Citrus Sinensis ID: 009745


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------
MANSKYEYVKSFEVEDEIFSPNLLVVRIHGRDFQRFSHDHGFEKPNDERALNLMNTCAVAVLEEYPDIVFSYGYSDEYSFVFKRTSKFYQRRASKILSLIVSFFTSVYVTKWKEFFPLKEFRYPPSFHSRVISCASIEVLQQYLAWRQNDCHVNNQYETCLWMLIKHGKSENEAQEILKGTQKQEKNELLFQQFGVNYKKLPEMFRQGSCVFKTEMEDIVKYNENGAPVKRLRRKARIVHSENIAGKSFWNGHSCLLKELGRFDEDVGKIKPDYVRSFVFENKLIPSTWIVIRIDGCHFHRFSEVHEFDKPNDEQALNLMNSCAVAVLEEFEDITFAYGVSDEYSFVLKNASMFYQRQASEIVSVIVSFFTSMYVVKWKEFFPQKKLNYPPSFDGRAVCYPSSDIIRDYLAWRQVDCHINNQYNTCFWMLVKSGKSKSEAQGCLKGTQAREKNELLIQKFGIDYSKLPLMFRQGSSIFRARTEKSVASENKSSVEKVWNKVLVSHCNIIEPSFWMAHPSILNEEPPL
cccccHHHHHccccccccccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEECccCEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccCEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHccccccccccHHccEEEEEEEEEccccccccccccEEEEEEEEEEEECccccccccccccEEEEcccccccccccccccEEEEEEEccccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccCEEEEcccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHccccccccccccccEEEEEEccccccccccccccEEEEEEEEEEEEccccccccccccccccccccc
***SKYEYVKSFEVEDEIFSPNLLVVRIHGRDFQRFSHDHGFEKPNDERALNLMNTCAVAVLEEYPDIVFSYGYSDEYSFVFKRTSKFYQRRASKILSLIVSFFTSVYVTKWKEFFPLKEFRYPPSFHSRVISCASIEVLQQYLAWRQNDCHVNNQYETCLWMLIKHGKSENEA*******QKQEKNELLFQQFGVNYKKLPEMFRQGSCVFKTEMEDIVKYNENGAPVKRLRRKARIVHSENIAGKSFWNGHSCLLKELGRFDEDVGKIKPDYVRSFVFENKLIPSTWIVIRIDGCHFHRFSEVHEFDKPNDEQALNLMNSCAVAVLEEFEDITFAYGVSDEYSFVLKNASMFYQRQASEIVSVIVSFFTSMYVVKWKEFFPQKKLNYPPSFDGRAVCYPSSDIIRDYLAWRQVDCHINNQYNTCFWMLVKSGKSKSEAQGCLKGTQAREKNELLIQKFGIDYSKLPLMFRQGSSIFRA****************VWNKVLVSHCNIIEPSFWMAHPSILNEEPP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANSKYEYVKSFEVEDEIFSPNLLVVRIHGRDFQRFSHDHGFEKPNDERALNLMNTCAVAVLEEYPDIVFSYGYSDEYSFVFKRTSKFYQRRASKILSLIVSFFTSVYVTKWKEFFPLKEFRYPPSFHSRVISCASIEVLQQYLAWRQNDCHVNNQYETCLWMLIKHGKSENEAQEILKGTQKQEKNELLFQQFGVNYKKLPEMFRQGSCVFKTEMEDIVKYNENGAPVKRLRRKARIVHSENIAGKSFWNGHSCLLKELGRFDEDVGKIKPDYVRSFVFENKLIPSTWIVIRIDGCHFHRFSEVHEFDKPNDEQALNLMNSCAVAVLEEFEDITFAYGVSDEYSFVLKNASMFYQRQASEIVSVIVSFFTSMYVVKWKEFFPQKKLNYPPSFDGRAVCYPSSDIIRDYLAWRQVDCHINNQYNTCFWMLVKSGKSKSEAQGCLKGTQAREKNELLIQKFGIDYSKLPLMFRQGSSIFRARTEKSVASENKSSVEKVWNKVLVSHCNIIEPSFWMAHPSILNEEPPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA(His) guanylyltransferase 2 Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.probableF4ISV6
tRNA(His) guanylyltransferase 1 Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.probableF4IRQ5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OTD, chain A
Confidence level:very confident
Coverage over the Query: 3-214,234-259
View the alignment between query and template
View the model in PyMOL
Template: 3OTD, chain A
Confidence level:very confident
Coverage over the Query: 269-480,499-524
View the alignment between query and template
View the model in PyMOL