.1.3 (A:157-248) Photosystem II D1 C-terminal	8e-18
d1w9ea1		85	b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie	1e-12
d1g9oa_		91	b.36.1.1 (A:) Na+/H+ exchanger regulatory factor,	5e-12
d2z9ia1		88	b.36.1.4 (A:227-314) Protease PepD {Mycobacterium	1e-10
d1uita_		117	b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma	1e-10
d1wifa_		126	b.36.1.1 (A:) hypothetical PDZ domain containing p	1e-10
d2f5ya1		77	b.36.1.1 (A:19-95) Regulator of G-protein signalin	2e-10
d1q3oa_		104	b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv	2e-10
d1x5qa1		97	b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom	4e-10
d1ky9b2		88	b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t	1e-09
d1ujda_		117	b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human	2e-09
d1ueqa_		123	b.36.1.1 (A:) Membrane associated guanylate kinase	3e-09
d1rgwa_		85	b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo	3e-09
d2csja1		104	b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj	5e-09
d1m5za_		91	b.36.1.1 (A:) Glutamate receptor interacting prote	5e-09
d1lcya1		100	b.36.1.4 (A:226-325) Mitochondrial serine protease	6e-09
d2fcfa1		96	b.36.1.1 (A:1148-1243) Multiple PDZ domain protein	8e-09
d1wg6a_		127	b.36.1.1 (A:) Partitioning-defective 3-like protei	8e-09
d1n7ea_		95	b.36.1.1 (A:) Glutamate receptor-interacting prote	9e-09
d1uf1a_		128	b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien	2e-08
d1wi4a1		96	b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou	2e-08
d1rgra_		93	b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus	2e-08
d1uepa_		103	b.36.1.1 (A:) Membrane associated guanylate kinase	3e-08
d1x5na1		101	b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens)	3e-08
d1x45a1		85	b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei	3e-08
d1x5ra1		99	b.36.1.1 (A:8-106) Glutamate receptor interacting	4e-08
d1v5la_		103	b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote	5e-08
d2cssa1		108	b.36.1.1 (A:8-115) Regulating synaptic membrane ex	6e-08
d1wh1a_		124	b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human	7e-08
d2fe5a1		92	b.36.1.1 (A:223-314) Synapse-associated protein 10	9e-08
d1t2ma1		92	b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta	1e-07
d1y7na1		79	b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote	1e-07
d2fnea1		88	b.36.1.1 (A:1955-2042) Multiple PDZ domain protein	1e-07
d1p1da2		99	b.36.1.1 (A:115-213) Glutamate receptor interactin	2e-07
d1ueza_		101	b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien	2e-07
d1ihja_		94	b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga	2e-07
d1x6da1		107	b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap	3e-07
d1um1a_		110	b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human	3e-07
d1kwaa_		88	b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta	3e-07
d1wf8a1		94	b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens	4e-07
d1i16a_		130	b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens)	6e-07
d2i6va1		87	b.36.1.5 (A:219-305) General secretion pathway pro	6e-07
d1v6ba_		118	b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI	7e-07
d1tp5a1		102	b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat	1e-06
d1uewa_		114	b.36.1.1 (A:) Membrane associated guanylate kinase	1e-06
d1vaea_		111	b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T	1e-06
d1ufxa_		103	b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien	2e-06
d2h3la1		103	b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens)	2e-06
d1ozia_		99	b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu	3e-06
d1ujva_		96	b.36.1.1 (A:) Membrane associated guanylate kinase	3e-06
d1v5qa_		122	b.36.1.1 (A:) Glutamate receptor interacting prote	4e-06
d1v62a_		117	b.36.1.1 (A:) Glutamate receptor interacting prote	5e-06
d1k32a1		91	b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th	7e-06
d1wi2a_		104	b.36.1.1 (A:) PDZ domain containing protein 11, Pd	1e-05
d1r6ja_		82	b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta	1e-05
d1rzxa_		98	b.36.1.1 (A:) GTPase-binding domain of the cell po	1e-05
d1va8a1		100	b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M	1e-05
d1whaa_		105	b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap	2e-05
d1ujua_		111	b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap	1e-04
d2f0aa1		92	b.36.1.1 (A:251-342) Segment polarity protein dish	3e-04
d2hgaa1		103	b.36.1.6 (A:23-125) Uncharacterized protein MTH136	7e-04

>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 294	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Tail specific protease, catalytic domain
domain: Photosystem II D1 C-terminal processing protease
species: Algae (Scenedesmus obliquus) [TaxId: 3088]

 Score =  161 bits (408), Expect = 3e-46
 Identities = 99/190 (52%), Positives = 135/190 (71%), Gaps = 2/190 (1%)

Query: 328 PGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEGIEIAKI 387
           PG +  ++GY++L +FN N + A ++A   L    V   VLD+R+N GGLFP G+ +A++
Sbjct: 101 PGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNVARM 160

Query: 388 WLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAV 447
            +D+G +V I DS+G+RDIY  DG   + ++ PL VLVN+GTASASE+LAGALKD+KR +
Sbjct: 161 LVDRGDLVLIADSQGIRDIYSADGNS-IDSATPLVVLVNRGTASASEVLAGALKDSKRGL 219

Query: 448 LFGEPTYGKGKIQSVFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPL-PKTFPKDED 506
           + GE T+GKG IQ+V  LSDGSG+AVTVARY+TPA  DI+K+GV PD  L P+  P D +
Sbjct: 220 IAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLE 279

Query: 507 GFCGCLQDSA 516
           G C  L   A
Sbjct: 280 GVCRVLGSDA 289

PyMOL of d1fc6a4

>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 294	Back information, alignment and structure

>d1j7xa_ c.14.1.2 (A:) Interphotoreceptor retinoid-binding protein IRBP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 302	Back information, alignment and structure

>d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 291	Back information, alignment and structure

>d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 291	Back information, alignment and structure

>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92	Back information, alignment and structure

>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91	Back information, alignment and structure

>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88	Back information, alignment and structure

>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117	Back information, alignment and structure

>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126	Back information, alignment and structure

>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77	Back information, alignment and structure

>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104	Back information, alignment and structure

>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88	Back information, alignment and structure

>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117	Back information, alignment and structure

>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123	Back information, alignment and structure

>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104	Back information, alignment and structure

>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91	Back information, alignment and structure

>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100	Back information, alignment and structure

>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127	Back information, alignment and structure

>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95	Back information, alignment and structure

>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128	Back information, alignment and structure

>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96	Back information, alignment and structure

>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93	Back information, alignment and structure

>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101	Back information, alignment and structure

>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99	Back information, alignment and structure

>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103	Back information, alignment and structure

>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108	Back information, alignment and structure

>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124	Back information, alignment and structure

>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92	Back information, alignment and structure

>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92	Back information, alignment and structure

>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99	Back information, alignment and structure

>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101	Back information, alignment and structure

>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94	Back information, alignment and structure

>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107	Back information, alignment and structure

>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110	Back information, alignment and structure

>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94	Back information, alignment and structure

>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130	Back information, alignment and structure

>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87	Back information, alignment and structure

>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118	Back information, alignment and structure

>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102	Back information, alignment and structure

>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114	Back information, alignment and structure

>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111	Back information, alignment and structure

>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99	Back information, alignment and structure

>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122	Back information, alignment and structure

>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117	Back information, alignment and structure

>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91	Back information, alignment and structure

>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104	Back information, alignment and structure

>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82	Back information, alignment and structure

>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98	Back information, alignment and structure

>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100	Back information, alignment and structure

>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105	Back information, alignment and structure

>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111	Back information, alignment and structure

>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92	Back information, alignment and structure

>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		529
d1fc6a4		294	Photosystem II D1 C-terminal processing protease {	100.0
d1k32a4		291	Tricorn protease {Archaeon Thermoplasma acidophilu	100.0
d1j7xa_		302	Interphotoreceptor retinoid-binding protein IRBP {	99.96
d1fc6a3		92	Photosystem II D1 C-terminal processing protease {	99.55
d2z9ia1		88	Protease PepD {Mycobacterium tuberculosis [TaxId:	99.32
d1k32a1		91	Tricorn protease {Archaeon Thermoplasma acidophilu	99.26
d1w9ea1		85	Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}	99.16
d1lcya1		100	Mitochondrial serine protease HtrA2 {Human (Homo s	99.12
d2f5ya1		77	Regulator of G-protein signaling 3, RGS3 {Human (H	99.03
d1m5za_		91	Glutamate receptor interacting protein {Rat (Rattu	98.99
d1rgwa_		85	Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax	98.98
d1t2ma1		92	Afadin {Human (Homo sapiens) [TaxId: 9606]}	98.97
d1g9oa_		91	Na+/H+ exchanger regulatory factor, NHERF {Human (	98.96
d2fe5a1		92	Synapse-associated protein 102 {Human (Homo sapien	98.94
d1x5qa1		97	Scribble (KIAA0147) {Human (Homo sapiens) [TaxId:	98.94
d1ky9b2		88	Protease Do (DegP, HtrA), C-terminal domains {Esch	98.94
d1sota1		99	Stress sensor protease DegS, C-terminal domain {Es	98.91
d1wifa_		126	hypothetical PDZ domain containing protein Uqcrc2	98.89
d2i6va1		87	General secretion pathway protein C, EpsC {Vibrio	98.89
d1ky9a1		94	Protease Do (DegP, HtrA), C-terminal domains {Esch	98.88
d1qaua_		112	Neuronal nitric oxide synthase, NNOS {Rat (Rattus	98.88
d1rgra_		93	Synaptic protein PSD-95 {Rat (Rattus norvegicus) [	98.87
d2hgaa1		103	Uncharacterized protein MTH1368 {Methanobacterium	98.86
d1ozia_		99	Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1	98.83
d1vb7a_		94	PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta	98.8
d2fcfa1		96	Multiple PDZ domain protein {Human (Homo sapiens)	98.8
d1vaea_		111	Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]}	98.8
d1uita_		117	Discs large 5 protein KIAA0583 {Human (Homo sapien	98.79
d1r6ja_		82	Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}	98.79
d1q3oa_		104	Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId	98.77
d1qava_		90	Syntrophin {Mouse (Mus musculus) [TaxId: 10090]}	98.77
d1um1a_		110	Hypothetical protein KIAA1849 {Human (Homo sapiens	98.77
d1whaa_		105	Scribble (KIAA0147) {Human (Homo sapiens) [TaxId:	98.77
d1p1da2		99	Glutamate receptor interacting protein {Rat (Rattu	98.76
d1y7na1		79	Amyloid beta A4 precursor protein-binding family A	98.76
d1i16a_		130	Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]	98.76
d1ihja_		94	Inad {Fruit fly (Drosophila melanogaster) [TaxId:	98.75
d1kwaa_		88	Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]}	98.74
d1n7ea_		95	Glutamate receptor-interacting protein 1, GRIP1 {R	98.74
d1wi2a_		104	PDZ domain containing protein 11, Pdzk11 {Mouse (M	98.74
d1tp5a1		102	Synaptic protein PSD-95 {Rat (Rattus norvegicus) [	98.73
d1wf8a1		94	Neurabin-i {Human (Homo sapiens) [TaxId: 9606]}	98.72
d1uepa_		103	Membrane associated guanylate kinase inverted-2 (M	98.72
d1va8a1		100	Maguk p55 subfamily member 5 {Mouse (Mus musculus)	98.7
d1uhpa_		107	Hypothetical protein KIAA1095 {Human (Homo sapiens	98.7
d1ueza_		101	KIAA1526 protein {Human (Homo sapiens) [TaxId: 960	98.69
d1ueqa_		123	Membrane associated guanylate kinase inverted-2 (M	98.69
d1wi4a1		96	Syntaxin binding protein 4 {Mouse (Mus musculus) [	98.68
d1ujda_		117	Hypothetical protein KIAA0559 {Human (Homo sapiens	98.68
d2f0aa1		92	Segment polarity protein dishevelled homolog Dvl-2	98.68
d1uf1a_		128	KIAA1526 protein {Human (Homo sapiens) [TaxId: 960	98.67
d2cssa1		108	Regulating synaptic membrane exocytosis protein 1,	98.64
d1wf7a_		103	Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1	98.64
d1x5na1		101	Harmonin {Human (Homo sapiens) [TaxId: 9606]}	98.64
d1x45a1		85	Amyloid beta A4 precursor protein-binding family A	98.63
d2fnea1		88	Multiple PDZ domain protein {Human (Homo sapiens)	98.63
d1rzxa_		98	GTPase-binding domain of the cell polarity protein	98.63
d1uewa_		114	Membrane associated guanylate kinase inverted-2 (M	98.62
d1ujua_		111	Scribble (KIAA0147) {Human (Homo sapiens) [TaxId:	98.61
d2cs5a1		106	Tyrosine-protein phosphatase non-receptor type 4,	98.61
d2h3la1		103	Erbin {Human (Homo sapiens) [TaxId: 9606]}	98.61
d1x6da1		107	Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]	98.6
d2csja1		104	Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc	98.6
d1v5la_		103	Alpha-actinin-2 associated LIM protein {Mouse (Mus	98.56
d1wg6a_		127	Partitioning-defective 3-like protein, PAR3-L (RIK	98.5
d1wfva_		103	Membrane associated guanylate kinase inverted-2 (M	98.49
d1v62a_		117	Glutamate receptor interacting protein 2, GRIP2 (K	98.46
d1v6ba_		118	Harmonin {Mouse (Mus musculus) [TaxId: 10090]}	98.45
d1x5ra1		99	Glutamate receptor interacting protein 2, GRIP2 (K	98.42
d1wh1a_		124	Hypothetical protein KIAA1095 {Human (Homo sapiens	98.42
d1v5qa_		122	Glutamate receptor interacting protein {Mouse (Mus	98.36
d1ujva_		96	Membrane associated guanylate kinase inverted-2 (M	98.34
d1ufxa_		103	KIAA1526 protein {Human (Homo sapiens) [TaxId: 960	98.32

>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Tail specific protease, catalytic domain
domain: Photosystem II D1 C-terminal processing protease
species: Algae (Scenedesmus obliquus) [TaxId: 3088]

Probab=100.00  E-value=1.3e-46  Score=379.79  Aligned_cols=286  Identities=54%  Similarity=0.949  Sum_probs=233.3

Q ss_pred             chhHHHHHHHHHHHHHHcCCCCCCCCChHHHHHHHhccCCCCCHHHHHHHHHHHHHhcCCCCccccChhhhhhhccccCC
Q 009668          142 SEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYMAIRKMLATLDDPFTRFLEPEKFNSLRSGTQG  221 (529)
Q Consensus       142 s~~~~~fd~v~~~l~~~Y~~~~~~g~~w~~~~~~~~~~~~~~~~~~f~~~i~~~l~~L~Dpht~~l~~~~~~~~~~~~~~  221 (529)
                      +..+++|+++|+.++++|+++.++|+||+++++++.....+.+.++++.+|.+|+++|+|+|+.++.++++..+......
T Consensus         2 ~~~~~if~e~W~~~~~~y~~~~~~gvDW~a~~~~y~~~~~~~~~~e~~~~i~~ml~~L~D~Ht~~~~~~~~~~~~~g~~~   81 (294)
T d1fc6a4           2 TSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRGTKV   81 (294)
T ss_dssp             CHHHHHHHHHHHHHHHHCSCTTGGGCCHHHHHHHHHHHSCCSSHHHHHHHHHHHHHTTCCTTCEEECHHHHHHHHHCSCC
T ss_pred             CcHHHHHHHHHHHhhccccCCCCCccCHHHHHHHHhccccCCCHHHHHHHHHHHHHHhCCCceEEeChHHhhhhccCceE
Confidence            45678999999999999999999999999999999876667788899999999999999999999999887654321110


Q ss_pred             cceeeeEEEeecCCCCCCCCcEEEEEecCCCcccCCCCCCCCEEEEECCEecCCCCHHHHHHHhcCCCCCcEEEEEeeCC
Q 009668          222 ALTGVGLSIGYPTASDGSSAGLVVISSMPGGPANRAGILSGDVILAIDDTSTESMGIYDAAERLQGPEGSPVELTVRSGA  301 (529)
Q Consensus       222 ~~~glG~~~~~~~~~~~~~~~~~V~~V~~gsPA~~aGL~~GD~IlaInG~~v~~~~~~~~~~~l~g~~G~~v~ltv~r~g  301 (529)
                      .                                    +         +                      .+..+.    
T Consensus        82 ~------------------------------------~---------~----------------------~~~~~~----   90 (294)
T d1fc6a4          82 T------------------------------------I---------N----------------------PVTFTT----   90 (294)
T ss_dssp             C------------------------------------C---------C----------------------CEEEEE----
T ss_pred             E------------------------------------e---------c----------------------ccCCCc----
Confidence            0                                    0         0                      000000    


Q ss_pred             eeEEEEEeeeccccccccceeeecCCCCCCCCceEEEEecccccchhHHHHHHHHHHhhCCCCeEEEEcCCCCCCChHHH
Q 009668          302 EIRHLALTREKVSLNPVKSRLCVVPGPGKSSPRIGYIKLTSFNQNASGAVREAIDTLRSNSVNAFVLDLRDNSGGLFPEG  381 (529)
Q Consensus       302 ~~~~v~l~r~~~~~~~v~~~~~~~~~~~~~~~~igYl~i~sF~~~~~~~l~~~l~~l~~~~~~~LIIDLR~N~GG~~~~~  381 (529)
                             . ..+....+..        ...+++||||+|++|...+.+++++++.+++++++++||||||+|+||++..+
T Consensus        91 -------~-~~~~~~~~~~--------~~~~~~IGYi~i~~F~~~~~~~~~~~l~~l~~~~~~~lIiDLR~N~GG~~~~a  154 (294)
T d1fc6a4          91 -------C-SNVAAAALPP--------GAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAG  154 (294)
T ss_dssp             -------E-CSCCGGGSCT--------TCSSSCEEEEEECCBSTTHHHHHHHHHHHHHHTTCSEEEEECTTCCCBCHHHH
T ss_pred             -------c-cccccccccC--------CCCCCcEEEEEEcccCchhHHHHHHHHHHHHHCCCcEEEEEeecCcccchhhh
Confidence                   0 0000011111        12357999999999999889999999999998899999999999999999999


Q ss_pred             HHHHHhhcCCCcEEEEEcCCCceeeeecCCCCcccCCCCEEEEECCCCCCHHHHHHHHHhcCCCeEEEccCCCCCceeee
Q 009668          382 IEIAKIWLDKGVIVYICDSRGVRDIYDTDGTDALAASEPLAVLVNKGTASASEILAGALKDNKRAVLFGEPTYGKGKIQS  461 (529)
Q Consensus       382 ~~l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gpv~VL~d~~TaSAaE~fa~~lk~~~~a~iVGe~T~G~~~~~~  461 (529)
                      ..++++|++++..+++...++....+...+ ....+.+|++||||+.|+||||+||++||+++++++||++|+|++..+.
T Consensus       155 ~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~pv~VL~~~~TaSaaE~~a~~lk~~~~a~vvG~~T~G~g~~~~  233 (294)
T d1fc6a4         155 VNVARMLVDRGDLVLIADSQGIRDIYSADG-NSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQT  233 (294)
T ss_dssp             HHHHHHHCSSSEEEEEEETTEEEEEEECCS-CCSCSSSCEEEEECTTCCTHHHHHHHHHHHTTSEEEEESCCCCCCEEEE
T ss_pred             HHHHHhhcccccceEEEEeccccceecccc-ccccccceEEEEecCCccchHHHHHHHhhhcCeEEEEeeeccCcceeeE
Confidence            999999999998877776665555555443 3456889999999999999999999999999999999999999999999


Q ss_pred             EEECCCCceEEEEeeEEEcCCCcccCCCCcccceEcCCCC-CCChhhHhhhccCc
Q 009668          462 VFQLSDGSGLAVTVARYETPAHTDIDKVGVIPDHPLPKTF-PKDEDGFCGCLQDS  515 (529)
Q Consensus       462 ~~~L~~G~~l~lt~~~~~~p~G~~~e~~GV~PDi~V~~~~-~~~~~~l~~~l~d~  515 (529)
                      .++||+|+.+++|+.++++|+|+.+|+.||+|||+|+.+. +.+.+++.+++.++
T Consensus       234 ~~~L~dG~~l~~t~~~~~~p~G~~~e~~Gv~PDi~v~~~~~~~d~~~~~~~l~~~  288 (294)
T d1fc6a4         234 VVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLPTDLEGVCRVLGSD  288 (294)
T ss_dssp             EEECTTSCEEEEEEEEEECTTSCBCTTTCCCCSEECCTTSSCSSHHHHHHHHHST
T ss_pred             EEEeCCCCEEEEEeEEEECCCCCEeeCcccCCCeEECCccCchhhhccccccCCC
Confidence            9999999999999999999999999999999999997654 44456666666543

PyMOL of d1fc6a4

>d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1j7xa_ c.14.1.2 (A:) Interphotoreceptor retinoid-binding protein IRBP {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]}	Back information, alignment and structure

>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure