Citrus Sinensis ID: 009685

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------53
MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILKKFSKLAPEGSNQKSSSEYPREDVIDAKKGKDKSSKKKKKKGPVSESKSESEYKKGLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKDK
ccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHEEEcccccccccccccccccHHccccccccEEccEEccccccccccccccEEEccccccccccccccccccEEEEEcccHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccEEcEEcccccccccccEEEEccEEEEEEEEEcEEEEEEEEcccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccc
cccHHHHccccHHHHHHHcHHHHHHHHHHHccccccccHcccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccEEEEEEEEEEcccHHHHHHccccccEEEEEcccEEEEEEEEEcccccEEEEccEEEEEEccccccccccccccccEEEEEccccHHHHHHHHHccccccHHHHHHHHcHHHccccccccccEEEEEEEEcccccccccEEEEcccEEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHccccccccHcccccHHHHccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHEccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
medfakyahspvhlAVARRDYAALRRIIATLprlskagevntedESLAAELQADAVSAVidrrdvpgretplHLAVRLRDPISAEILMAAGadwslqnenGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHfessvipfigriapsdtyRIWKRgsnlradmtlagfdgfriqrsdqTFLFlgegytsedgnvslspgslivlSHKEKEVTnalegagappteaEVAHEVALMSqtnmyrpgidvtqaelvphlnwrrQERTEMVGNWKAKVYDMLHVMVSVksrrvpgamtdeelfavededklanggdndeyddvLTAEERLQLDSALRmgnsdglcdddengvlscqengsgvsyengeansavkekkswfgwnkkgtknnvedaedSKILKKFSklapegsnqkssseypredvidakkgkdksskkkkkkgpvseskseseykkglrpvlwltpdfplktdellpLLDILANKVKAIRRLRELLTtklpsgtfpvkdk
medfakyahspvhlavARRDYAALRRIIATlprlskagevntEDESLAAELQADAvsavidrrdvpgretplhlavrlrDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHfessvipfigriaPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELfavededklanggdndeyDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSavkekkswfgwnkkgtknnvedaedsKILKKFsklapegsnqkssseypredvidakkgkdksskkkkkkgpvseskseseykkglrpvlwltpdfPLKTDELLPLLDILANKVKAIRRLREllttklpsgtfpvkdk
MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILKKFSKLAPEGSNQKSSSEYPREDVIDAkkgkdksskkkkkkgpvseskseseykkGLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKDK
******YAHSPVHLAVARRDYAALRRIIATLPRL********************AVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNV*****SLIVL*************************EVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRV*************************************************************************************WFGW*************************************************************************GLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTK***********
*EDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKE**********************LMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSV************************************************************ENGV*******************************************************************************************************GLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPV***
********HSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILKKFSKL***************EDVIDA****************************GLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKDK
*EDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDED********************************************************************************************************************************************ESEYKKGLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILKKFSKLAPEGSNQKSSSEYPREDVIDAKKGKDKSSKKKKKKGPVSESKSESEYKKGLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query528 2.2.26 [Sep-21-2011]
Q86YJ7 626 Ankyrin repeat domain-con yes no 0.481 0.405 0.338 2e-29
Q5F259 626 Ankyrin repeat domain-con yes no 0.482 0.407 0.328 5e-29
Q6NRD0510 Ankyrin repeat domain-con N/A no 0.471 0.488 0.291 2e-21
Q7ZYD9513 Ankyrin repeat domain-con N/A no 0.465 0.479 0.290 2e-21
Q8N6S4541 Ankyrin repeat domain-con no no 0.496 0.484 0.277 3e-21
Q3UX43541 Ankyrin repeat domain-con no no 0.448 0.438 0.295 3e-21
Q8IZ07590 Ankyrin repeat domain-con no no 0.494 0.442 0.277 3e-21
Q7ZUV0488 Ankyrin repeat domain-con no no 0.448 0.485 0.295 4e-21
Q28C34509 Ankyrin repeat domain-con no no 0.471 0.489 0.287 7e-21
Q80UP5588 Ankyrin repeat domain-con no no 0.306 0.275 0.345 4e-18
>sp|Q86YJ7|AN13B_HUMAN Ankyrin repeat domain-containing protein 13B OS=Homo sapiens GN=ANKRD13B PE=2 SV=4 Back     alignment and function desciption
 Score =  130 bits (327), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/269 (33%), Positives = 146/269 (54%), Gaps = 15/269 (5%)

Query: 47  LAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQ 106
           L  E++A  V   I++ D  GR TPLHLA  L     A +L+A GAD   +N +GW+ LQ
Sbjct: 30  LEKEVRAGQVD--IEQLDPRGR-TPLHLATTLGHLECARVLLAHGADVGRENRSGWTVLQ 86

Query: 107 EAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIG 166
           EAV TR+  +  ++ R+       K    +P ++    + +DFY+E+ + F +S +P + 
Sbjct: 87  EAVSTRDLELVQLVLRYRDYQRVVKRLAGIPVLLEKLRKAQDFYVEMKWEF-TSWVPLVS 145

Query: 167 RIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSE----DGNVSLSP 222
           +I PSDTY++WK G NLR D TL GFD    QR +++F+F G+  ++     D +  +  
Sbjct: 146 KICPSDTYKVWKSGQNLRVDTTLLGFDHMTWQRGNRSFVFRGQDTSAVVMEIDHDRRVVY 205

Query: 223 GSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEV-ALMSQTNMYRPGIDVTQAELVPHLNW 281
              + L+ +++E    L  A A PTE +V   + A +  T +    I   + +    L W
Sbjct: 206 TETLALAGQDRE----LLLAAAQPTEEQVLSRLTAPVVTTQLDTKNISFERNK-TGILGW 260

Query: 282 RRQERTEMVGNWKAKVYDMLHVMVSVKSR 310
            R E+TEMV  ++AKVY   +V +  ++R
Sbjct: 261 -RSEKTEMVNGYEAKVYGASNVELITRTR 288

Homo sapiens (taxid: 9606)
>sp|Q5F259|AN13B_MOUSE Ankyrin repeat domain-containing protein 13B OS=Mus musculus GN=Ankrd13b PE=2 SV=1 Back     alignment and function description
>sp|Q6NRD0|A13CA_XENLA Ankyrin repeat domain-containing protein 13C-A OS=Xenopus laevis GN=ankrd13c-a PE=2 SV=1 Back     alignment and function description
>sp|Q7ZYD9|A13CB_XENLA Ankyrin repeat domain-containing protein 13C-B OS=Xenopus laevis GN=ankrd13c-b PE=2 SV=1 Back     alignment and function description
>sp|Q8N6S4|AN13C_HUMAN Ankyrin repeat domain-containing protein 13C OS=Homo sapiens GN=ANKRD13C PE=2 SV=2 Back     alignment and function description
>sp|Q3UX43|AN13C_MOUSE Ankyrin repeat domain-containing protein 13C OS=Mus musculus GN=Ankrd13c PE=2 SV=2 Back     alignment and function description
>sp|Q8IZ07|AN13A_HUMAN Ankyrin repeat domain-containing protein 13A OS=Homo sapiens GN=ANKRD13A PE=1 SV=3 Back     alignment and function description
>sp|Q7ZUV0|AN13C_DANRE Ankyrin repeat domain-containing protein 13C OS=Danio rerio GN=ankrd13c PE=2 SV=1 Back     alignment and function description
>sp|Q28C34|AN13C_XENTR Ankyrin repeat domain-containing protein 13C OS=Xenopus tropicalis GN=ankrd13c PE=2 SV=1 Back     alignment and function description
>sp|Q80UP5|AN13A_MOUSE Ankyrin repeat domain-containing protein 13A OS=Mus musculus GN=Ankrd13a PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query528
255561957 661 protein binding protein, putative [Ricin 0.996 0.795 0.876 0.0
359488099 660 PREDICTED: ankyrin repeat domain-contain 0.996 0.796 0.872 0.0
449470224 658 PREDICTED: ankyrin repeat domain-contain 0.996 0.799 0.840 0.0
356505985 689 PREDICTED: ankyrin repeat domain-contain 0.996 0.763 0.804 0.0
356576680 645 PREDICTED: uncharacterized protein LOC10 0.979 0.801 0.806 0.0
356535198 725 PREDICTED: ankyrin repeat domain-contain 0.971 0.707 0.792 0.0
449449585 657 PREDICTED: ankyrin repeat domain-contain 0.996 0.800 0.795 0.0
79391178 640 ankyrin repeat-containing protein [Arabi 0.956 0.789 0.779 0.0
297833124 640 hypothetical protein ARALYDRAFT_896477 [ 0.956 0.789 0.779 0.0
224144588583 predicted protein [Populus trichocarpa] 0.842 0.763 0.871 0.0
>gi|255561957|ref|XP_002521987.1| protein binding protein, putative [Ricinus communis] gi|223538791|gb|EEF40391.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/533 (87%), Positives = 496/533 (93%), Gaps = 7/533 (1%)

Query: 1   MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVI 60
           ME F+KYAHSP H+AVARRDYAALR +I+TLPRL+KAGEVNTE+ESLAAE +ADAVSAVI
Sbjct: 1   MEAFSKYAHSPAHIAVARRDYAALRHVISTLPRLAKAGEVNTEEESLAAEERADAVSAVI 60

Query: 61  DRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMII 120
           DRRDVPGRETPLHLAV+LRDPISAEILMAAGADWSLQNE+GWSALQEAVCTREE IAMII
Sbjct: 61  DRRDVPGRETPLHLAVKLRDPISAEILMAAGADWSLQNEHGWSALQEAVCTREERIAMII 120

Query: 121 ARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG 180
           ARHYQPLAWAKWCRRLPRIVASA+RIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG
Sbjct: 121 ARHYQPLAWAKWCRRLPRIVASASRIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG 180

Query: 181 SNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALE 240
           SNLRADMTLAGFDGFRIQRSDQTFLFLGEGY+SEDGN SL PGSLIVL+HKEKEVTNALE
Sbjct: 181 SNLRADMTLAGFDGFRIQRSDQTFLFLGEGYSSEDGNTSLPPGSLIVLAHKEKEVTNALE 240

Query: 241 GAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDM 300
           GAGA PTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQER+EMVGNWKAKVYDM
Sbjct: 241 GAGAQPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERSEMVGNWKAKVYDM 300

Query: 301 LHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNS 360
           LHVMVSVKSRRVPGAMTDEELFAV+DE+KL NG DNDE+DDVLTAEER QLDSALRMG+S
Sbjct: 301 LHVMVSVKSRRVPGAMTDEELFAVDDEEKLVNGADNDEFDDVLTAEERKQLDSALRMGSS 360

Query: 361 DGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILK 420
           DGLC+D+E GV+  QENGSG SYENGE+N ++KEKKSWFGW  KG KNN +D ED+KILK
Sbjct: 361 DGLCEDEEPGVIEFQENGSGGSYENGESNGSIKEKKSWFGWKNKGPKNNNDDPEDTKILK 420

Query: 421 KFSKLAPEGS------NQKSSSEYPR-EDVIDAKKGKDKSSKKKKKKGPVSESKSESEYK 473
           KFSKLAPEG       NQ+SSSE+ R ED+ D KKGKDK SKKKKKK P SESK ESEYK
Sbjct: 421 KFSKLAPEGGTQKSVDNQRSSSEFSRAEDLGDGKKGKDKGSKKKKKKVPGSESKHESEYK 480

Query: 474 KGLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVK 526
           KGLRPVLWLTPDFPL+TDELLPLLDILANKVKAIRRLRELLTTKLP GTFPVK
Sbjct: 481 KGLRPVLWLTPDFPLQTDELLPLLDILANKVKAIRRLRELLTTKLPQGTFPVK 533

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359488099|ref|XP_002266715.2| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449470224|ref|XP_004152818.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Cucumis sativus] gi|449477722|ref|XP_004155104.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356505985|ref|XP_003521769.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like [Glycine max] Back     alignment and taxonomy information
>gi|356576680|ref|XP_003556458.1| PREDICTED: uncharacterized protein LOC100801892 [Glycine max] Back     alignment and taxonomy information
>gi|356535198|ref|XP_003536135.1| PREDICTED: ankyrin repeat domain-containing protein 13A-like [Glycine max] Back     alignment and taxonomy information
>gi|449449585|ref|XP_004142545.1| PREDICTED: ankyrin repeat domain-containing protein 13A-like [Cucumis sativus] gi|449479795|ref|XP_004155709.1| PREDICTED: ankyrin repeat domain-containing protein 13A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|79391178|ref|NP_566227.3| ankyrin repeat-containing protein [Arabidopsis thaliana] gi|7547106|gb|AAF63778.1| unknown protein [Arabidopsis thaliana] gi|332640565|gb|AEE74086.1| ankyrin repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297833124|ref|XP_002884444.1| hypothetical protein ARALYDRAFT_896477 [Arabidopsis lyrata subsp. lyrata] gi|297330284|gb|EFH60703.1| hypothetical protein ARALYDRAFT_896477 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224144588|ref|XP_002325341.1| predicted protein [Populus trichocarpa] gi|222862216|gb|EEE99722.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query528
TAIR|locus:2100900 640 AT3G04470 "AT3G04470" [Arabido 0.964 0.795 0.745 8.2e-202
TAIR|locus:2010597 664 AT1G04780 "AT1G04780" [Arabido 0.973 0.774 0.571 2e-150
TAIR|locus:2093741607 AT3G24210 [Arabidopsis thalian 0.592 0.515 0.643 2.4e-142
TAIR|locus:2036863624 AT1G62050 "AT1G62050" [Arabido 0.596 0.504 0.544 1.5e-116
MGI|MGI:2144501 626 Ankrd13b "ankyrin repeat domai 0.482 0.407 0.328 8.4e-35
UNIPROTKB|F1P6U9398 ANKRD13C "Uncharacterized prot 0.473 0.628 0.289 1.2e-28
UNIPROTKB|F1NWB4432 ANKRD13C "Uncharacterized prot 0.490 0.599 0.290 1.3e-28
ZFIN|ZDB-GENE-030131-3892488 ankrd13c "ankyrin repeat domai 0.464 0.502 0.299 2.6e-28
UNIPROTKB|A5PK24546 ANKRD13C "ANKRD13C protein" [B 0.490 0.474 0.290 6.8e-28
UNIPROTKB|Q8N6S4541 ANKRD13C "Ankyrin repeat domai 0.490 0.478 0.290 1.6e-27
TAIR|locus:2100900 AT3G04470 "AT3G04470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1953 (692.5 bits), Expect = 8.2e-202, P = 8.2e-202
 Identities = 395/530 (74%), Positives = 437/530 (82%)

Query:     1 MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVI 60
             MED++KY HSP HLAV  RD+AALRRI++ LPRL+KAGEV TE ES+ +E +AD+VSAVI
Sbjct:     1 MEDYSKYTHSPAHLAVVLRDHAALRRIVSDLPRLAKAGEVTTEAESMESESRADSVSAVI 60

Query:    61 DRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMII 120
             DRRDVPGRETPLHLAVRLRDP+SAEILM+AGADWSLQNENGWSALQEAVCTREE+IAMII
Sbjct:    61 DRRDVPGRETPLHLAVRLRDPVSAEILMSAGADWSLQNENGWSALQEAVCTREEAIAMII 120

Query:   121 ARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG 180
             ARHYQPLAWAKWCRRLPRI+ASA+RIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG
Sbjct:   121 ARHYQPLAWAKWCRRLPRIIASASRIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG 180

Query:   181 SNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALE 240
             SNLRADMTLAGFDGF+IQRSDQTFLFLG+GY+SEDG +SLSPGSLIVLSHKEKE+TNALE
Sbjct:   181 SNLRADMTLAGFDGFKIQRSDQTFLFLGDGYSSEDGKMSLSPGSLIVLSHKEKEMTNALE 240

Query:   241 GAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDM 300
             GAGA PT+AEVAHEVALMSQTNMYRPGIDVTQAELV HLNWRRQERTEMVGNWKAKVYDM
Sbjct:   241 GAGAQPTDAEVAHEVALMSQTNMYRPGIDVTQAELVSHLNWRRQERTEMVGNWKAKVYDM 300

Query:   301 LHVMVSVKSRRVPGAMTDEELFAVEDE-DKLANGGDNDEYDDVLTAEERLQLDSALRMGN 359
             LHVMVSVKSRRVPGAMTDEELFAV++E   + NG + D ++DVLT EERLQL+SAL+ GN
Sbjct:   301 LHVMVSVKSRRVPGAMTDEELFAVDEERTAVTNGAETDGFEDVLTPEERLQLNSALQTGN 360

Query:   360 SDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKIL 419
             SD + +D+E  V   QENG            A+K+KK WFGWNKKG+  N ED +  K  
Sbjct:   361 SDAI-EDEECEVTDQQENG------------ALKDKKGWFGWNKKGS--NTEDTKLKKGS 405

Query:   420 KKFSKLAPE-GSNQKSS--SEYPREDVIDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXGL 476
             K   +   + G +QKSS  S++  ED  DA                            GL
Sbjct:   406 KSAPEDGNQKGKSQKSSMVSDHANEDHGDAKKGKEKKKKKKGVAGDEVKRESEYKK--GL 463

Query:   477 RPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVK 526
             RPVLWLTPDFPL TDELLPLLDILANKVKA+RRLRELLTTKLP GTFPVK
Sbjct:   464 RPVLWLTPDFPLTTDELLPLLDILANKVKAVRRLRELLTTKLPLGTFPVK 513
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2010597 AT1G04780 "AT1G04780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093741 AT3G24210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036863 AT1G62050 "AT1G62050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2144501 Ankrd13b "ankyrin repeat domain 13b" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6U9 ANKRD13C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWB4 ANKRD13C "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3892 ankrd13c "ankyrin repeat domain 13C" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A5PK24 ANKRD13C "ANKRD13C protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N6S4 ANKRD13C "Ankyrin repeat domain-containing protein 13C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query528
pfam11904290 pfam11904, GPCR_chapero_1, GPCR-chaperone 5e-75
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.003
>gnl|CDD|221304 pfam11904, GPCR_chapero_1, GPCR-chaperone Back     alignment and domain information 
 Score =  238 bits (610), Expect = 5e-75
 Identities = 109/346 (31%), Positives = 144/346 (41%), Gaps = 102/346 (29%)

Query: 184 RADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAG 243
           R D TLAGFDG + QR D++FLF GE             GSLI + H +KEV NALE   
Sbjct: 1   RVDTTLAGFDGMKWQRGDRSFLFKGEES---------DAGSLIEVDHDDKEVYNALEEL- 50

Query: 244 APPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPH---LNWRRQERTEMVGNWKAKVYDM 300
              ++AE   EVA +  + +   G+D TQ         L WRR E+TE VG ++AKVYD 
Sbjct: 51  ---SDAEEDEEVAALLTSPIVSTGLDTTQIGFERSKSILGWRRSEKTETVGGYEAKVYDA 107

Query: 301 LHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNS 360
            +V +  K+R                              + L+ E++ +L S      S
Sbjct: 108 SNVELITKTRS-----------------------------EHLSEEDQQKLKSGKTSLGS 138

Query: 361 DGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILK 420
            GL  + + G  S Q                                             
Sbjct: 139 -GLGAEQDGGPTSRQGPVE----------------------------------------- 156

Query: 421 KFSKLAPEGSNQKSSSEYPREDVIDAKKGKDKSSKKKKKKGPVSESKSESEYKKGLRPVL 480
                        +  EY  +     KKG+D           +   K ESE KK  +  L
Sbjct: 157 --QSATAPNPTALTPEEY-FKPEFKLKKGRD-----------IGRPKEESEKKKKFKATL 202

Query: 481 WLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVK 526
           WL+ DFPL  ++LLP+LD+LANK K  RRLRE +TTKLP G FPVK
Sbjct: 203 WLSEDFPLSLEQLLPILDLLANKNKHFRRLREFVTTKLPPG-FPVK 247

This domain, and the associated ANK family repeat pfam00023 domain, together act as a chaperone for biogenesis and folding of the DP receptor for prostaglandin D2. Length = 290
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 528
KOG0522 560 consensus Ankyrin repeat protein [General function 100.0
PF11904307 GPCR_chapero_1: GPCR-chaperone; InterPro: IPR02183 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.9
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.87
PHA02859209 ankyrin repeat protein; Provisional 99.82
PHA02791284 ankyrin-like protein; Provisional 99.82
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.81
PHA02875413 ankyrin repeat protein; Provisional 99.79
PHA02791284 ankyrin-like protein; Provisional 99.78
PHA02878477 ankyrin repeat protein; Provisional 99.78
PHA02874434 ankyrin repeat protein; Provisional 99.77
PHA02741169 hypothetical protein; Provisional 99.76
PHA02946446 ankyin-like protein; Provisional 99.75
PHA02875413 ankyrin repeat protein; Provisional 99.75
KOG0514452 consensus Ankyrin repeat protein [General function 99.75
PHA03100480 ankyrin repeat protein; Provisional 99.75
PHA02878477 ankyrin repeat protein; Provisional 99.75
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.74
PHA03100480 ankyrin repeat protein; Provisional 99.74
PHA02874434 ankyrin repeat protein; Provisional 99.74
PHA02946446 ankyin-like protein; Provisional 99.74
PHA03095471 ankyrin-like protein; Provisional 99.74
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.73
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.72
PHA02798489 ankyrin-like protein; Provisional 99.72
PHA02989494 ankyrin repeat protein; Provisional 99.71
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.71
PHA02795437 ankyrin-like protein; Provisional 99.71
PHA02876682 ankyrin repeat protein; Provisional 99.71
KOG0510 929 consensus Ankyrin repeat protein [General function 99.7
PHA02736154 Viral ankyrin protein; Provisional 99.7
PHA03095471 ankyrin-like protein; Provisional 99.7
KOG0508615 consensus Ankyrin repeat protein [General function 99.7
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.69
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.68
PHA02859209 ankyrin repeat protein; Provisional 99.68
PLN03192823 Voltage-dependent potassium channel; Provisional 99.68
PHA02743166 Viral ankyrin protein; Provisional 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
PHA02917661 ankyrin-like protein; Provisional 99.66
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.66
PHA02876682 ankyrin repeat protein; Provisional 99.66
PHA02884300 ankyrin repeat protein; Provisional 99.65
PHA02989494 ankyrin repeat protein; Provisional 99.65
PHA02798489 ankyrin-like protein; Provisional 99.64
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.63
KOG0508615 consensus Ankyrin repeat protein [General function 99.63
KOG0510 929 consensus Ankyrin repeat protein [General function 99.62
PHA02795437 ankyrin-like protein; Provisional 99.61
PHA02741169 hypothetical protein; Provisional 99.6
PHA02736154 Viral ankyrin protein; Provisional 99.6
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.59
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.58
PLN03192823 Voltage-dependent potassium channel; Provisional 99.57
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.56
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.56
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.51
PHA02730672 ankyrin-like protein; Provisional 99.5
PHA02917661 ankyrin-like protein; Provisional 99.49
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.48
PHA02884300 ankyrin repeat protein; Provisional 99.47
PHA02730 672 ankyrin-like protein; Provisional 99.44
PHA02743166 Viral ankyrin protein; Provisional 99.43
TIGR00870743 trp transient-receptor-potential calcium channel p 99.42
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.4
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.4
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.38
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.37
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.32
PHA02792631 ankyrin-like protein; Provisional 99.31
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.31
KOG0514452 consensus Ankyrin repeat protein [General function 99.29
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.28
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.27
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.26
PHA02792631 ankyrin-like protein; Provisional 99.24
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.21
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.2
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.18
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.18
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.16
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.14
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.13
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.13
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.12
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.07
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.97
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.83
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.78
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.72
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.69
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.64
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.63
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.6
PF1360630 Ank_3: Ankyrin repeat 98.55
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.54
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.52
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.38
PF1360630 Ank_3: Ankyrin repeat 98.27
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.09
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.09
KOG2384223 consensus Major histocompatibility complex protein 98.04
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.92
KOG0522560 consensus Ankyrin repeat protein [General function 97.83
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.75
KOG0818669 consensus GTPase-activating proteins of the GIT fa 97.71
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.71
KOG0520975 consensus Uncharacterized conserved protein, conta 97.69
KOG2384223 consensus Major histocompatibility complex protein 97.53
KOG0511516 consensus Ankyrin repeat protein [General function 97.48
KOG0511516 consensus Ankyrin repeat protein [General function 97.44
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 97.41
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.4
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.72
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.4
KOG2505591 consensus Ankyrin repeat protein [General function 96.29
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.13
KOG0520975 consensus Uncharacterized conserved protein, conta 94.93
KOG2505591 consensus Ankyrin repeat protein [General function 94.87
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 86.24
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-97  Score=773.49  Aligned_cols=400  Identities=44%  Similarity=0.677  Sum_probs=342.5

Q ss_pred             hHHHHHHHcCCHHHHHHHHHhCCCCCcCCCCCchhhHHHHHhccccccccccccCCCCCCcHHHHHHHcCCHHHHHHHHH
Q 009685           10 SPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMA   89 (528)
Q Consensus        10 TPLH~Aa~~G~~e~vk~LL~~ga~v~~~~~~~t~l~~~A~~~~~~~vga~In~kD~p~G~TPLHlAa~~G~~e~VklLL~   89 (528)
                      .|||+++...+.+.+..++...                        ++..|+.+|. .|+||||+||+.||.++++.||.
T Consensus        22 ~~lh~~~~~~~~~sl~~el~~~------------------------~~~~id~~D~-~g~TpLhlAV~Lg~~~~a~~Ll~   76 (560)
T KOG0522|consen   22 KPLHWAVVTTDSDSLEQELLAK------------------------VSLVIDRRDP-PGRTPLHLAVRLGHVEAARILLS   76 (560)
T ss_pred             cccchhhhccchhhHHHHHhhh------------------------hhceeccccC-CCCccHHHHHHhcCHHHHHHHHh
Confidence            4599999998888777766541                        1356899996 89999999999999999999999


Q ss_pred             cCCCCCCcCCCCCcHHHHHHHcCCHHHHHHHHHhcCChhHHhhcCCchHHHHHHhhhhhHHHHhhccccccccccccccC
Q 009685           90 AGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIA  169 (528)
Q Consensus        90 ~GAdvn~~n~~G~TpLh~A~~~g~~eivklLL~~ga~i~~~~~~g~tPl~lA~l~~~~Df~~emkw~f~SswvPlvsr~~  169 (528)
                      +||++..+|+.||+|||.|+++|+.+++..++++.....+..+..+.|.+++++.+++||||||+|+|+| ||||+||||
T Consensus        77 a~Adv~~kN~~gWs~L~EAv~~g~~q~i~~vlr~~~~q~~~~~~~~~p~ll~~l~~~~DFYmE~~wdF~S-WvPlvSrI~  155 (560)
T KOG0522|consen   77 AGADVSIKNNEGWSPLHEAVSTGNEQIITEVLRHLKYQAWEKWERRLPRLLAKLSEMPDFYMEMKWDFQS-WIPLLSRIL  155 (560)
T ss_pred             cCCCccccccccccHHHHHHHcCCHHHHHHHHHHhHHHHHHHHHhcchHHHHHHHhCccceEEEEeccee-ehhhhhccC
Confidence            9999999999999999999999999999999999988888889999999999999999999999999998 999999999


Q ss_pred             CCCceeeeccCccccccceeccccCceEeecceeEEEecCCCcCCCCCcccCCCceEEEeccchhhhhhhccCCCCCCHH
Q 009685          170 PSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEA  249 (528)
Q Consensus       170 psD~~kI~K~G~~lR~DttL~gf~~~~~~Rg~~S~if~g~~~~~~~~~~~~~~~~l~~~dh~~~~~~~~~~~~~~~~~~~  249 (528)
                      |||+|+|||+|++||+||||+||++|+|+|||+||||+|++          ++|++|+|||++|+|+++++.++.+++|.
T Consensus       156 PSD~~kIyK~G~~lR~DTTL~gF~~m~wqRGd~SFlF~gd~----------~~~e~lvl~hdek~v~~~~~r~~~e~se~  225 (560)
T KOG0522|consen  156 PSDTCKIYKRGSSLRADTTLAGFEGMKWQRGDQSFLFRGDA----------NPAELLVLDHDEKVVTNAFQRLRDEESEA  225 (560)
T ss_pred             chhhHHHhhcccceeeeeeeecCCCceEEecceEEEEecCC----------CcceeEEEeccchhhHHHHHhcccccchh
Confidence            99999999999999999999999999999999999999996          35899999999999999999899999999


Q ss_pred             HHHHHHHhhhcCcccccceeeeeeee-ccccccccccceeeecCeeeeEEEeeceEEEEEeeccCCCCChhhhhhhhhhh
Q 009685          250 EVAHEVALMSQTNMYRPGIDVTQAEL-VPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDED  328 (528)
Q Consensus       250 ~v~~~v~~~~~t~i~~~~~~~~~~~~-~~~~~W~~~~k~E~v~~~~a~vy~~~~v~~~~r~r~~~~~~~~~~~~~~~~~~  328 (528)
                      +++++|+.+|+++|+.+++|++.|.| ++++||||++|+|+||||+||||+|+||+|+||+|++  |||+|+..++..  
T Consensus       226 ~~~~eVd~~ls~~i~~t~l~tktiaF~~~~~gWrr~ek~E~Vg~y~akvY~v~nv~l~tk~Rre--HLs~ed~~r~~~--  301 (560)
T KOG0522|consen  226 EMEEEVDVRLSQDILYTPLDTKTIAFERGFLGWRRQEKTETVGGYKAKVYDVSNVHLSTKKRRE--HLSEEDEKRVIE--  301 (560)
T ss_pred             hhHHHHHHHhcCcceeccccchhHHHHHhhhhhhhhchhhhccCeeeeEEeecceEEEEeeccc--ccchHHHhhhhh--
Confidence            99999999999999999999999977 7999999999999999999999999999999999998  999999887432  


Q ss_pred             hhcCCCCCCcccccccHHHHHHHHHHhhcCCCCCCCCCCCCCccccccCCCCCcccCCCCCccchhhccccccccCCCCC
Q 009685          329 KLANGGDNDEYDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKN  408 (528)
Q Consensus       329 ~~~~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  408 (528)
                                 +..+|..|++ +.++..++++.   ..++|.                  +. -.-+.            
T Consensus       302 -----------~~~~~~~es~-~~~~~~~~~~~---~~~~~~------------------~r-~l~~~------------  335 (560)
T KOG0522|consen  302 -----------EAQLTPLESN-LLSIKETMFGP---KTAECA------------------NR-DLYTS------------  335 (560)
T ss_pred             -----------hccCChhhhh-hhhhhhhcCCC---cccccc------------------cc-chhhc------------
Confidence                       2245666666 56666555542   112221                  00 00000            


Q ss_pred             CcccchhhhhHhhhcccCCCCCCCCCC---CCCCCcccccccccccccccccccCCCCCCCcccccccccccceeeecCC
Q 009685          409 NVEDAEDSKILKKFSKLAPEGSNQKSS---SEYPREDVIDAKKGKDKSSKKKKKKGPVSESKSESEYKKGLRPVLWLTPD  485 (528)
Q Consensus       409 ~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~k~~r~~~wls~~  485 (528)
                                     .+.+|+. -++.   ++|.....+... ||.+               .+++++|+|||+||||++
T Consensus       336 ---------------sls~~pt-~i~p~~~~~~~~a~~g~~~-GR~~---------------~~k~~~k~fkA~lwmsee  383 (560)
T KOG0522|consen  336 ---------------SLSAPPT-AITPPEYENYEGALIGKDP-GRPK---------------EEKEKKKKFKATLWMSEE  383 (560)
T ss_pred             ---------------ccCCCcc-cCCCCcccccccccccCCC-CCch---------------hhhhhhhhhhhheeeccc
Confidence                           1222221 1111   445555554423 8876               577889999999999999


Q ss_pred             CCCCcccccchhHHhhhhhHHHHHHHHHhhccCCCCCCCcccC
Q 009685          486 FPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKDK  528 (528)
Q Consensus       486 fPl~~~~llplldila~~~k~~~rlre~~t~klp~g~FPVK~~  528 (528)
                      |||++|+||||||||||.+|||+|||||||+||||| |||||+
T Consensus       384 fPLsldqllpildlmA~~~khf~rLReFitlkLPpG-FPVKie  425 (560)
T KOG0522|consen  384 FPLSLDQLLPILDLMANPSKHFARLREFITLKLPPG-FPVKIE  425 (560)
T ss_pred             CCccHHHHHHHHHHHcccHHHHHHHHHHHhhcCCCC-CceeEe
Confidence            999999999999999999999999999999999999 999984

>PF11904 GPCR_chapero_1: GPCR-chaperone; InterPro: IPR021832 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query528
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-04
2pnn_A273 Transient receptor potential cation channel subfa 5e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-04
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
 Score = 49.6 bits (118), Expect = 1e-06
 Identities = 18/105 (17%), Positives = 40/105 (38%), Gaps = 1/105 (0%)

Query: 5   AKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRD 64
           AKY    +   + ++    ++                 +D  L        ++ +++ +D
Sbjct: 221 AKYYLDILMGWIVKKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNAQD 280

Query: 65  VPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAV 109
             G  T L++A RL +    + L+  GAD  + N++G   +    
Sbjct: 281 SNGD-TCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGA 324
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query528
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.9
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.9
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.89
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.88
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.88
3hra_A201 Ankyrin repeat family protein; structural protein; 99.87
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.87
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.87
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.87
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.86
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.86
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.86
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.86
2rfa_A232 Transient receptor potential cation channel subfa 99.86
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.86
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
2etb_A256 Transient receptor potential cation channel subfam 99.85
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.85
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.85
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.85
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.85
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.85
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.85
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.85
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.85
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.85
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.85
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.85
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.84
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.84
2rfa_A232 Transient receptor potential cation channel subfa 99.84
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.84
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.84
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.84
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.84
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.84
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.84
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.84
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.83
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.83
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.83
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.83
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.83
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.83
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.82
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.82
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.82
2etb_A256 Transient receptor potential cation channel subfam 99.82
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.82
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.81
2pnn_A273 Transient receptor potential cation channel subfa 99.81
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.81
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.81
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.81
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.81
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.81
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.81
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.8
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.8
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.8
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.8
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.8
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.79
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.79
2pnn_A273 Transient receptor potential cation channel subfa 99.79
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.79
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.79
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.79
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.78
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.78
3hra_A201 Ankyrin repeat family protein; structural protein; 99.78
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.78
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.78
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.78
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.77
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.77
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.77
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.77
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.77
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.76
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.76
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.74
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.73
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.73
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.72
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.7
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.7
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.7
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.7
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.68
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.67
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.66
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.65
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.65
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.64
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.64
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.64
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.64
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.64
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.58
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.53
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.53
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.48
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.47
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.46
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.90  E-value=3.5e-23  Score=193.15  Aligned_cols=138  Identities=16%  Similarity=0.182  Sum_probs=124.7

Q ss_pred             hHHHHHHHcCCHHHHHHHHHhCCCCCcCCC-CCchhhHHHHHhccccc------cccccccCCCCCCcHHHHHHHcCCHH
Q 009685           10 SPVHLAVARRDYAALRRIIATLPRLSKAGE-VNTEDESLAAELQADAV------SAVIDRRDVPGRETPLHLAVRLRDPI   82 (528)
Q Consensus        10 TPLH~Aa~~G~~e~vk~LL~~ga~v~~~~~-~~t~l~~~A~~~~~~~v------ga~In~kD~p~G~TPLHlAa~~G~~e   82 (528)
                      ++|+.||..|+.++|+.||++|++++..+. +.++++.++..+....+      |++++.+|. .|+||||+|+..|+.+
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~-~g~TpLh~A~~~g~~~   84 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDS-DGRTPLHHAAENGHKE   84 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT-TSCCHHHHHHHTTCHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhcc-CCCCHHHHHHHcCCHH
Confidence            479999999999999999999999998554 56777666666655444      899999997 9999999999999999


Q ss_pred             HHHHHHHcCCCCCCcCCCCCcHHHHHHHcCCHHHHHHHHHhcCChhHHhhcCCchHHHHHHhhhhh
Q 009685           83 SAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRD  148 (528)
Q Consensus        83 ~VklLL~~GAdvn~~n~~G~TpLh~A~~~g~~eivklLL~~ga~i~~~~~~g~tPl~lA~l~~~~D  148 (528)
                      ++++|+++|++++.+|..|+||||+|+..|+.+++++|+++|++++..+..|+||+++|+..+..+
T Consensus        85 ~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~  150 (169)
T 4gpm_A           85 VVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNEE  150 (169)
T ss_dssp             HHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHH
T ss_pred             HHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCCHH
Confidence            999999999999999999999999999999999999999999999999999999999999876544
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 528
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.004
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.002
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.003
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.004
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Swi6 ankyrin-repeat fragment
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 52.7 bits (125), Expect = 4e-08
 Identities = 18/109 (16%), Positives = 40/109 (36%), Gaps = 1/109 (0%)

Query: 1   MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVI 60
               AKY    +   + ++    ++                 +D  L        ++ ++
Sbjct: 193 CSAAAKYYLDILMGWIVKKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANML 252

Query: 61  DRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAV 109
           + +D  G  T L++A RL +    + L+  GAD  + N++G   +    
Sbjct: 253 NAQDSNGD-TCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGA 300
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query528
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.83
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.82
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.82
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.8
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.79
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.78
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.78
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.78
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.77
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.76
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.75
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.75
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.74
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.74
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.72
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.72
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.71
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.71
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.71
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.67
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.65
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.64
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.63
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.63
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.61
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.61
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.57
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.56
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.52
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.4
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.85  E-value=3.3e-21  Score=184.73  Aligned_cols=148  Identities=18%  Similarity=0.142  Sum_probs=123.0

Q ss_pred             CCCCCCCCChHHHHHHHcCCHHHHHHHHHhCCCCCcCCC-CCchhhHHHHHhccccc-----------------------
Q 009685            1 MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGE-VNTEDESLAAELQADAV-----------------------   56 (528)
Q Consensus         1 IN~~D~~G~TPLH~Aa~~G~~e~vk~LL~~ga~v~~~~~-~~t~l~~~A~~~~~~~v-----------------------   56 (528)
                      +|.+|.+|.||||+||..|+.+++++||++|++++..+. +.++++.++..++.+++                       
T Consensus        38 i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~tpL~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~  117 (255)
T d1oy3d_          38 LDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQ  117 (255)
T ss_dssp             GGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCHHHHHTTTTCHHHHHHHSSSCCSSCCCC---------
T ss_pred             ccCcCCCCCCccchHHhhcccccccccccccccccccccccchhhhhhhccCchHHHHHHHhhccchhcccchhhhhHHh
Confidence            356788999999999999999999999999999887544 45555443332221110                       


Q ss_pred             ------------------------------cccccccCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCc-CCCCCcHH
Q 009685           57 ------------------------------SAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQ-NENGWSAL  105 (528)
Q Consensus        57 ------------------------------ga~In~kD~p~G~TPLHlAa~~G~~e~VklLL~~GAdvn~~-n~~G~TpL  105 (528)
                                                    +..++.+|. .|.||||+||..++.+++++|+++|++.+.. +..|+|||
T Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~-~g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL  196 (255)
T d1oy3d_         118 DCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENY-DGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPL  196 (255)
T ss_dssp             --------------------------CCCGGGGTTCCCT-TSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHH
T ss_pred             hhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccc-cCcccccccccccccccccchhcccccccccccccccccc
Confidence                                          466677887 8999999999999999999999999998865 67899999


Q ss_pred             HHHHHcCCHHHHHHHHHhcCChhHHhhcCCchHHHHHHhhhhhH
Q 009685          106 QEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDF  149 (528)
Q Consensus       106 h~A~~~g~~eivklLL~~ga~i~~~~~~g~tPl~lA~l~~~~Df  149 (528)
                      |+|+..|+.+++++|+++|++++.++..|.||+++|+..+..+.
T Consensus       197 ~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~i  240 (255)
T d1oy3d_         197 HLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPIL  240 (255)
T ss_dssp             HHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHH
T ss_pred             cccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHH
Confidence            99999999999999999999999999999999999997776554
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure