Citrus Sinensis ID: 009705
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 528 | ||||||
| 224087304 | 651 | predicted protein [Populus trichocarpa] | 0.856 | 0.694 | 0.523 | 1e-119 | |
| 356517838 | 487 | PREDICTED: uncharacterized protein LOC10 | 0.886 | 0.960 | 0.474 | 1e-116 | |
| 224142701 | 714 | predicted protein [Populus trichocarpa] | 0.848 | 0.627 | 0.507 | 1e-112 | |
| 449457271 | 512 | PREDICTED: uncharacterized protein LOC10 | 0.823 | 0.849 | 0.481 | 1e-102 | |
| 255573763 | 373 | conserved hypothetical protein [Ricinus | 0.640 | 0.906 | 0.468 | 3e-78 | |
| 224087296 | 607 | predicted protein [Populus trichocarpa] | 0.623 | 0.542 | 0.513 | 1e-77 | |
| 357465269 | 475 | PHD and RING finger domain-containing pr | 0.797 | 0.886 | 0.404 | 2e-77 | |
| 356507021 | 224 | PREDICTED: bromodomain adjacent to zinc | 0.420 | 0.991 | 0.601 | 7e-74 | |
| 224121224 | 486 | predicted protein [Populus trichocarpa] | 0.596 | 0.648 | 0.414 | 2e-62 | |
| 218194845 | 470 | hypothetical protein OsI_15901 [Oryza sa | 0.698 | 0.785 | 0.363 | 3e-62 |
| >gi|224087304|ref|XP_002308115.1| predicted protein [Populus trichocarpa] gi|222854091|gb|EEE91638.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 436 bits (1121), Expect = e-119, Method: Compositional matrix adjust.
Identities = 244/466 (52%), Positives = 301/466 (64%), Gaps = 14/466 (3%)
Query: 55 DTLCPLNFDRNSQHSTVSTMSGSTAPTLVYQRRKLRGNSVPIFSTQDPVNTKRS-DDCLS 113
D+ C L+ + Q T STMS +A VY RRKLRGNS S Q P TKRS +DCLS
Sbjct: 180 DSQCRLSLQGSPQLPTSSTMSEISARNFVYSRRKLRGNSATFLSAQVPGITKRSREDCLS 239
Query: 114 VVSFDAVSVPMEEQHAVSL-----AEVGTEAVGTPILPPIISQSEPRLLRSDS-----VQ 163
++S D S+ +EE VS E GT G PP++ EP + +S+S +
Sbjct: 240 IISSDGPSLVVEEARVVSQDHQDQFERGTG--GALPRPPLVCYGEPHVSKSESSSGCSLV 297
Query: 164 EQVVSDKLSKNIRHKMVEIDSINDSCSSSKSNMELLSASKKTEVDETGECSSSSAVMLET 223
E +VSD+ +K R K++E+DSINDSCSSSKSNM+L+S S KTE D+ GECSSSS V E
Sbjct: 298 EDLVSDEATKKSRPKIIEVDSINDSCSSSKSNMDLVSDSTKTEGDDNGECSSSSIVAAEV 357
Query: 224 TGKDLSAKDLCISILRNEGMLERFWPTQIRSSANDVDSGTGCSGICSRSCKICGRSETAL 283
TG+D S D CISILR +G E WP + SA + G+G SR CK C R + +
Sbjct: 358 TGEDQSENDQCISILRRQGAFEGVWPGKTHVSAKSIGDGSGSGSSSSRPCKKCFRKGSPV 417
Query: 284 KLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKKHKTLKAT-ARKSPNIISEKGRG 342
K+L+CD+CE++FHV+C PR+K +P DEW C C KKK K T +RKS NII + GR
Sbjct: 418 KMLICDNCEDSFHVSCCNPRVKRIPVDEWLCRSCWKKKRIIPKETISRKSLNIIGDMGRC 477
Query: 343 RNASAKGEPSPIELMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSE 402
R+AS+ GE +PI LML T PYT VRVGKGFQ DIPDW P N +G+PL L+ S
Sbjct: 478 RDASSTGESNPIALMLRDTEPYTGGVRVGKGFQVDIPDWSGPIINVVDIIGKPLVLEPSY 537
Query: 403 CPSLHDLNSYNLSNLSSIGNWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFC 462
L +L S S L SIGNWLQCKQV++ +G + T CGKWRRAPLFEVQT WECFC
Sbjct: 538 FVGLFELKSNKSSKLGSIGNWLQCKQVIDDAAEGGNVTICGKWRRAPLFEVQTAVWECFC 597
Query: 463 AVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRLDAKRRKFDRT 508
V WDP HADCA PQELETDEV KQ+KY++MLR R+ AK +K R
Sbjct: 598 CVFWDPIHADCAAPQELETDEVMKQIKYIQMLRPRIAAKHQKLRRA 643
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356517838|ref|XP_003527593.1| PREDICTED: uncharacterized protein LOC100800660 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224142701|ref|XP_002324693.1| predicted protein [Populus trichocarpa] gi|222866127|gb|EEF03258.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449457271|ref|XP_004146372.1| PREDICTED: uncharacterized protein LOC101212408 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255573763|ref|XP_002527802.1| conserved hypothetical protein [Ricinus communis] gi|223532798|gb|EEF34574.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224087296|ref|XP_002308114.1| predicted protein [Populus trichocarpa] gi|222854090|gb|EEE91637.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357465269|ref|XP_003602916.1| PHD and RING finger domain-containing protein [Medicago truncatula] gi|355491964|gb|AES73167.1| PHD and RING finger domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356507021|ref|XP_003522270.1| PREDICTED: bromodomain adjacent to zinc finger domain protein 2A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224121224|ref|XP_002330774.1| predicted protein [Populus trichocarpa] gi|222872576|gb|EEF09707.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|218194845|gb|EEC77272.1| hypothetical protein OsI_15901 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 528 | ||||||
| TAIR|locus:2047630 | 631 | AT2G19260 "AT2G19260" [Arabido | 0.312 | 0.261 | 0.482 | 7.8e-55 | |
| WB|WBGene00016200 | 372 | dpff-1 [Caenorhabditis elegans | 0.094 | 0.134 | 0.480 | 1.7e-05 | |
| UNIPROTKB|E9PJ24 | 1645 | PHRF1 "PHD and RING finger dom | 0.077 | 0.024 | 0.487 | 0.00013 | |
| UNIPROTKB|F8WEF5 | 1647 | PHRF1 "PHD and RING finger dom | 0.077 | 0.024 | 0.487 | 0.00013 | |
| UNIPROTKB|Q9P1Y6 | 1649 | PHRF1 "PHD and RING finger dom | 0.077 | 0.024 | 0.487 | 0.00013 | |
| UNIPROTKB|H9KZW6 | 725 | H9KZW6 "Uncharacterized protei | 0.214 | 0.155 | 0.266 | 0.00013 | |
| MGI|MGI:2141847 | 1682 | Phrf1 "PHD and ring finger dom | 0.077 | 0.024 | 0.487 | 0.00013 | |
| RGD|708360 | 1685 | Phrf1 "PHD and ring finger dom | 0.077 | 0.024 | 0.487 | 0.00013 | |
| UNIPROTKB|Q63625 | 1685 | Phrf1 "PHD and RING finger dom | 0.077 | 0.024 | 0.487 | 0.00013 | |
| UNIPROTKB|D4ADM0 | 733 | LOC100362634 "Protein LOC10036 | 0.214 | 0.154 | 0.274 | 0.00013 |
| TAIR|locus:2047630 AT2G19260 "AT2G19260" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 400 (145.9 bits), Expect = 7.8e-55, Sum P(3) = 7.8e-55
Identities = 84/174 (48%), Positives = 102/174 (58%)
Query: 339 KGRGRNASAKGEPSPIELMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLEL 398
K + KG S E TVP+ +R+GK FQAD+PDW PT +D +GEPLE+
Sbjct: 459 KNQSSKTKTKGRISH-ERKWRVTVPFVIGIRIGKMFQADVPDWSGPTMSDTSFVGEPLEI 517
Query: 399 DTSECPXXXXXXXXXXXXXXXXXXWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDW 458
SE WLQC++ E T +G CGKWRRAP EVQT DW
Sbjct: 518 GQSEY-MHDLKKAKNSKKQCSAVNWLQCRE--EDT----NGVICGKWRRAPRSEVQTKDW 570
Query: 459 ECFCAVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRLDAKRRKFD-RTKSR 511
ECFC WDP+ ADCAVPQELET E+ KQLKY++MLR R DAK+RK + +SR
Sbjct: 571 ECFCCFSWDPSRADCAVPQELETSEILKQLKYIKMLRPRSDAKKRKLGPKGRSR 624
|
|
| WB|WBGene00016200 dpff-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PJ24 PHRF1 "PHD and RING finger domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8WEF5 PHRF1 "PHD and RING finger domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9P1Y6 PHRF1 "PHD and RING finger domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9KZW6 H9KZW6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2141847 Phrf1 "PHD and ring finger domains 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|708360 Phrf1 "PHD and ring finger domains 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q63625 Phrf1 "PHD and RING finger domain-containing protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4ADM0 LOC100362634 "Protein LOC100362634" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 528 | |||
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 3e-09 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 7e-09 | |
| pfam07496 | 50 | pfam07496, zf-CW, CW-type Zinc Finger | 0.001 | |
| COG5141 | 669 | COG5141, COG5141, PHD zinc finger-containing prote | 0.001 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Score = 52.5 bits (126), Expect = 3e-09
Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
Query: 273 CKICGRSETALKLLLCDDCEEAFHVTCYTPRIKI--VPSDEWFCHLC 317
C +CG+ + +LLLCD C+ FH+ C P ++ +P EW+C C
Sbjct: 2 CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPEC 48
|
PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51 |
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|219431 pfam07496, zf-CW, CW-type Zinc Finger | Back alignment and domain information |
|---|
| >gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 528 | |||
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 99.25 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 99.12 | |
| PF07496 | 50 | zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi | 99.02 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 98.88 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.68 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 98.64 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 98.3 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.21 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 97.99 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.68 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 97.58 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.51 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 97.23 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 97.11 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 96.76 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 96.73 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 96.62 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 96.5 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 96.38 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 96.31 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 95.65 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 92.42 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 91.83 | |
| KOG1246 | 904 | consensus DNA-binding protein jumonji/RBP2/SMCY, c | 87.44 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 85.14 | |
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 84.02 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 80.89 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 80.17 |
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.25 E-value=2.9e-12 Score=139.99 Aligned_cols=167 Identities=23% Similarity=0.376 Sum_probs=103.8
Q ss_pred ccccccccccccCCceEeccCCCCcccccccCCC--cCCCCCCCccChhccccccccch-hhccCCCCcccccccCCCCC
Q 009705 270 SRSCKICGRSETALKLLLCDDCEEAFHVTCYTPR--IKIVPSDEWFCHLCLKKKHKTLK-ATARKSPNIISEKGRGRNAS 346 (528)
Q Consensus 270 ~d~C~VC~~~g~~~~LL~CD~C~r~yH~~Cl~Pp--L~~iP~g~W~C~~C~~~~~~~~~-et~~ksp~i~~e~~~~r~a~ 346 (528)
+++|..|++.|.-..++|||.|+++||++|+.|| .+.+|.|.|||+.|..+-..-.. ++.+..-.+. +.. .....
T Consensus 253 ~~fCsaCn~~~~F~~~i~CD~Cp~sFH~~CLePPl~~eniP~g~W~C~ec~~k~~in~~~~t~~~~~~~~-~i~-t~~~~ 330 (613)
T KOG4299|consen 253 EDFCSACNGSGLFNDIICCDGCPRSFHQTCLEPPLEPENIPPGSWFCPECKIKSVINPKMETLSNRGTVV-DIF-TQFVS 330 (613)
T ss_pred HHHHHHhCCccccccceeecCCchHHHHhhcCCCCCcccCCCCccccCCCeeeeecccchhhhhhccchH-HHH-HHHHH
Confidence 5799999999966677999999999999999999 55799999999999876432111 1111000000 000 00011
Q ss_pred CCCCCChhhhhccc-CCCcccccccCCCccccCCCCCCCCCCCCCCCCCCccCCCCCCCccccccccccCCccCCCCeEe
Q 009705 347 AKGEPSPIELMLTS-TVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSECPSLHDLNSYNLSNLSSIGNWLQ 425 (528)
Q Consensus 347 ~~~gm~Pie~~l~e-lllyl~cVR~G~~Fqa~VP~Wsg~~~~y~~~IgePMdLd~se~~~L~~l~~~~~~k~ds~gnw~q 425 (528)
.....+|+.+.+++ +..+|-++..|. ...|.+.-. ++.|+...+. |......+. +++.|+-+.
T Consensus 331 ~IDs~np~q~~lPe~i~~~~~~v~~g~------------~~~~sd~~~-~~pl~~~~~~-~d~e~~e~g--~~ssg~~~~ 394 (613)
T KOG4299|consen 331 KIDSHNPIQKILPENISESFGGVSRGD------------DGQYSDTQD-EKPLDPPALI-LDGENDENG--IDSSGTELL 394 (613)
T ss_pred hhhccchhhhhCCHHHHhhccccccCC------------CCccccccC-CcCCChhhhc-ccccCCccC--CCccCcchh
Confidence 23457788999998 777776766542 111211111 2233332221 111111121 234799999
Q ss_pred cccccCCCCCCCCcccCCCccccCcccccCCCCceeeccccCCCCCCCC
Q 009705 426 CKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCA 474 (528)
Q Consensus 426 C~~c~~~~g~~~~~i~C~kwrr~p~~~~~~~~w~c~c~~~Wdp~h~dC~ 474 (528)
|..|........-+..|. +|+.+| |.||+
T Consensus 395 ~~~c~~~~~~s~~vl~c~-----------------ye~s~~---h~dc~ 423 (613)
T KOG4299|consen 395 CGRCSKTQTESVVVLDCQ-----------------YEQSPE---HPDCK 423 (613)
T ss_pred hcccCcchhhhhhhhccc-----------------cccCCC---Ccccc
Confidence 999998666655666898 999999 99998
|
|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 528 | ||||
| 4gy5_A | 241 | Crystal Structure Of The Tandem Tudor Domain And Pl | 4e-05 | ||
| 3ask_A | 226 | Structure Of Uhrf1 In Complex With Histone Tail Len | 4e-05 | ||
| 3zvz_B | 57 | Phd Finger Of Human Uhrf1 Length = 57 | 2e-04 | ||
| 1f62_A | 51 | Wstf-Phd Length = 51 | 2e-04 | ||
| 3shb_A | 77 | Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 | 2e-04 | ||
| 3zvy_A | 72 | Phd Finger Of Human Uhrf1 In Complex With Unmodifie | 2e-04 | ||
| 3sou_A | 70 | Structure Of Uhrf1 Phd Finger In Complex With Histo | 2e-04 | ||
| 2lgg_A | 69 | Structure Of Phd Domain Of Uhrf1 In Complex With H3 | 2e-04 | ||
| 3t6r_A | 72 | Structure Of Uhrf1 In Complex With Unmodified H3 N- | 2e-04 | ||
| 2kwj_A | 114 | Solution Structures Of The Double Phd Fingers Of Hu | 4e-04 |
| >pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 | Back alignment and structure |
|
| >pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 | Back alignment and structure |
| >pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 | Back alignment and structure |
| >pdb|1F62|A Chain A, Wstf-Phd Length = 51 | Back alignment and structure |
| >pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 | Back alignment and structure |
| >pdb|3ZVY|A Chain A, Phd Finger Of Human Uhrf1 In Complex With Unmodified Histone H3 N-Terminal Tail Length = 72 | Back alignment and structure |
| >pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 | Back alignment and structure |
| >pdb|2LGG|A Chain A, Structure Of Phd Domain Of Uhrf1 In Complex With H3 Peptide Length = 69 | Back alignment and structure |
| >pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 | Back alignment and structure |
| >pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 528 | |||
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 2e-13 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 2e-13 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 4e-13 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 1e-12 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 2e-12 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 4e-12 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 5e-12 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 5e-12 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 7e-12 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 7e-12 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 8e-12 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 1e-08 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 8e-12 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 2e-11 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 3e-11 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 4e-11 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 9e-11 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 1e-10 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 2e-10 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 3e-04 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 3e-10 | |
| 2l7p_A | 100 | Histone-lysine N-methyltransferase ASHH2; CW-domai | 5e-10 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 1e-09 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 1e-08 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 3e-08 | |
| 2e61_A | 69 | Zinc finger CW-type PWWP domain protein 1; ZF-CW d | 2e-07 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 2e-07 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 1e-05 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 2e-04 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 2e-04 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 2e-04 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 4e-04 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 4e-04 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 6e-04 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 6e-04 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 8e-04 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 8e-04 |
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
Score = 63.9 bits (156), Expect = 2e-13
Identities = 20/46 (43%), Positives = 27/46 (58%)
Query: 273 CKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCL 318
CK+C + KL+LCD+C +AFH+ C P + VP EW C C
Sbjct: 3 CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQ 48
|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Length = 100 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
| >2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* Length = 69 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 528 | |||
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.71 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.71 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.65 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.5 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.5 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.47 | |
| 2l7p_A | 100 | Histone-lysine N-methyltransferase ASHH2; CW-domai | 99.42 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.41 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 99.4 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.38 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.37 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.36 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.35 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.34 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.33 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.33 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 99.33 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.31 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.31 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.27 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 99.25 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.21 | |
| 2e61_A | 69 | Zinc finger CW-type PWWP domain protein 1; ZF-CW d | 99.21 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 99.16 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 99.11 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 98.97 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.93 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.79 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.75 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.65 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 98.58 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.58 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.56 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.52 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.44 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.4 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.39 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.38 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.18 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 98.07 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 97.98 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 97.81 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 97.75 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 97.74 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 97.61 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 97.6 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 97.58 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 97.54 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 97.54 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 97.49 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 97.41 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 97.32 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.11 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 97.08 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.78 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 96.35 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 96.25 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 95.91 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 94.77 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 93.52 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 93.25 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 90.3 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 88.49 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 86.69 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 86.63 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 85.11 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 84.94 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 84.36 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 83.92 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 83.8 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 83.54 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 82.86 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 82.55 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 81.65 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 80.34 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 80.15 |
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
Probab=99.71 E-value=1.1e-18 Score=164.31 Aligned_cols=124 Identities=22% Similarity=0.488 Sum_probs=94.8
Q ss_pred cccccccccccccCCceEeccCCCCcccccccCCCcCCCCCCCccChhccccccccchhhccCCCCcccccccCCCCCCC
Q 009705 269 CSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKKHKTLKATARKSPNIISEKGRGRNASAK 348 (528)
Q Consensus 269 c~d~C~VC~~~g~~~~LL~CD~C~r~yH~~Cl~PpL~~iP~g~W~C~~C~~~~~~~~~et~~ksp~i~~e~~~~r~a~~~ 348 (528)
++++|.+|+++| +||+||.|+++||++|+.|+|..+|.|+|+|+.|+.......... ...+....+ .+.....
T Consensus 3 ~~~~C~~C~~~g---~ll~Cd~C~~~~H~~C~~p~l~~~p~~~W~C~~C~~~~~~~~e~d-c~~~~~~s~---~~~~~~~ 75 (184)
T 3o36_A 3 NEDWCAVCQNGG---ELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYD-CDAPSHNSE---KKKTEGL 75 (184)
T ss_dssp SCSSCTTTCCCS---SCEECSSSSCEECTTTSSSCCSSCCSSCCCCTTTSCSSSCSSCCG-GGCCSSCTT---TSCCTTC
T ss_pred CCCccccCCCCC---eeeecCCCCcccCccccCCCCCCCCCCCEECccccCccccccccc-ccccccccc---ccccccc
Confidence 467899999988 799999999999999999999999999999999997653221100 001111111 1122234
Q ss_pred CCCChhhhhccc-CCCcccccccCCCccccCCCCCCCCCCCCCCCCCCccCCCCC
Q 009705 349 GEPSPIELMLTS-TVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSE 402 (528)
Q Consensus 349 ~gm~Pie~~l~e-lllyl~cVR~G~~Fqa~VP~Wsg~~~~y~~~IgePMdLd~se 402 (528)
.+|.+..++.++ ++..+...+.+..|..||.. ..++|+++|++||||++-+
T Consensus 76 ~~l~~~~~~~c~~il~~l~~~~~s~~F~~Pv~~---~~pdY~~iIk~PmdL~tI~ 127 (184)
T 3o36_A 76 VKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPL---TVPDYYKIIKNPMDLSTIK 127 (184)
T ss_dssp CCCCHHHHHHHHHHHHHHHHSTTCHHHHSCCCT---TSTTHHHHCSSCCCHHHHH
T ss_pred cccCHHHHHHHHHHHHHHHhchhhhhhcccccc---CCCchhhhcCCCCCHHHHH
Confidence 568899888888 78888888999899999986 6789999999999997753
|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 528 | ||||
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 2e-12 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 1e-11 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 3e-10 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 3e-10 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 2e-08 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 2e-08 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 2e-06 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 3e-05 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 8e-04 |
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Williams-Beuren syndrome transcription factor, WSTF species: Human (Homo sapiens) [TaxId: 9606]
Score = 60.0 bits (145), Expect = 2e-12
Identities = 20/45 (44%), Positives = 27/45 (60%)
Query: 273 CKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLC 317
CK+C + KL+LCD+C +AFH+ C P + VP EW C C
Sbjct: 3 CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPAC 47
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 528 | |||
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 99.16 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.16 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 99.07 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.86 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.34 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 98.28 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.26 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.19 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 97.99 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 97.86 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 97.35 |
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Williams-Beuren syndrome transcription factor, WSTF species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.16 E-value=4.9e-12 Score=94.42 Aligned_cols=48 Identities=42% Similarity=1.032 Sum_probs=45.2
Q ss_pred ccccccccccCCceEeccCCCCcccccccCCCcCCCCCCCccChhccc
Q 009705 272 SCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLK 319 (528)
Q Consensus 272 ~C~VC~~~g~~~~LL~CD~C~r~yH~~Cl~PpL~~iP~g~W~C~~C~~ 319 (528)
.|.+|+..++++.||.||.|++.||+.|+.|++..+|.++|+|+.|+.
T Consensus 2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~ 49 (51)
T d1f62a_ 2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQP 49 (51)
T ss_dssp CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSC
T ss_pred CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcC
Confidence 588999988888999999999999999999999999999999999975
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|