Citrus Sinensis ID: 009797

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----

MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIPLWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTTVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFKEEDLPKSFEESQTVQKAPENTPAGGGLLVVIVHEAQDVEGKHHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCRMKNDPFRQ

ccEEEHHHHHHHHHHHHHHHHHHHHHHEEEEECcccccccccHHHHccHHHHHHHcccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEccccccEEEEEEEEEccccEEEEcccEEEcccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEccccccccCEEEEEEEEcccccccccEEEEccccccccccHHHHHHHHHHHHHcccccccEEEEcccccccccccccEEEEEEEEEEcccccccccccccccEEEEEccccccccccCECccccccEEEEEEEEEEEcccccEEEEEEEEccccccccccEEEEEEccccccccccCEEEEccccccccccccccccEEEEEEEEEcccccccccccHcccccccccccccccccEEEEEEEEEEcccccccccccEEEEEEccCEEEEEccccccccccccEEEEEECccccccEEEEEEEEccccccccccccccEEEEcccccccccccccccccccccc

MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIPLWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKL**K**TVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLK**************QLVVEFIYKPFKEE******************TPAGGGLLVVIVHEAQDVEGKHHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCR********

xxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Synaptotagmin-1	Plays an important role in maintaining plasma membrane integrity during freezing and osmotic stresses. May function in membrane resealing during calcium-dependent freezing tolerance. May regulate endocytosis and endosome recycling at the plasma membrane and cell-to-cell trafficking of cabbage leaf curl virus (CaLCuV) and tobacco mosaic virus (TMV) movement proteins via plasmodesmata.	confident	Q9SKR2
Synaptotagmin-2	May play an important role in regulating an unconventional protein trafficking from the cytosol to the extracelluar matrix.	probable	B6ETT4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R83, chain A
Confidence level:very confident
Coverage over the Query: 255-390,416-517
View the alignment between query and template
View the model in PyMOL

Template: 3NSJ, chain A
Confidence level:very confident
Coverage over the Query: 192-364,378-389
View the alignment between query and template
View the model in PyMOL