Citrus Sinensis ID: 009704

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------53

MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILKKFSKLAPEGSNQKSSSEYPREDVIDAKKGKDKSSKKKKKKGPVSESKSESEYKKGLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKVN

ccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHccccccEEccEEccccccccccccccEEEccccccccccccccccccEEEEEcccHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccEEEEEcccccccccccEEEcccEEEEEEEEEcEEEEEEEEcccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccc

cccHHHHccccHHHHHHHcHHHHHHHHHHHccccccccHcccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccEEEEEEEEEEcccHHHHHHccccccEEEEEcccEEEEEEEEEcccccEEEEccEEEEEEccccccccccccccccEEEEEccccHHHHHHHHHccccccHHHHHHHHcHHHccccccccccEEEEEEEEcccccccccEEEEcccEEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHccccccccHcccccHHHHccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHEccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEc

medfakyahspvhlAVARRDYAALRRIIATLprlskagevntedESLAAELQADAVSAVidrrdvpgretplHLAVRLRDPISAEILMAAGadwslqnenGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHfessvipfigriapsdtyRIWKRgsnlradmtlagfdgfriqrsdqTFLFlgegytsedgnvslspgslivlSHKEKEVTnalegagappteaEVAHEVALMSqtnmyrpgidvtqaelvphlnwrrQERTEMVGNWKAKVYDMLHVMVSVksrrvpgamtdeelfavededklanggdndeyddvLTAEERLQLDSALRmgnsdglcdddengvlscqengsgvsyengeansavkekkswfgwnkkgtknnvedaedSKILKKFSklapegsnqkssseypredvidakkgkdksskkkkkkgpvseskseseykkglrpvlwltpdfplktdellpLLDILANKVKAIRRLRELLTtklpsgtfpvkvn

medfakyahspvhlavARRDYAALRRIIATlprlskagevntEDESLAAELQADAvsavidrrdvpgretplhlavrlrDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHfessvipfigriaPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELfavededklanggdndeyDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSavkekkswfgwnkkgtknnvedaedsKILKKFsklapegsnqkssseypredvidakkgkdksskkkkkkgpvseskseseykkglrpvlwltpdfPLKTDELLPLLDILANKVKAIRRLREllttklpsgtfpvkvn

MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILKKFSKLAPEGSNQKSSSEYPREDVIDAkkgkdksskkkkkkgpvseskseseykkGLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKVN

******YAHSPVHLAVARRDYAALRRIIATLPRL********************AVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNV*****SLIVL*************************EVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRV*************************************************************************************WFGW*************************************************************************GLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKL**********

**DFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKE**********************LMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSV*********************************************************DDDENGVLS*****************************************************************************************************GLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKVN

********HSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILKKFSKL***************EDVIDA****************************GLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKVN

*EDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDED********************************************************************************************************************************************ESEYKKGLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKVN

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		528	2.2.26 [Sep-21-2011]
Q86YJ7		626	Ankyrin repeat domain-con	yes	no	0.481	0.405	0.338	2e-29
Q5F259		626	Ankyrin repeat domain-con	yes	no	0.482	0.407	0.328	4e-29
Q6NRD0		510	Ankyrin repeat domain-con	N/A	no	0.471	0.488	0.291	2e-21
Q7ZYD9		513	Ankyrin repeat domain-con	N/A	no	0.465	0.479	0.290	2e-21
Q3UX43		541	Ankyrin repeat domain-con	no	no	0.448	0.438	0.295	2e-21
Q8IZ07		590	Ankyrin repeat domain-con	no	no	0.494	0.442	0.277	3e-21
Q8N6S4		541	Ankyrin repeat domain-con	no	no	0.496	0.484	0.277	3e-21
Q7ZUV0		488	Ankyrin repeat domain-con	no	no	0.448	0.485	0.295	4e-21
Q28C34		509	Ankyrin repeat domain-con	no	no	0.471	0.489	0.287	7e-21
Q80UP5		588	Ankyrin repeat domain-con	no	no	0.306	0.275	0.345	5e-18

>sp\|Q86YJ7\|AN13B_HUMAN Ankyrin repeat domain-containing protein 13B OS=Homo sapiens GN=ANKRD13B PE=2 SV=4	Back alignment and function desciption

 Score =  130 bits (327), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/269 (33%), Positives = 146/269 (54%), Gaps = 15/269 (5%)

Query: 47  LAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQ 106
           L  E++A  V   I++ D  GR TPLHLA  L     A +L+A GAD   +N +GW+ LQ
Sbjct: 30  LEKEVRAGQVD--IEQLDPRGR-TPLHLATTLGHLECARVLLAHGADVGRENRSGWTVLQ 86

Query: 107 EAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIG 166
           EAV TR+  +  ++ R+       K    +P ++    + +DFY+E+ + F +S +P + 
Sbjct: 87  EAVSTRDLELVQLVLRYRDYQRVVKRLAGIPVLLEKLRKAQDFYVEMKWEF-TSWVPLVS 145

Query: 167 RIAPSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSE----DGNVSLSP 222
           +I PSDTY++WK G NLR D TL GFD    QR +++F+F G+  ++     D +  +  
Sbjct: 146 KICPSDTYKVWKSGQNLRVDTTLLGFDHMTWQRGNRSFVFRGQDTSAVVMEIDHDRRVVY 205

Query: 223 GSLIVLSHKEKEVTNALEGAGAPPTEAEVAHEV-ALMSQTNMYRPGIDVTQAELVPHLNW 281
              + L+ +++E    L  A A PTE +V   + A +  T +    I   + +    L W
Sbjct: 206 TETLALAGQDRE----LLLAAAQPTEEQVLSRLTAPVVTTQLDTKNISFERNK-TGILGW 260

Query: 282 RRQERTEMVGNWKAKVYDMLHVMVSVKSR 310
            R E+TEMV  ++AKVY   +V +  ++R
Sbjct: 261 -RSEKTEMVNGYEAKVYGASNVELITRTR 288

Homo sapiens (taxid: 9606)

>sp\|Q5F259\|AN13B_MOUSE Ankyrin repeat domain-containing protein 13B OS=Mus musculus GN=Ankrd13b PE=2 SV=1	Back alignment and function description

>sp\|Q6NRD0\|A13CA_XENLA Ankyrin repeat domain-containing protein 13C-A OS=Xenopus laevis GN=ankrd13c-a PE=2 SV=1	Back alignment and function description

>sp\|Q7ZYD9\|A13CB_XENLA Ankyrin repeat domain-containing protein 13C-B OS=Xenopus laevis GN=ankrd13c-b PE=2 SV=1	Back alignment and function description

>sp\|Q3UX43\|AN13C_MOUSE Ankyrin repeat domain-containing protein 13C OS=Mus musculus GN=Ankrd13c PE=2 SV=2	Back alignment and function description

>sp\|Q8IZ07\|AN13A_HUMAN Ankyrin repeat domain-containing protein 13A OS=Homo sapiens GN=ANKRD13A PE=1 SV=3	Back alignment and function description

>sp\|Q8N6S4\|AN13C_HUMAN Ankyrin repeat domain-containing protein 13C OS=Homo sapiens GN=ANKRD13C PE=2 SV=2	Back alignment and function description

>sp\|Q7ZUV0\|AN13C_DANRE Ankyrin repeat domain-containing protein 13C OS=Danio rerio GN=ankrd13c PE=2 SV=1	Back alignment and function description

>sp\|Q28C34\|AN13C_XENTR Ankyrin repeat domain-containing protein 13C OS=Xenopus tropicalis GN=ankrd13c PE=2 SV=1	Back alignment and function description

>sp\|Q80UP5\|AN13A_MOUSE Ankyrin repeat domain-containing protein 13A OS=Mus musculus GN=Ankrd13a PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		528
255561957		661	protein binding protein, putative [Ricin	0.998	0.797	0.876	0.0
359488099		660	PREDICTED: ankyrin repeat domain-contain	0.998	0.798	0.872	0.0
449470224		658	PREDICTED: ankyrin repeat domain-contain	0.998	0.800	0.840	0.0
356505985		689	PREDICTED: ankyrin repeat domain-contain	0.998	0.764	0.805	0.0
356576680		645	PREDICTED: uncharacterized protein LOC10	0.981	0.803	0.806	0.0
356535198		725	PREDICTED: ankyrin repeat domain-contain	0.973	0.708	0.792	0.0
449449585		657	PREDICTED: ankyrin repeat domain-contain	0.998	0.802	0.795	0.0
79391178		640	ankyrin repeat-containing protein [Arabi	0.958	0.790	0.777	0.0
297833124		640	hypothetical protein ARALYDRAFT_896477 [	0.958	0.790	0.777	0.0
357441395		631	Ankyrin repeat domain-containing protein	0.941	0.787	0.729	0.0

>gi\|255561957\|ref\|XP_002521987.1\| protein binding protein, putative [Ricinus communis] gi\|223538791\|gb\|EEF40391.1\| protein binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/534 (87%), Positives = 497/534 (93%), Gaps = 7/534 (1%)

Query: 1   MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVI 60
           ME F+KYAHSP H+AVARRDYAALR +I+TLPRL+KAGEVNTE+ESLAAE +ADAVSAVI
Sbjct: 1   MEAFSKYAHSPAHIAVARRDYAALRHVISTLPRLAKAGEVNTEEESLAAEERADAVSAVI 60

Query: 61  DRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMII 120
           DRRDVPGRETPLHLAV+LRDPISAEILMAAGADWSLQNE+GWSALQEAVCTREE IAMII
Sbjct: 61  DRRDVPGRETPLHLAVKLRDPISAEILMAAGADWSLQNEHGWSALQEAVCTREERIAMII 120

Query: 121 ARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG 180
           ARHYQPLAWAKWCRRLPRIVASA+RIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG
Sbjct: 121 ARHYQPLAWAKWCRRLPRIVASASRIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG 180

Query: 181 SNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALE 240
           SNLRADMTLAGFDGFRIQRSDQTFLFLGEGY+SEDGN SL PGSLIVL+HKEKEVTNALE
Sbjct: 181 SNLRADMTLAGFDGFRIQRSDQTFLFLGEGYSSEDGNTSLPPGSLIVLAHKEKEVTNALE 240

Query: 241 GAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDM 300
           GAGA PTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQER+EMVGNWKAKVYDM
Sbjct: 241 GAGAQPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERSEMVGNWKAKVYDM 300

Query: 301 LHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNS 360
           LHVMVSVKSRRVPGAMTDEELFAV+DE+KL NG DNDE+DDVLTAEER QLDSALRMG+S
Sbjct: 301 LHVMVSVKSRRVPGAMTDEELFAVDDEEKLVNGADNDEFDDVLTAEERKQLDSALRMGSS 360

Query: 361 DGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILK 420
           DGLC+D+E GV+  QENGSG SYENGE+N ++KEKKSWFGW  KG KNN +D ED+KILK
Sbjct: 361 DGLCEDEEPGVIEFQENGSGGSYENGESNGSIKEKKSWFGWKNKGPKNNNDDPEDTKILK 420

Query: 421 KFSKLAPEGS------NQKSSSEYPR-EDVIDAKKGKDKSSKKKKKKGPVSESKSESEYK 473
           KFSKLAPEG       NQ+SSSE+ R ED+ D KKGKDK SKKKKKK P SESK ESEYK
Sbjct: 421 KFSKLAPEGGTQKSVDNQRSSSEFSRAEDLGDGKKGKDKGSKKKKKKVPGSESKHESEYK 480

Query: 474 KGLRPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKV 527
           KGLRPVLWLTPDFPL+TDELLPLLDILANKVKAIRRLRELLTTKLP GTFPVKV
Sbjct: 481 KGLRPVLWLTPDFPLQTDELLPLLDILANKVKAIRRLRELLTTKLPQGTFPVKV 534

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359488099\|ref\|XP_002266715.2\| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449470224\|ref\|XP_004152818.1\| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Cucumis sativus] gi\|449477722\|ref\|XP_004155104.1\| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356505985\|ref\|XP_003521769.1\| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like [Glycine max]	Back alignment and taxonomy information

>gi\|356576680\|ref\|XP_003556458.1\| PREDICTED: uncharacterized protein LOC100801892 [Glycine max]	Back alignment and taxonomy information

>gi\|356535198\|ref\|XP_003536135.1\| PREDICTED: ankyrin repeat domain-containing protein 13A-like [Glycine max]	Back alignment and taxonomy information

>gi\|449449585\|ref\|XP_004142545.1\| PREDICTED: ankyrin repeat domain-containing protein 13A-like [Cucumis sativus] gi\|449479795\|ref\|XP_004155709.1\| PREDICTED: ankyrin repeat domain-containing protein 13A-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|79391178\|ref\|NP_566227.3\| ankyrin repeat-containing protein [Arabidopsis thaliana] gi\|7547106\|gb\|AAF63778.1\| unknown protein [Arabidopsis thaliana] gi\|332640565\|gb\|AEE74086.1\| ankyrin repeat-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297833124\|ref\|XP_002884444.1\| hypothetical protein ARALYDRAFT_896477 [Arabidopsis lyrata subsp. lyrata] gi\|297330284\|gb\|EFH60703.1\| hypothetical protein ARALYDRAFT_896477 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|357441395\|ref\|XP_003590975.1\| Ankyrin repeat domain-containing protein 13C-B [Medicago truncatula] gi\|355480023\|gb\|AES61226.1\| Ankyrin repeat domain-containing protein 13C-B [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		528
TAIR\|locus:2100900		640	AT3G04470 "AT3G04470" [Arabido	0.965	0.796	0.743	6.4e-202
TAIR\|locus:2010597		664	AT1G04780 "AT1G04780" [Arabido	0.975	0.775	0.572	7.6e-151
TAIR\|locus:2093741		607	AT3G24210 [Arabidopsis thalian	0.592	0.515	0.643	8.9e-143
TAIR\|locus:2036863		624	AT1G62050 "AT1G62050" [Arabido	0.596	0.504	0.544	9.3e-117
MGI\|MGI:2144501		626	Ankrd13b "ankyrin repeat domai	0.482	0.407	0.328	4.1e-35
UNIPROTKB\|F1P6U9		398	ANKRD13C "Uncharacterized prot	0.473	0.628	0.289	7.3e-29
UNIPROTKB\|F1NWB4		432	ANKRD13C "Uncharacterized prot	0.490	0.599	0.290	8.3e-29
ZFIN\|ZDB-GENE-030131-3892		488	ankrd13c "ankyrin repeat domai	0.464	0.502	0.299	1.6e-28
UNIPROTKB\|A5PK24		546	ANKRD13C "ANKRD13C protein" [B	0.490	0.474	0.290	4.2e-28
UNIPROTKB\|Q8N6S4		541	ANKRD13C "Ankyrin repeat domai	0.490	0.478	0.290	9.9e-28

TAIR\|locus:2100900 AT3G04470 "AT3G04470" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1954 (692.9 bits), Expect = 6.4e-202, P = 6.4e-202
 Identities = 395/531 (74%), Positives = 438/531 (82%)

Query:     1 MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVI 60
             MED++KY HSP HLAV  RD+AALRRI++ LPRL+KAGEV TE ES+ +E +AD+VSAVI
Sbjct:     1 MEDYSKYTHSPAHLAVVLRDHAALRRIVSDLPRLAKAGEVTTEAESMESESRADSVSAVI 60

Query:    61 DRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAVCTREESIAMII 120
             DRRDVPGRETPLHLAVRLRDP+SAEILM+AGADWSLQNENGWSALQEAVCTREE+IAMII
Sbjct:    61 DRRDVPGRETPLHLAVRLRDPVSAEILMSAGADWSLQNENGWSALQEAVCTREEAIAMII 120

Query:   121 ARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG 180
             ARHYQPLAWAKWCRRLPRI+ASA+RIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG
Sbjct:   121 ARHYQPLAWAKWCRRLPRIIASASRIRDFYMEITFHFESSVIPFIGRIAPSDTYRIWKRG 180

Query:   181 SNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALE 240
             SNLRADMTLAGFDGF+IQRSDQTFLFLG+GY+SEDG +SLSPGSLIVLSHKEKE+TNALE
Sbjct:   181 SNLRADMTLAGFDGFKIQRSDQTFLFLGDGYSSEDGKMSLSPGSLIVLSHKEKEMTNALE 240

Query:   241 GAGAPPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPHLNWRRQERTEMVGNWKAKVYDM 300
             GAGA PT+AEVAHEVALMSQTNMYRPGIDVTQAELV HLNWRRQERTEMVGNWKAKVYDM
Sbjct:   241 GAGAQPTDAEVAHEVALMSQTNMYRPGIDVTQAELVSHLNWRRQERTEMVGNWKAKVYDM 300

Query:   301 LHVMVSVKSRRVPGAMTDEELFAVEDE-DKLANGGDNDEYDDVLTAEERLQLDSALRMGN 359
             LHVMVSVKSRRVPGAMTDEELFAV++E   + NG + D ++DVLT EERLQL+SAL+ GN
Sbjct:   301 LHVMVSVKSRRVPGAMTDEELFAVDEERTAVTNGAETDGFEDVLTPEERLQLNSALQTGN 360

Query:   360 SDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKIL 419
             SD + +D+E  V   QENG            A+K+KK WFGWNKKG+  N ED +  K  
Sbjct:   361 SDAI-EDEECEVTDQQENG------------ALKDKKGWFGWNKKGS--NTEDTKLKKGS 405

Query:   420 KKFSKLAPE-GSNQKSS--SEYPREDVIDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXGL 476
             K   +   + G +QKSS  S++  ED  DA                            GL
Sbjct:   406 KSAPEDGNQKGKSQKSSMVSDHANEDHGDAKKGKEKKKKKKGVAGDEVKRESEYKK--GL 463

Query:   477 RPVLWLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKV 527
             RPVLWLTPDFPL TDELLPLLDILANKVKA+RRLRELLTTKLP GTFPVK+
Sbjct:   464 RPVLWLTPDFPLTTDELLPLLDILANKVKAVRRLRELLTTKLPLGTFPVKL 514

GO:0003674 "molecular_function" evidence=ND

GO:0008150 "biological_process" evidence=ND

GO:0005886 "plasma membrane" evidence=IDA

TAIR\|locus:2010597 AT1G04780 "AT1G04780" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2093741 AT3G24210 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2036863 AT1G62050 "AT1G62050" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

MGI\|MGI:2144501 Ankrd13b "ankyrin repeat domain 13b" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P6U9 ANKRD13C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NWB4 ANKRD13C "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-3892 ankrd13c "ankyrin repeat domain 13C" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|A5PK24 ANKRD13C "ANKRD13C protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8N6S4 ANKRD13C "Ankyrin repeat domain-containing protein 13C" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		528
pfam11904		290	pfam11904, GPCR_chapero_1, GPCR-chaperone	1e-75
cd00204		126	cd00204, ANK, ankyrin repeats; ankyrin repeats med	1e-08
cd00204		126	cd00204, ANK, ankyrin repeats; ankyrin repeats med	2e-06
pfam13857		56	pfam13857, Ank_5, Ankyrin repeats (many copies)	1e-05
pfam12796		91	pfam12796, Ank_2, Ankyrin repeats (3 copies)	4e-05
pfam00023		33	pfam00023, Ank, Ankyrin repeat	0.003

>gnl\|CDD\|221304 pfam11904, GPCR_chapero_1, GPCR-chaperone	Back alignment and domain information

 Score =  240 bits (614), Expect = 1e-75
 Identities = 109/347 (31%), Positives = 145/347 (41%), Gaps = 102/347 (29%)

Query: 184 RADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAG 243
           R D TLAGFDG + QR D++FLF GE             GSLI + H +KEV NALE   
Sbjct: 1   RVDTTLAGFDGMKWQRGDRSFLFKGEES---------DAGSLIEVDHDDKEVYNALEEL- 50

Query: 244 APPTEAEVAHEVALMSQTNMYRPGIDVTQAELVPH---LNWRRQERTEMVGNWKAKVYDM 300
              ++AE   EVA +  + +   G+D TQ         L WRR E+TE VG ++AKVYD 
Sbjct: 51  ---SDAEEDEEVAALLTSPIVSTGLDTTQIGFERSKSILGWRRSEKTETVGGYEAKVYDA 107

Query: 301 LHVMVSVKSRRVPGAMTDEELFAVEDEDKLANGGDNDEYDDVLTAEERLQLDSALRMGNS 360
            +V +  K+R                              + L+ E++ +L S      S
Sbjct: 108 SNVELITKTRS-----------------------------EHLSEEDQQKLKSGKTSLGS 138

Query: 361 DGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKNNVEDAEDSKILK 420
            GL  + + G  S Q                                             
Sbjct: 139 -GLGAEQDGGPTSRQGPVE----------------------------------------- 156

Query: 421 KFSKLAPEGSNQKSSSEYPREDVIDAKKGKDKSSKKKKKKGPVSESKSESEYKKGLRPVL 480
                        +  EY  +     KKG+D           +   K ESE KK  +  L
Sbjct: 157 --QSATAPNPTALTPEEY-FKPEFKLKKGRD-----------IGRPKEESEKKKKFKATL 202

Query: 481 WLTPDFPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKV 527
           WL+ DFPL  ++LLP+LD+LANK K  RRLRE +TTKLP G FPVK+
Sbjct: 203 WLSEDFPLSLEQLLPILDLLANKNKHFRRLREFVTTKLPPG-FPVKI 248

This domain, and the associated ANK family repeat pfam00023 domain, together act as a chaperone for biogenesis and folding of the DP receptor for prostaglandin D2. Length = 290

>gnl\|CDD\|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins	Back alignment and domain information

>gnl\|CDD\|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins	Back alignment and domain information

>gnl\|CDD\|206028 pfam13857, Ank_5, Ankyrin repeats (many copies)	Back alignment and domain information

>gnl\|CDD\|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies)	Back alignment and domain information

>gnl\|CDD\|200936 pfam00023, Ank, Ankyrin repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		528
KOG0522		560	consensus Ankyrin repeat protein [General function	100.0
PF11904		307	GPCR_chapero_1: GPCR-chaperone; InterPro: IPR02183	100.0
KOG4412		226	consensus 26S proteasome regulatory complex, subun	99.91
KOG4412		226	consensus 26S proteasome regulatory complex, subun	99.88
PHA02859		209	ankyrin repeat protein; Provisional	99.83
PHA02791		284	ankyrin-like protein; Provisional	99.82
KOG0509		600	consensus Ankyrin repeat and DHHC-type Zn-finger d	99.81
PHA02791		284	ankyrin-like protein; Provisional	99.78
PHA02875		413	ankyrin repeat protein; Provisional	99.78
PHA02878		477	ankyrin repeat protein; Provisional	99.78
PHA02874		434	ankyrin repeat protein; Provisional	99.77
PHA02741		169	hypothetical protein; Provisional	99.75
PHA02875		413	ankyrin repeat protein; Provisional	99.75
PHA02878		477	ankyrin repeat protein; Provisional	99.75
PHA03100		480	ankyrin repeat protein; Provisional	99.75
KOG0514		452	consensus Ankyrin repeat protein [General function	99.75
PHA02946		446	ankyin-like protein; Provisional	99.75
PHA02874		434	ankyrin repeat protein; Provisional	99.74
PHA03100		480	ankyrin repeat protein; Provisional	99.74
PHA03095		471	ankyrin-like protein; Provisional	99.74
PHA02716		764	CPXV016; CPX019; EVM010; Provisional	99.73
PHA02946		446	ankyin-like protein; Provisional	99.73
PHA02798		489	ankyrin-like protein; Provisional	99.72
PHA02989		494	ankyrin repeat protein; Provisional	99.71
PHA02795		437	ankyrin-like protein; Provisional	99.71
KOG0512		228	consensus Fetal globin-inducing factor (contains a	99.71
KOG0510		929	consensus Ankyrin repeat protein [General function	99.7
PHA02876		682	ankyrin repeat protein; Provisional	99.7
PHA03095		471	ankyrin-like protein; Provisional	99.7
PHA02716		764	CPXV016; CPX019; EVM010; Provisional	99.7
KOG0502		296	consensus Integral membrane ankyrin-repeat protein	99.7
PHA02736		154	Viral ankyrin protein; Provisional	99.69
KOG0509		600	consensus Ankyrin repeat and DHHC-type Zn-finger d	99.69
KOG0508		615	consensus Ankyrin repeat protein [General function	99.69
PHA02859		209	ankyrin repeat protein; Provisional	99.69
KOG4177		1143	consensus Ankyrin [Cell wall/membrane/envelope bio	99.68
PHA02743		166	Viral ankyrin protein; Provisional	99.68
PLN03192		823	Voltage-dependent potassium channel; Provisional	99.68
PHA02917		661	ankyrin-like protein; Provisional	99.67
PHA02876		682	ankyrin repeat protein; Provisional	99.66
PHA02884		300	ankyrin repeat protein; Provisional	99.65
PF12796		89	Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02	99.65
PHA02989		494	ankyrin repeat protein; Provisional	99.65
KOG0195		448	consensus Integrin-linked kinase [Signal transduct	99.64
KOG0512		228	consensus Fetal globin-inducing factor (contains a	99.64
PHA02798		489	ankyrin-like protein; Provisional	99.64
KOG0508		615	consensus Ankyrin repeat protein [General function	99.63
KOG0510		929	consensus Ankyrin repeat protein [General function	99.62
PHA02795		437	ankyrin-like protein; Provisional	99.61
PHA02736		154	Viral ankyrin protein; Provisional	99.6
PHA02741		169	hypothetical protein; Provisional	99.6
KOG0505		527	consensus Myosin phosphatase, regulatory subunit [	99.6
PLN03192		823	Voltage-dependent potassium channel; Provisional	99.57
TIGR00870		743	trp transient-receptor-potential calcium channel p	99.57
cd00204		126	ANK ankyrin repeats; ankyrin repeats mediate prote	99.56
KOG0502		296	consensus Integral membrane ankyrin-repeat protein	99.52
KOG4177		1143	consensus Ankyrin [Cell wall/membrane/envelope bio	99.51
PHA02917		661	ankyrin-like protein; Provisional	99.5
PHA02730		672	ankyrin-like protein; Provisional	99.5
PHA02884		300	ankyrin repeat protein; Provisional	99.46
PHA02730		672	ankyrin-like protein; Provisional	99.44
PHA02743		166	Viral ankyrin protein; Provisional	99.43
KOG3676		782	consensus Ca2+-permeable cation channel OSM-9 and	99.43
TIGR00870		743	trp transient-receptor-potential calcium channel p	99.4
COG0666		235	Arp FOG: Ankyrin repeat [General function predicti	99.39
PTZ00322		664	6-phosphofructo-2-kinase/fructose-2,6-biphosphatas	99.37
KOG4214		117	consensus Myotrophin and similar proteins [Transcr	99.36
KOG0507		854	consensus CASK-interacting adaptor protein (caskin	99.35
PHA02792		631	ankyrin-like protein; Provisional	99.32
PF13637		54	Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A	99.3
KOG0514		452	consensus Ankyrin repeat protein [General function	99.29
PF13857		56	Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A	99.29
KOG0195		448	consensus Integrin-linked kinase [Signal transduct	99.25
COG0666		235	Arp FOG: Ankyrin repeat [General function predicti	99.24
KOG0507		854	consensus CASK-interacting adaptor protein (caskin	99.24
PF12796		89	Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02	99.23
PF13637		54	Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A	99.21
PHA02792		631	ankyrin-like protein; Provisional	99.19
KOG4214		117	consensus Myotrophin and similar proteins [Transcr	99.18
KOG0515		752	consensus p53-interacting protein 53BP/ASPP, conta	99.17
KOG1710		396	consensus MYND Zn-finger and ankyrin repeat protei	99.16
KOG1710		396	consensus MYND Zn-finger and ankyrin repeat protei	99.15
cd00204		126	ANK ankyrin repeats; ankyrin repeats mediate prote	99.14
KOG0505		527	consensus Myosin phosphatase, regulatory subunit [	99.11
PF13857		56	Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A	99.05
KOG0515		752	consensus p53-interacting protein 53BP/ASPP, conta	98.96
KOG3676		782	consensus Ca2+-permeable cation channel OSM-9 and	98.91
KOG0818		669	consensus GTPase-activating proteins of the GIT fa	98.81
KOG0783		1267	consensus Uncharacterized conserved protein, conta	98.81
PTZ00322		664	6-phosphofructo-2-kinase/fructose-2,6-biphosphatas	98.81
KOG0783		1267	consensus Uncharacterized conserved protein, conta	98.71
KOG4369		2131	consensus RTK signaling protein MASK/UNC-44 [Signa	98.61
KOG0705		749	consensus GTPase-activating protein Centaurin gamm	98.58
KOG0506		622	consensus Glutaminase (contains ankyrin repeat) [A	98.55
PF13606		30	Ank_3: Ankyrin repeat	98.52
PF00023		33	Ank: Ankyrin repeat Hereditary spherocytosis; Inte	98.51
KOG0782		1004	consensus Predicted diacylglycerol kinase [Signal	98.42
KOG4369		2131	consensus RTK signaling protein MASK/UNC-44 [Signa	98.39
PF13606		30	Ank_3: Ankyrin repeat	98.26
KOG0782		1004	consensus Predicted diacylglycerol kinase [Signal	98.14
KOG2384		223	consensus Major histocompatibility complex protein	98.09
PF00023		33	Ank: Ankyrin repeat Hereditary spherocytosis; Inte	98.07
KOG0521		785	consensus Putative GTPase activating proteins (GAP	97.94
KOG0522		560	consensus Ankyrin repeat protein [General function	97.87
KOG0705		749	consensus GTPase-activating protein Centaurin gamm	97.78
KOG0818		669	consensus GTPase-activating proteins of the GIT fa	97.77
KOG0521		785	consensus Putative GTPase activating proteins (GAP	97.62
KOG2384		223	consensus Major histocompatibility complex protein	97.6
KOG0520		975	consensus Uncharacterized conserved protein, conta	97.56
KOG0511		516	consensus Ankyrin repeat protein [General function	97.55
KOG3609		822	consensus Receptor-activated Ca2+-permeable cation	97.36
KOG0511		516	consensus Ankyrin repeat protein [General function	97.25
KOG0506		622	consensus Glutaminase (contains ankyrin repeat) [A	97.07
smart00248		30	ANK ankyrin repeats. Ankyrin repeats are about 33	96.65
KOG3609		822	consensus Receptor-activated Ca2+-permeable cation	96.12
smart00248		30	ANK ankyrin repeats. Ankyrin repeats are about 33	96.09
KOG2505		591	consensus Ankyrin repeat protein [General function	96.01
KOG0520		975	consensus Uncharacterized conserved protein, conta	95.37
KOG2505		591	consensus Ankyrin repeat protein [General function	94.26
PF06128		284	Shigella_OspC: Shigella flexneri OspC protein; Int	82.1

>KOG0522 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=4.7e-99  Score=784.72  Aligned_cols=400  Identities=44%  Similarity=0.686  Sum_probs=341.0

Q ss_pred             hHHHHHHHcCCHHHHHHHHHcCCCCCcCCCCCchhHHHHHHhccccccccccccCCCCCCcHHHHHHHcCCHHHHHHHHH
Q 009704           10 SPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRDVPGRETPLHLAVRLRDPISAEILMA   89 (528)
Q Consensus        10 TPLH~Av~~g~~e~vk~LL~~ga~l~~~~~~~t~l~~~A~~~~~~~vga~In~kD~p~G~TPLHlAv~~G~~e~vklLL~   89 (528)
                      .|||+++...+.+.+..++...                        ++..|+.+|. .|+||||+||+.||.+++++||.
T Consensus        22 ~~lh~~~~~~~~~sl~~el~~~------------------------~~~~id~~D~-~g~TpLhlAV~Lg~~~~a~~Ll~   76 (560)
T KOG0522|consen   22 KPLHWAVVTTDSDSLEQELLAK------------------------VSLVIDRRDP-PGRTPLHLAVRLGHVEAARILLS   76 (560)
T ss_pred             cccchhhhccchhhHHHHHhhh------------------------hhceeccccC-CCCccHHHHHHhcCHHHHHHHHh
Confidence            4599999999888777766541                        1346999996 89999999999999999999999


Q ss_pred             cCCCCCCcCCCCCcHHHHHHHcCCHHHHHHHHHhCCChhHhhhcCCchHHHHHHhhhhhhHHhhhccccccccccccccC
Q 009704           90 AGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRDFYMEITFHFESSVIPFIGRIA  169 (528)
Q Consensus        90 ~GAdvn~~n~~G~TpLh~A~~~g~~eiv~lLl~~g~~i~~~~~~g~tPl~lA~l~~~~Dfy~em~w~f~SswvPlvsr~~  169 (528)
                      +||++..+|+.||+|||+|+++|+.+++..++++....++..+..+.|.+++++.+++||||||+|+|+| ||||+||||
T Consensus        77 a~Adv~~kN~~gWs~L~EAv~~g~~q~i~~vlr~~~~q~~~~~~~~~p~ll~~l~~~~DFYmE~~wdF~S-WvPlvSrI~  155 (560)
T KOG0522|consen   77 AGADVSIKNNEGWSPLHEAVSTGNEQIITEVLRHLKYQAWEKWERRLPRLLAKLSEMPDFYMEMKWDFQS-WIPLLSRIL  155 (560)
T ss_pred             cCCCccccccccccHHHHHHHcCCHHHHHHHHHHhHHHHHHHHHhcchHHHHHHHhCccceEEEEeccee-ehhhhhccC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999998 999999999


Q ss_pred             CCCceeeeccCccccccceeccccCceeeccceeEEEecCCCccCCCCcccCCCceEEEeccceehhhhhccCCCCCCHH
Q 009704          170 PSDTYRIWKRGSNLRADMTLAGFDGFRIQRSDQTFLFLGEGYTSEDGNVSLSPGSLIVLSHKEKEVTNALEGAGAPPTEA  249 (528)
Q Consensus       170 PsD~~ki~K~G~~lR~DttL~gf~~~~~~Rg~~s~if~g~~~~~~~~~~~~~~~~l~~~dh~~~~~~~~~~~~~~~~~~~  249 (528)
                      |||+|+|||+|++||+||||+||++|+|+|||+||||+|++          ++|++|+|||++|+|+++++.++.+++|.
T Consensus       156 PSD~~kIyK~G~~lR~DTTL~gF~~m~wqRGd~SFlF~gd~----------~~~e~lvl~hdek~v~~~~~r~~~e~se~  225 (560)
T KOG0522|consen  156 PSDTCKIYKRGSSLRADTTLAGFEGMKWQRGDQSFLFRGDA----------NPAELLVLDHDEKVVTNAFQRLRDEESEA  225 (560)
T ss_pred             chhhHHHhhcccceeeeeeeecCCCceEEecceEEEEecCC----------CcceeEEEeccchhhHHHHHhcccccchh
Confidence            99999999999999999999999999999999999999996          35899999999999999998899999999


Q ss_pred             HHHHHHHhhhcCcccccceeeeeeee-ccccccccccceeeecCeeeeEEEeeceEEEEEEeccCCCCChhhhhhhhhhh
Q 009704          250 EVAHEVALMSQTNMYRPGIDVTQAEL-VPHLNWRRQERTEMVGNWKAKVYDMLHVMVSVKSRRVPGAMTDEELFAVEDED  328 (528)
Q Consensus       250 ~v~~~v~~~~~~~i~~~~~~~~~~~~-~~~~~W~~~~k~E~v~~~~~~vy~~~~v~~~~r~r~~~~~~~~~~~~~~~~~~  328 (528)
                      ++++||+.+|+++|+.+++|++.|.| ++++||||++|+|+||||+||||+|+||+|+||+||+  |||+||..++..  
T Consensus       226 ~~~~eVd~~ls~~i~~t~l~tktiaF~~~~~gWrr~ek~E~Vg~y~akvY~v~nv~l~tk~Rre--HLs~ed~~r~~~--  301 (560)
T KOG0522|consen  226 EMEEEVDVRLSQDILYTPLDTKTIAFERGFLGWRRQEKTETVGGYKAKVYDVSNVHLSTKKRRE--HLSEEDEKRVIE--  301 (560)
T ss_pred             hhHHHHHHHhcCcceeccccchhHHHHHhhhhhhhhchhhhccCeeeeEEeecceEEEEeeccc--ccchHHHhhhhh--
Confidence            99999999999999999999999977 7999999999999999999999999999999999998  999999888532  


Q ss_pred             hhcCCCCCCcccccccHHHHHHHHHHhhcCCCCCCCCCCCCCccccccCCCCCccCCCCCCcchhhhccccccccCCCCC
Q 009704          329 KLANGGDNDEYDDVLTAEERLQLDSALRMGNSDGLCDDDENGVLSCQENGSGVSYENGEANSAVKEKKSWFGWNKKGTKN  408 (528)
Q Consensus       329 ~~~~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  408 (528)
                                 +..+|..|+. +.++..++++.   ..++|.                       .+-            
T Consensus       302 -----------~~~~~~~es~-~~~~~~~~~~~---~~~~~~-----------------------~r~------------  331 (560)
T KOG0522|consen  302 -----------EAQLTPLESN-LLSIKETMFGP---KTAECA-----------------------NRD------------  331 (560)
T ss_pred             -----------hccCChhhhh-hhhhhhhcCCC---cccccc-----------------------ccc------------
Confidence                       1234555554 45555444432   111110                       000            


Q ss_pred             CccchhhhhhHhhhcccCCCCCCCCCC---CCCCCccccccccCccccccccccCCCCCCCccccccccccccEeeecCC
Q 009704          409 NVEDAEDSKILKKFSKLAPEGSNQKSS---SEYPREDVIDAKKGKDKSSKKKKKKGPVSESKSESEYKKGLRPVLWLTPD  485 (528)
Q Consensus       409 ~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~e~~k~~r~~lwls~d  485 (528)
                                 .....+.+|+. .++.   ++|.....+... ||++               .+++++|+|||+||||+|
T Consensus       332 -----------l~~~sls~~pt-~i~p~~~~~~~~a~~g~~~-GR~~---------------~~k~~~k~fkA~lwmsee  383 (560)
T KOG0522|consen  332 -----------LYTSSLSAPPT-AITPPEYENYEGALIGKDP-GRPK---------------EEKEKKKKFKATLWMSEE  383 (560)
T ss_pred             -----------hhhcccCCCcc-cCCCCcccccccccccCCC-CCch---------------hhhhhhhhhhhheeeccc
Confidence                       00011222221 1111   445555554433 8886               466779999999999999


Q ss_pred             CCCCcccccchHHHhhhchHHHHHHHhHhhccCCCCCCCcccC
Q 009704          486 FPLKTDELLPLLDILANKVKAIRRLRELLTTKLPSGTFPVKVN  528 (528)
Q Consensus       486 FPL~~~~llplldila~~~k~~~rlre~~t~klP~g~FPVKv~  528 (528)
                      |||++|+|||||||||+.+|||+|||||||+|||+| |||||+
T Consensus       384 fPLsldqllpildlmA~~~khf~rLReFitlkLPpG-FPVKie  425 (560)
T KOG0522|consen  384 FPLSLDQLLPILDLMANPSKHFARLREFITLKLPPG-FPVKIE  425 (560)
T ss_pred             CCccHHHHHHHHHHHcccHHHHHHHHHHHhhcCCCC-CceeEe
Confidence            999999999999999999999999999999999999 999985

>PF11904 GPCR_chapero_1: GPCR-chaperone; InterPro: IPR021832 This family of proteins are functionally uncharacterised	Back alignment and domain information

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02859 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02791 ankyrin-like protein; Provisional	Back alignment and domain information

>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only]	Back alignment and domain information

>PHA02791 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02875 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02878 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02874 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02741 hypothetical protein; Provisional	Back alignment and domain information

>PHA02875 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02878 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA03100 ankyrin repeat protein; Provisional	Back alignment and domain information

>KOG0514 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PHA02946 ankyin-like protein; Provisional	Back alignment and domain information

>PHA02874 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA03100 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA03095 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02716 CPXV016; CPX019; EVM010; Provisional	Back alignment and domain information

>PHA02946 ankyin-like protein; Provisional	Back alignment and domain information

>PHA02798 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02989 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02795 ankyrin-like protein; Provisional	Back alignment and domain information

>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription]	Back alignment and domain information

>KOG0510 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PHA02876 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA03095 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02716 CPXV016; CPX019; EVM010; Provisional	Back alignment and domain information

>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only]	Back alignment and domain information

>PHA02736 Viral ankyrin protein; Provisional	Back alignment and domain information

>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only]	Back alignment and domain information

>KOG0508 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PHA02859 ankyrin repeat protein; Provisional	Back alignment and domain information

>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PHA02743 Viral ankyrin protein; Provisional	Back alignment and domain information

>PLN03192 Voltage-dependent potassium channel; Provisional	Back alignment and domain information

>PHA02917 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02876 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02884 ankyrin repeat protein; Provisional	Back alignment and domain information

>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain	Back alignment and domain information

>PHA02989 ankyrin repeat protein; Provisional	Back alignment and domain information

>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription]	Back alignment and domain information

>PHA02798 ankyrin-like protein; Provisional	Back alignment and domain information

>KOG0508 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG0510 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PHA02795 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02736 Viral ankyrin protein; Provisional	Back alignment and domain information

>PHA02741 hypothetical protein; Provisional	Back alignment and domain information

>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PLN03192 Voltage-dependent potassium channel; Provisional	Back alignment and domain information

>TIGR00870 trp transient-receptor-potential calcium channel protein	Back alignment and domain information

>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins	Back alignment and domain information

>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only]	Back alignment and domain information

>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PHA02917 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02730 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02884 ankyrin repeat protein; Provisional	Back alignment and domain information

>PHA02730 ankyrin-like protein; Provisional	Back alignment and domain information

>PHA02743 Viral ankyrin protein; Provisional	Back alignment and domain information

>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>TIGR00870 trp transient-receptor-potential calcium channel protein	Back alignment and domain information

>COG0666 Arp FOG: Ankyrin repeat [General function prediction only]	Back alignment and domain information

>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional	Back alignment and domain information

>KOG4214 consensus Myotrophin and similar proteins [Transcription]	Back alignment and domain information

>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms]	Back alignment and domain information

>PHA02792 ankyrin-like protein; Provisional	Back alignment and domain information

>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A	Back alignment and domain information

>KOG0514 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A	Back alignment and domain information

>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms]	Back alignment and domain information

>COG0666 Arp FOG: Ankyrin repeat [General function prediction only]	Back alignment and domain information

>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms]	Back alignment and domain information

>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain	Back alignment and domain information

>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A	Back alignment and domain information

>PHA02792 ankyrin-like protein; Provisional	Back alignment and domain information

>KOG4214 consensus Myotrophin and similar proteins [Transcription]	Back alignment and domain information

>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins	Back alignment and domain information

>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A	Back alignment and domain information

>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms]	Back alignment and domain information

>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown]	Back alignment and domain information

>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional	Back alignment and domain information

>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown]	Back alignment and domain information

>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism]	Back alignment and domain information

>PF13606 Ank_3: Ankyrin repeat	Back alignment and domain information

>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature	Back alignment and domain information

>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms]	Back alignment and domain information

>PF13606 Ank_3: Ankyrin repeat	Back alignment and domain information

>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only]	Back alignment and domain information

>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature	Back alignment and domain information

>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0522 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms]	Back alignment and domain information

>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]	Back alignment and domain information

>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only]	Back alignment and domain information

>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown]	Back alignment and domain information

>KOG0511 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG0511 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism]	Back alignment and domain information

>smart00248 ANK ankyrin repeats	Back alignment and domain information

>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>smart00248 ANK ankyrin repeats	Back alignment and domain information

>KOG2505 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown]	Back alignment and domain information

>KOG2505 consensus Ankyrin repeat protein [General function prediction only]	Back alignment and domain information

>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		528
1sw6_A		327	Regulatory protein SWI6; transcription regulation,	1e-06
1sw6_A		327	Regulatory protein SWI6; transcription regulation,	5e-04
2b0o_E		301	UPLC1; arfgap, structural genomics, structural gen	3e-06
1ikn_D		236	Protein (I-kappa-B-alpha), protein (NF-kappa-B P50	5e-06
1ikn_D		236	Protein (I-kappa-B-alpha), protein (NF-kappa-B P50	3e-04
1ikn_D		236	Protein (I-kappa-B-alpha), protein (NF-kappa-B P50	4e-04
1dcq_A		278	PYK2-associated protein beta; zinc-binding module,	1e-05
3ehr_A		222	Osteoclast-stimulating factor 1; beta barrel, heli	1e-05
1oy3_D		282	Transcription factor inhibitor I-kappa-B-beta; pro	2e-05
1oy3_D		282	Transcription factor inhibitor I-kappa-B-beta; pro	5e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-05
2xai_A		261	ASB-9, ankyrin repeat and SOCS box protein 9; tran	1e-04
1k1a_A		241	B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa	2e-04
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	3e-04
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	7e-04
3utm_A		351	Tankyrase-1; tankyrase, TNKS, ankryin repeat clust	4e-04
3hra_A		201	Ankyrin repeat family protein; structural protein;	5e-04
2pnn_A		273	Transient receptor potential cation channel subfa	5e-04
1wdy_A		285	2-5A-dependent ribonuclease; hydrolase, RNA-bindin	6e-04
1bd8_A		156	P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr	7e-04
3c5r_A		137	BARD-1, BRCA1-associated ring domain protein 1; an	8e-04
3t8k_A		186	Uncharacterized protein; structural genomics, PSI-	9e-04

>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327	Back alignment and structure

 Score = 49.6 bits (118), Expect = 1e-06
 Identities = 18/105 (17%), Positives = 40/105 (38%), Gaps = 1/105 (0%)

Query: 5   AKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVIDRRD 64
           AKY    +   + ++    ++                 +D  L        ++ +++ +D
Sbjct: 221 AKYYLDILMGWIVKKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNAQD 280

Query: 65  VPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAV 109
             G  T L++A RL +    + L+  GAD  + N++G   +    
Sbjct: 281 SNGD-TCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGA 324

PyMOL of 1sw6

>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327	Back alignment and structure

>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301	Back alignment and structure

>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236	Back alignment and structure

>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236	Back alignment and structure

>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236	Back alignment and structure

>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278	Back alignment and structure

>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222	Back alignment and structure

>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282	Back alignment and structure

>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437	Back alignment and structure

>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351	Back alignment and structure

>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201	Back alignment and structure

>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273	Back alignment and structure

>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285	Back alignment and structure

>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156	Back alignment and structure

>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137	Back alignment and structure

>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		528
4gpm_A		169	Engineered protein OR264; de novo protein, structu	99.9
4b93_B		269	Ankyrin repeat domain-containing protein 27; endoc	99.9
2rfm_A		192	Putative ankyrin repeat protein TV1425; ANK repeat	99.89
4gpm_A		169	Engineered protein OR264; de novo protein, structu	99.88
1yyh_A		253	HN1;, notch 1, ankyrin domain; ankyrin repeats, ce	99.87
3hra_A		201	Ankyrin repeat family protein; structural protein;	99.87
1awc_B		153	Protein (GA binding protein beta 1); complex (tran	99.87
4hbd_A		276	KN motif and ankyrin repeat domain-containing Pro;	99.87
1oy3_D		282	Transcription factor inhibitor I-kappa-B-beta; pro	99.87
3v31_A		167	Ankyrin repeat family A protein 2; structural geno	99.86
2f8y_A		223	Notch homolog 1, translocation-associated (drosoph	99.86
1d9s_A		136	Cyclin-dependent kinase 4 inhibitor B; helix-turn-	99.86
2rfa_A		232	Transient receptor potential cation channel subfa	99.85
3aji_A		231	26S proteasome non-ATPase regulatory subunit 10; g	99.85
2dzn_A		228	Probable 26S proteasome regulatory subunit P28; an	99.85
1ikn_D		236	Protein (I-kappa-B-alpha), protein (NF-kappa-B P50	99.85
3aji_A		231	26S proteasome non-ATPase regulatory subunit 10; g	99.85
2y1l_E		169	Darpin-8.4; hydrolase-inhibitor complex, DEVD darp	99.85
2etb_A		256	Transient receptor potential cation channel subfam	99.85
2xai_A		261	ASB-9, ankyrin repeat and SOCS box protein 9; tran	99.85
3c5r_A		137	BARD-1, BRCA1-associated ring domain protein 1; an	99.85
2dzn_A		228	Probable 26S proteasome regulatory subunit P28; an	99.85
1yyh_A		253	HN1;, notch 1, ankyrin domain; ankyrin repeats, ce	99.85
1oy3_D		282	Transcription factor inhibitor I-kappa-B-beta; pro	99.85
3v30_A		172	DNA-binding protein rfxank; structural genomics co	99.85
1sw6_A		327	Regulatory protein SWI6; transcription regulation,	99.85
1bi7_B		156	P16INK4A, MTS1, multiple tumor suppressor; cyclin	99.85
1s70_B		299	130 kDa myosin-binding subunit of smooth muscle my	99.85
1k1a_A		241	B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa	99.85
2f8y_A		223	Notch homolog 1, translocation-associated (drosoph	99.85
2rfa_A		232	Transient receptor potential cation channel subfa	99.84
3v30_A		172	DNA-binding protein rfxank; structural genomics co	99.84
3b7b_A		237	Euchromatic histone-lysine N-methyltransferase 1;	99.84
3aaa_C		123	Myotrophin, protein V-1; actin capping protein, ba	99.84
1ihb_A		162	P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit	99.84
2xai_A		261	ASB-9, ankyrin repeat and SOCS box protein 9; tran	99.84
1k1a_A		241	B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa	99.84
3b7b_A		237	Euchromatic histone-lysine N-methyltransferase 1;	99.84
3d9h_A		285	CDNA FLJ77766, highly similar to HOMO sapiens anky	99.84
3f6q_A		179	Integrin-linked protein kinase; ILK, integrin-link	99.83
2jab_A		136	H10-2-G3; HER2, darpin, ankyrin repeat protein, me	99.83
1ycs_B		239	53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres	99.83
1bd8_A		156	P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr	99.83
3twr_A		165	Tankyrase-2; ankyrin repeat, protein-protein inter	99.83
3ljn_A		364	Hypothetical protein; ankyrin, structural genomics	99.83
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	99.83
3d9h_A		285	CDNA FLJ77766, highly similar to HOMO sapiens anky	99.83
3utm_A		351	Tankyrase-1; tankyrase, TNKS, ankryin repeat clust	99.82
1n0q_A		93	3ANK, 3 ankyrin repeats; structural protein; 1.26A	99.82
3jxi_A		260	Vanilloid receptor-related osmotically activated p	99.82
3kea_A		285	K1L; tropism, ANK repeat, viral protein; 2.30A {Va	99.82
2etb_A		256	Transient receptor potential cation channel subfam	99.82
1n0r_A		126	4ANK, 4 ankyrin repeats; structural protein; 1.50A	99.82
3utm_A		351	Tankyrase-1; tankyrase, TNKS, ankryin repeat clust	99.82
1wdy_A		285	2-5A-dependent ribonuclease; hydrolase, RNA-bindin	99.81
1ihb_A		162	P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit	99.81
2pnn_A		273	Transient receptor potential cation channel subfa	99.81
3v31_A		167	Ankyrin repeat family A protein 2; structural geno	99.81
1n11_A		437	Ankyrin; clathrin, BAND 3, anion exchanger, struct	99.81
2y1l_E		169	Darpin-8.4; hydrolase-inhibitor complex, DEVD darp	99.81
3ljn_A		364	Hypothetical protein; ankyrin, structural genomics	99.81
1ikn_D		236	Protein (I-kappa-B-alpha), protein (NF-kappa-B P50	99.81
2l6b_A		115	NR1C; ankyrin, consensus, repeat protein, ising mo	99.81
3ehr_A		222	Osteoclast-stimulating factor 1; beta barrel, heli	99.8
2fo1_E		373	LIN-12 protein; beta-barrel, protein-DNA complex,	99.8
2rfm_A		192	Putative ankyrin repeat protein TV1425; ANK repeat	99.8
1s70_B		299	130 kDa myosin-binding subunit of smooth muscle my	99.8
4b93_B		269	Ankyrin repeat domain-containing protein 27; endoc	99.8
3deo_A		183	Signal recognition particle 43 kDa protein; chloro	99.79
1wdy_A		285	2-5A-dependent ribonuclease; hydrolase, RNA-bindin	99.79
3t8k_A		186	Uncharacterized protein; structural genomics, PSI-	99.79
2pnn_A		273	Transient receptor potential cation channel subfa	99.79
2fo1_E		373	LIN-12 protein; beta-barrel, protein-DNA complex,	99.79
2vge_A		229	RELA-associated inhibitor; iaspp, nucleus, apoptos	99.79
3twr_A		165	Tankyrase-2; ankyrin repeat, protein-protein inter	99.78
4g8k_A		337	2-5A-dependent ribonuclease; ankyrin-repeat domain	99.78
1awc_B		153	Protein (GA binding protein beta 1); complex (tran	99.78
3hra_A		201	Ankyrin repeat family protein; structural protein;	99.78
3kea_A		285	K1L; tropism, ANK repeat, viral protein; 2.30A {Va	99.78
3eu9_A		240	Huntingtin-interacting protein 14; epigenetics, an	99.78
3eu9_A		240	Huntingtin-interacting protein 14; epigenetics, an	99.78
3jxi_A		260	Vanilloid receptor-related osmotically activated p	99.77
3ui2_A		244	Signal recognition particle 43 kDa protein, chlor;	99.77
1bd8_A		156	P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr	99.77
2jab_A		136	H10-2-G3; HER2, darpin, ankyrin repeat protein, me	99.77
3f6q_A		179	Integrin-linked protein kinase; ILK, integrin-link	99.76
4g8k_A		337	2-5A-dependent ribonuclease; ankyrin-repeat domain	99.76
1d9s_A		136	Cyclin-dependent kinase 4 inhibitor B; helix-turn-	99.75
1n0r_A		126	4ANK, 4 ankyrin repeats; structural protein; 1.50A	99.74
1ycs_B		239	53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres	99.73
2b0o_E		301	UPLC1; arfgap, structural genomics, structural gen	99.73
1dcq_A		278	PYK2-associated protein beta; zinc-binding module,	99.72
2zgd_A		110	3 repeat synthetic ankyrin; ankyrin repeat, hydrox	99.72
2vge_A		229	RELA-associated inhibitor; iaspp, nucleus, apoptos	99.72
4hbd_A		276	KN motif and ankyrin repeat domain-containing Pro;	99.71
3lvq_E		497	ARF-GAP with SH3 domain, ANK repeat and PH domain	99.7
1dcq_A		278	PYK2-associated protein beta; zinc-binding module,	99.69
3jue_A		368	Arfgap with coiled-coil, ANK repeat and PH domain	99.69
3ehr_A		222	Osteoclast-stimulating factor 1; beta barrel, heli	99.67
3lvq_E		497	ARF-GAP with SH3 domain, ANK repeat and PH domain	99.67
3aaa_C		123	Myotrophin, protein V-1; actin capping protein, ba	99.66
3jue_A		368	Arfgap with coiled-coil, ANK repeat and PH domain	99.65
3c5r_A		137	BARD-1, BRCA1-associated ring domain protein 1; an	99.64
1sw6_A		327	Regulatory protein SWI6; transcription regulation,	99.64
3deo_A		183	Signal recognition particle 43 kDa protein; chloro	99.64
3t8k_A		186	Uncharacterized protein; structural genomics, PSI-	99.63
3ui2_A		244	Signal recognition particle 43 kDa protein, chlor;	99.63
1n0q_A		93	3ANK, 3 ankyrin repeats; structural protein; 1.26A	99.62
1bi7_B		156	P16INK4A, MTS1, multiple tumor suppressor; cyclin	99.59
2aja_A		376	Ankyrin repeat family protein; NESG, Q5ZSV0, struc	99.52
2zgd_A		110	3 repeat synthetic ankyrin; ankyrin repeat, hydrox	99.52
2l6b_A		115	NR1C; ankyrin, consensus, repeat protein, ising mo	99.47
2b0o_E		301	UPLC1; arfgap, structural genomics, structural gen	99.47
2aja_A		376	Ankyrin repeat family protein; NESG, Q5ZSV0, struc	99.43

>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A	Back alignment and structure

Probab=99.90  E-value=4e-23  Score=192.69  Aligned_cols=138  Identities=16%  Similarity=0.182  Sum_probs=125.5

Q ss_pred             hHHHHHHHcCCHHHHHHHHHcCCCCCcCCC-CCchhHHHHHHhccccc------cccccccCCCCCCcHHHHHHHcCCHH
Q 009704           10 SPVHLAVARRDYAALRRIIATLPRLSKAGE-VNTEDESLAAELQADAV------SAVIDRRDVPGRETPLHLAVRLRDPI   82 (528)
Q Consensus        10 TPLH~Av~~g~~e~vk~LL~~ga~l~~~~~-~~t~l~~~A~~~~~~~v------ga~In~kD~p~G~TPLHlAv~~G~~e   82 (528)
                      ++|+.||..|+.++|+.||++|++++..+. +.++++.++..++.+++      |++++.+|. .|+||||+|+..|+.+
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~-~g~TpLh~A~~~g~~~   84 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDS-DGRTPLHHAAENGHKE   84 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT-TSCCHHHHHHHTTCHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhcc-CCCCHHHHHHHcCCHH
Confidence            479999999999999999999999998544 57777777766666544      899999997 9999999999999999


Q ss_pred             HHHHHHHcCCCCCCcCCCCCcHHHHHHHcCCHHHHHHHHHhCCChhHhhhcCCchHHHHHHhhhhh
Q 009704           83 SAEILMAAGADWSLQNENGWSALQEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRD  148 (528)
Q Consensus        83 ~vklLL~~GAdvn~~n~~G~TpLh~A~~~g~~eiv~lLl~~g~~i~~~~~~g~tPl~lA~l~~~~D  148 (528)
                      ++++|+++||+++.+|..|+||||+|+..|+.+++++|+++|++++..+..|+||+++|+.....+
T Consensus        85 ~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~  150 (169)
T 4gpm_A           85 VVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNEE  150 (169)
T ss_dssp             HHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHH
T ss_pred             HHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCCHH
Confidence            999999999999999999999999999999999999999999999999999999999999776443

PyMOL of 4gpm

>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens}	Back alignment and structure

>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium}	Back alignment and structure

>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A	Back alignment and structure

>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A	Back alignment and structure

>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis}	Back alignment and structure

>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1	Back alignment and structure

>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens}	Back alignment and structure

>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D	Back alignment and structure

>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A	Back alignment and structure

>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A	Back alignment and structure

>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1	Back alignment and structure

>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus}	Back alignment and structure

>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A	Back alignment and structure

>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A	Back alignment and structure

>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E	Back alignment and structure

>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A	Back alignment and structure

>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C*	Back alignment and structure

>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A	Back alignment and structure

>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1	Back alignment and structure

>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A	Back alignment and structure

>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A	Back alignment and structure

>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D	Back alignment and structure

>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A	Back alignment and structure

>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1	Back alignment and structure

>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A	Back alignment and structure

>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1	Back alignment and structure

>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A	Back alignment and structure

>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A	Back alignment and structure

>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus}	Back alignment and structure

>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A	Back alignment and structure

>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A*	Back alignment and structure

>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A	Back alignment and structure

>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A	Back alignment and structure

>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A	Back alignment and structure

>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A*	Back alignment and structure

>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens}	Back alignment and structure

>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A	Back alignment and structure

>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C	Back alignment and structure

>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B	Back alignment and structure

>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B	Back alignment and structure

>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S*	Back alignment and structure

>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major}	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1	Back alignment and structure

>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens}	Back alignment and structure

>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus}	Back alignment and structure

>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1	Back alignment and structure

>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A*	Back alignment and structure

>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus}	Back alignment and structure

>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A	Back alignment and structure

>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1	Back alignment and structure

>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus}	Back alignment and structure

>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1	Back alignment and structure

>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A	Back alignment and structure

>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A*	Back alignment and structure

>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A	Back alignment and structure

>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1	Back alignment and structure

>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C*	Back alignment and structure

>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major}	Back alignment and structure

>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E	Back alignment and structure

>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli}	Back alignment and structure

>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A	Back alignment and structure

>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1	Back alignment and structure

>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium}	Back alignment and structure

>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1	Back alignment and structure

>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens}	Back alignment and structure

>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A	Back alignment and structure

>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1	Back alignment and structure

>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis}	Back alignment and structure

>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A*	Back alignment and structure

>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1	Back alignment and structure

>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens}	Back alignment and structure

>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S*	Back alignment and structure

>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A*	Back alignment and structure

>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1	Back alignment and structure

>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis}	Back alignment and structure

>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus}	Back alignment and structure

>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens}	Back alignment and structure

>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens}	Back alignment and structure

>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A*	Back alignment and structure

>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A	Back alignment and structure

>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B	Back alignment and structure

>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C	Back alignment and structure

>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A	Back alignment and structure

>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A*	Back alignment and structure

>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1	Back alignment and structure

>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1	Back alignment and structure

>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B	Back alignment and structure

>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens}	Back alignment and structure

>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1	Back alignment and structure

>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A	Back alignment and structure

>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens}	Back alignment and structure

>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens}	Back alignment and structure

>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1	Back alignment and structure

>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A	Back alignment and structure

>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A	Back alignment and structure

>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E*	Back alignment and structure

>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A	Back alignment and structure

>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A	Back alignment and structure

>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1	Back alignment and structure

>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1	Back alignment and structure

>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A	Back alignment and structure

>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis}	Back alignment and structure

>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A	Back alignment and structure

>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1	Back alignment and structure

>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A	Back alignment and structure

>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1	Back alignment and structure

>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A	Back alignment and structure

>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli}	Back alignment and structure

>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens}	Back alignment and structure

>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		528
d1sw6a_		301	d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker	4e-08
d1sw6a_		301	d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker	0.004
d1n11a_		408	d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta	2e-07
d1n11a_		408	d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta	7e-06
d1n11a_		408	d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta	2e-05
d1n11a_		408	d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta	0.002
d1n11a_		408	d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta	0.003
d2fo1e1		277	d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele	6e-06
d2fo1e1		277	d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele	0.002
d1oy3d_		255	d.211.1.1 (D:) Transcription factor inhibitor I-ka	3e-05
d1oy3d_		255	d.211.1.1 (D:) Transcription factor inhibitor I-ka	0.004
d1k1aa_		228	d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId:	6e-05
d1ixva_		229	d.211.1.1 (A:) 26S proteasome non-ATPase regulator	8e-05
d1s70b_		291	d.211.1.1 (B:) Myosin phosphatase targeting subuni	9e-05
d1s70b_		291	d.211.1.1 (B:) Myosin phosphatase targeting subuni	2e-04
d1wdya_		285	d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas	9e-05
d1wdya_		285	d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas	4e-04
d1iknd_		221	d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien	3e-04
d1iknd_		221	d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien	4e-04
d1uoha_		223	d.211.1.1 (A:) 26S proteasome non-ATPase regulator	0.003

>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Swi6 ankyrin-repeat fragment
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 52.7 bits (125), Expect = 4e-08
 Identities = 18/109 (16%), Positives = 40/109 (36%), Gaps = 1/109 (0%)

Query: 1   MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGEVNTEDESLAAELQADAVSAVI 60
               AKY    +   + ++    ++                 +D  L        ++ ++
Sbjct: 193 CSAAAKYYLDILMGWIVKKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANML 252

Query: 61  DRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQNENGWSALQEAV 109
           + +D  G  T L++A RL +    + L+  GAD  + N++G   +    
Sbjct: 253 NAQDSNGD-TCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGA 300

PyMOL of d1sw6a_

>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408	Back information, alignment and structure

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure

>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255	Back information, alignment and structure

>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255	Back information, alignment and structure

>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228	Back information, alignment and structure

>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229	Back information, alignment and structure

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291	Back information, alignment and structure

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291	Back information, alignment and structure

>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285	Back information, alignment and structure

>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285	Back information, alignment and structure

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221	Back information, alignment and structure

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221	Back information, alignment and structure

>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		528
d1oy3d_		255	Transcription factor inhibitor I-kappa-B-beta, IKB	99.85
d1myoa_		118	Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]	99.83
d1ixva_		229	26S proteasome non-ATPase regulatory subunit 10, g	99.82
d1uoha_		223	26S proteasome non-ATPase regulatory subunit 10, g	99.82
d1ot8a_		209	Neurogenic locus notch receptor domain {Fruit fly	99.82
d1s70b_		291	Myosin phosphatase targeting subunit 1, MYPT1 {Chi	99.8
d1ycsb1		130	53BP2 {Human (Homo sapiens) [TaxId: 9606]}	99.79
d1iknd_		221	I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606	99.79
d2fo1e1		277	Lin-12 {Caenorhabditis elegans [TaxId: 6239]}	99.78
d1awcb_		153	GA bindinig protein (GABP) beta 1 {Mouse (Mus musc	99.78
d1bi7b_		125	Cell cycle inhibitor p16ink4A {Human (Homo sapiens	99.78
d1uoha_		223	26S proteasome non-ATPase regulatory subunit 10, g	99.77
d1sw6a_		301	Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch	99.76
d1bd8a_		156	Cell cycle inhibitor p19ink4D {Human (Homo sapiens	99.76
d1dcqa1		154	Pyk2-associated protein beta {Mouse (Mus musculus)	99.76
d1k1aa_		228	bcl-3 {Human (Homo sapiens) [TaxId: 9606]}	99.74
d1ihba_		156	p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]	99.74
d1oy3d_		255	Transcription factor inhibitor I-kappa-B-beta, IKB	99.73
d1awcb_		153	GA bindinig protein (GABP) beta 1 {Mouse (Mus musc	99.72
d1bd8a_		156	Cell cycle inhibitor p19ink4D {Human (Homo sapiens	99.71
d1ihba_		156	p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]	99.71
d1n11a_		408	Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]}	99.7
d1wdya_		285	RNase L, 2-5a-dependent ribonuclease {Human (Homo	99.7
d1dcqa1		154	Pyk2-associated protein beta {Mouse (Mus musculus)	99.7
d1n11a_		408	Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]}	99.7
d1bi7b_		125	Cell cycle inhibitor p16ink4A {Human (Homo sapiens	99.67
d1ycsb1		130	53BP2 {Human (Homo sapiens) [TaxId: 9606]}	99.66
d1ot8a_		209	Neurogenic locus notch receptor domain {Fruit fly	99.65
d1myoa_		118	Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]	99.64
d1iknd_		221	I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606	99.63
d2fo1e1		277	Lin-12 {Caenorhabditis elegans [TaxId: 6239]}	99.63
d2ajaa1		346	Hypothetical protein LPG2416 {Legionella pneumophi	99.61
d1wdya_		285	RNase L, 2-5a-dependent ribonuclease {Human (Homo	99.6
d1k1aa_		228	bcl-3 {Human (Homo sapiens) [TaxId: 9606]}	99.59
d1ixva_		229	26S proteasome non-ATPase regulatory subunit 10, g	99.57
d1s70b_		291	Myosin phosphatase targeting subunit 1, MYPT1 {Chi	99.56
d2ajaa1		346	Hypothetical protein LPG2416 {Legionella pneumophi	99.5
d1sw6a_		301	Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch	99.4

>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.85  E-value=2.2e-21  Score=186.11  Aligned_cols=147  Identities=18%  Similarity=0.139  Sum_probs=123.4

Q ss_pred             CCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCCCCcCCC-CCchhHHHHHHhccccc-----------------------
Q 009704            1 MEDFAKYAHSPVHLAVARRDYAALRRIIATLPRLSKAGE-VNTEDESLAAELQADAV-----------------------   56 (528)
Q Consensus         1 In~~Dk~G~TPLH~Av~~g~~e~vk~LL~~ga~l~~~~~-~~t~l~~~A~~~~~~~v-----------------------   56 (528)
                      +|.+|.+|.||||+||..|+.+++++||++|++++..+. +.++++.++..++.+++                       
T Consensus        38 i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~tpL~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~  117 (255)
T d1oy3d_          38 LDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQ  117 (255)
T ss_dssp             GGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCHHHHHTTTTCHHHHHHHSSSCCSSCCCC---------
T ss_pred             ccCcCCCCCCccchHHhhcccccccccccccccccccccccchhhhhhhccCchHHHHHHHhhccchhcccchhhhhHHh
Confidence            356788999999999999999999999999998887543 45666554433321110                       


Q ss_pred             ------------------------------cccccccCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCc-CCCCCcHH
Q 009704           57 ------------------------------SAVIDRRDVPGRETPLHLAVRLRDPISAEILMAAGADWSLQ-NENGWSAL  105 (528)
Q Consensus        57 ------------------------------ga~In~kD~p~G~TPLHlAv~~G~~e~vklLL~~GAdvn~~-n~~G~TpL  105 (528)
                                                    +..++.+|. .|.||||+||..++.+++++|++++++.+.. +..|+|||
T Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~-~g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL  196 (255)
T d1oy3d_         118 DCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENY-DGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPL  196 (255)
T ss_dssp             --------------------------CCCGGGGTTCCCT-TSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHH
T ss_pred             hhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccc-cCcccccccccccccccccchhcccccccccccccccccc
Confidence                                          566777887 8999999999999999999999999998865 67899999


Q ss_pred             HHHHHcCCHHHHHHHHHhCCChhHhhhcCCchHHHHHHhhhhh
Q 009704          106 QEAVCTREESIAMIIARHYQPLAWAKWCRRLPRIVASAARIRD  148 (528)
Q Consensus       106 h~A~~~g~~eiv~lLl~~g~~i~~~~~~g~tPl~lA~l~~~~D  148 (528)
                      |+|+..|+.+++++|+++|++++.++..|.||+++|+.....+
T Consensus       197 ~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~  239 (255)
T d1oy3d_         197 HLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPI  239 (255)
T ss_dssp             HHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHH
T ss_pred             cccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHH
Confidence            9999999999999999999999999999999999998776555

PyMOL of d1oy3d_

>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]}	Back information, alignment and structure

>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]}	Back information, alignment and structure

>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure