Citrus Sinensis ID: 009767


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520------
MYALLCSDLNEKLPPFPSDEPGGKDITFKRILLNHCQEAFEGADNTRAEIRQMTAPEQEMERMDQERLVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLENDGKTCPAEENVEAICQFFNTIGKQLDENPKSRRVNDVYFSRLKELTTNSQLVPRLRFMIHDVLDLRANNWVPRREEMKAKTITEIHSEAEKNLGLRPGATAMMRNGRTGATGGMGPGGFPIARPGTGGMMPGMPGTQKMPGMPGFDTDNWEVPRSRTMPRGDSKSPSQFPGRVQSPLIGKSPSINSKFLPQGSGGIISGKTSALLQGSPTPSARPSGIASGVEPLTQYTKPVAPAASVVASPEKPSAPVTKLNLADLRKKTVSLLEEYFSIRILDEALQCVEELRAPTYHPEVVKEAIALALEKIPPCVEPVIQLLEFLLNKNVLTTRDIGTGCLLYGSLLDDIGIDLPKAPNNFGEMVGKLVVAKSLDFIVLKEVLKKVEDNMFRRSIFTAAMKSIQSSPAGQEVLAVQGAEVQACESLLT
cHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcc
MYALLCSDLN***************ITFKRILLNHCQEAFEGAD***********************LVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLENDGKTCPAEENVEAICQFFNTIGKQLDENPKSRRVNDVYFSRLKELTTNSQLVPRLRFMIHDVLDLRANNWVPR**********************************************************************************************************************************************************************************LNLADLRKKTVSLLEEYFSIRILDEALQCVEELRAPTYHPEVVKEAIALALEKIPPCVEPVIQLLEFLLNKNVLTTRDIGTGCLLYGSLLDDIGIDLPKAPNNFGEMVGKLVVAKSLDFIVLKEVLKKVEDNMFRRSIFTAAMK*************VQGAEVQACESLLT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYALLCSDLNEKLPPFPSDEPGGKDITFKRILLNHCQEAFEGADNTRAEIRQMTAPEQEMERMDQERLVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLENDGKTCPAEENVEAICQFFNTIGKQLDENPKSRRVNDVYFSRLKELTTNSQLVPRLRFMIHDVLDLRANNWVPRREEMKAKTITEIHSEAEKNLGLRPGATAMMRNGRTGATGGMGPGGFPIARPGTGGMMPGMPGTQKMPGMPGFDTDNWEVPRSRTMPRGDSKSPSQFPGRVQSPLIGKSPSINSKFLPQGSGGIISGKTSALLQGSPTPSARPSGIASGVEPLTQYTKPVAPAASVVASPEKPSAPVTKLNLADLRKKTVSLLEEYFSIRILDEALQCVEELRAPTYHPEVVKEAIALALEKIPPCVEPVIQLLEFLLNKNVLTTRDIGTGCLLYGSLLDDIGIDLPKAPNNFGEMVGKLVVAKSLDFIVLKEVLKKVEDNMFRRSIFTAAMKSIQSSPAGQEVLAVQGAEVQACESLLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor isoform 4G-1 Plays a role in the accumulation of a sobemovirus (RYMV) during viral infection.probableQ84PB3
Eukaryotic translation initiation factor isoform 4G-1 Plays a role in the accumulation of some potyvirus during viral infection.probableQ93ZT6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HU3, chain A
Confidence level:very confident
Coverage over the Query: 1-14,27-45,65-176
View the alignment between query and template
View the model in PyMOL
Template: 3EIQ, chain C
Confidence level:very confident
Coverage over the Query: 358-503
View the alignment between query and template
View the model in PyMOL