Citrus Sinensis ID: 009797


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----
MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIPLWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTTVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFKEEDLPKSFEESQTVQKAPENTPAGGGLLVVIVHEAQDVEGKHHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCRMKNDPFRQ
ccEEEHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccccccHHHHccHHHHHHHcccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEccccccEEEEEEEEEccccEEEEcccEEEcccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEccccccccEEEEEEEEEcccccccccEEEEccccccccccHHHHHHHHHHHHHcccccccEEEEcccccccccccccEEEEEEEEEEcccccccccccccccEEEEEccccccccccEEEccccccEEEEEEEEEEEcccccEEEEEEEEccccccccccEEEEEEccccccccccEEEEEccccccccccccccccEEEEEEEEEcccccccccccHHccccccccccccccccEEEEEEEEEEcccccccccccEEEEEEccEEEEEEccccccccccccEEEEEEEccccccEEEEEEEEccccccccccccccEEEEcccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccHHHHHHHcccccccEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccccEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEcccccccccEEEEEEEEcccccEEEEEEEccccHcccccHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccEEEEEEEEEEEccccccccccccEEEEEEEEccccccEEccccccccccEEEEEEEEccEcccccEEEEEEEEccccccccccEEEEEEHHHccccccccEEEEcccccccccccccccccEEEEEEEEEcccccccccHHccccccccccccccccccEEEEEEEcHcccccccccccEEEEEEcccEEEEEEEEccccccEcEEEEEEEcccccccEEEEEEEEcccccccccccccccHHEHHHHHHHHHHHHHHHccccccc
MGVISTIFGFCGFGVGISSGLVIGYFLFIyfqptdvknpeirplverDSETLQQMlpeiplwvkcpdydrvDWLNKFLELMWPYLDKAICKTAKNIAkpiiaeqipkykiesvefetltlgtlpptfqgmkvyvtdekelimepclkwaanpnvtigVKAFGLKATVQVVDLqvfaqpritlkplvpafpcfANIYVSLMEKPHVDFGLKLVGadlmsipgLYRFVQELIKTQVANmylwpktlevpildpskayrrpvgILHVKVVKAMNlkkkdllgasdpyvklkitedklpskkttvkhknlnpewneeynftvrdpesqaVELAVYDWeqvgkhdkmgmnvvplkeltpeepsvktldllknmdlndgqneksRGQLVVEFIykpfkeedlpksfeesqtvqkapentpaggGLLVVIVHEAqdvegkhhtnpyarilfrgeerktkhvkknrdpRWEEEFQFMleepptndrlhvEVCSvssrigllhpkvLFQFYFIFYLVHRFKQECcrmkndpfrq
MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLpeiplwvkcpdYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETltlgtlpptfqGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLevpildpskayrrPVGILHVKVVKamnlkkkdllgasdpyvklkitedklpskkttvkhknlnpewneeynfTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMdlndgqneksrgQLVVEFIYKPFKEEDLPKSFEESQTVQkapentpagGGLLVVIVHEAqdvegkhhtnpyarilfrgeerktkhvkknrdprWEEEFQFMleepptndrLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCRMKNDPFRQ
MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIPLWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTTVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFKEEDLPKSFEESQTVQKAPENTPAGGGLLVVIVHEAQDVEGKHHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCRMKNDPFRQ
**VISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVE***ETLQQMLPEIPLWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKIT******************EWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVV*********************************QLVVEFIYKPF*************************GGLLVVIVHEAQDVEGKHHTNPYARILFR**********************F********DRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCR********
MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIPLWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKL**K**TVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLK**************QLVVEFIYKPFKEE******************TPAGGGLLVVIVHEAQ*****HHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHR***************
MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIPLWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTTVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFKEEDL**************ENTPAGGGLLVVIVHEAQDVEGKHHTNPYARILFRGEER**********PRWEEEFQFMLEEPPTNDRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCRMKNDPFRQ
MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIPLWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTTVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFKE*********************AGGGLLVVIVHEAQDVEGKHHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCRMKN*****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIPLWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTTVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFKEEDLPKSFEESQTVQKAPENTPAGGGLLVVIVHEAQDVEGKHHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCRMKNDPFRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query525 2.2.26 [Sep-21-2011]
Q9SKR2541 Synaptotagmin-1 OS=Arabid yes no 0.944 0.916 0.773 0.0
B6ETT4537 Synaptotagmin-2 OS=Arabid no no 0.956 0.934 0.706 0.0
Q7XA06540 Synaptotagmin-3 OS=Arabid no no 0.923 0.898 0.543 1e-151
Q8L706560 Synaptotagmin-5 OS=Arabid no no 0.887 0.832 0.308 5e-62
A0JJX5569 Synaptotagmin-4 OS=Arabid no no 0.899 0.829 0.307 6e-56
Q5RAG2 1104 Extended synaptotagmin-1 yes no 0.878 0.417 0.251 1e-30
Q3U7R1 1092 Extended synaptotagmin-1 yes no 0.862 0.414 0.253 1e-30
Q5M7N9 889 Extended synaptotagmin-3 no no 0.542 0.320 0.296 3e-30
Q3TZZ7 845 Extended synaptotagmin-2 no no 0.784 0.487 0.249 4e-30
A0FGR8 921 Extended synaptotagmin-2 yes no 0.775 0.441 0.251 8e-30
>sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 Back     alignment and function desciption
 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/498 (77%), Positives = 439/498 (88%), Gaps = 2/498 (0%)

Query: 1   MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIP 60
           MG  STI GFCGFGVGIS GLVIGY LF+Y  P DVK+PEIR + ++D + + +MLPEIP
Sbjct: 1   MGFFSTILGFCGFGVGISLGLVIGYVLFVYLLPNDVKDPEIRSIADQDPKAMLRMLPEIP 60

Query: 61  LWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTL 120
           LWVK PD+DRVDW+N+FLE MWPYLDKAICKTAKNIAKPII EQIPKYKI+SVEFETLTL
Sbjct: 61  LWVKNPDFDRVDWINRFLEYMWPYLDKAICKTAKNIAKPIIEEQIPKYKIDSVEFETLTL 120

Query: 121 GTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRI 180
           G+LPPTFQGMKVY+TDEKELIMEPCLKWAANPN+ + +KAFGLKATVQVVDLQVFAQPRI
Sbjct: 121 GSLPPTFQGMKVYLTDEKELIMEPCLKWAANPNILVAIKAFGLKATVQVVDLQVFAQPRI 180

Query: 181 TLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLW 240
           TLKPLVP+FPCFANIYVSLMEKPHVDFGLKL GADLMSIPGLYRFVQE IK QVANMYLW
Sbjct: 181 TLKPLVPSFPCFANIYVSLMEKPHVDFGLKLGGADLMSIPGLYRFVQEQIKDQVANMYLW 240

Query: 241 PKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTT 300
           PKTL VPILDP+KA+RRPVGI+HVKVV+A+ L+KKDL+G +DP+VK+K++EDK+PSKKTT
Sbjct: 241 PKTLVVPILDPAKAFRRPVGIVHVKVVRAVGLRKKDLMGGADPFVKIKLSEDKIPSKKTT 300

Query: 301 VKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVK 360
           VKHKNLNPEWNEE+ F+VRDP++Q +E +VYDWEQVG  +KMGMNV+ LKE+ P+E    
Sbjct: 301 VKHKNLNPEWNEEFKFSVRDPQTQVLEFSVYDWEQVGNPEKMGMNVLALKEMVPDEHKAF 360

Query: 361 TLDLLKNMDLN-DGQ-NEKSRGQLVVEFIYKPFKEEDLPKSFEESQTVQKAPENTPAGGG 418
           TL+L K +D   DGQ  +K RG+L VE +YKPF EE++PK FEE+Q VQKAPE TPA GG
Sbjct: 361 TLELRKTLDGGEDGQPPDKYRGKLEVELLYKPFTEEEMPKGFEETQAVQKAPEGTPAAGG 420

Query: 419 LLVVIVHEAQDVEGKHHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDR 478
           +LVVIVH A+DVEGKHHTNPY RI F+GEERKTKHVKKNRDPRW EEF FMLEEPP  ++
Sbjct: 421 MLVVIVHSAEDVEGKHHTNPYVRIYFKGEERKTKHVKKNRDPRWNEEFTFMLEEPPVREK 480

Query: 479 LHVEVCSVSSRIGLLHPK 496
           LHVEV S SSRIGLLHPK
Sbjct: 481 LHVEVLSTSSRIGLLHPK 498




Plays an important role in maintaining plasma membrane integrity during freezing and osmotic stresses. May function in membrane resealing during calcium-dependent freezing tolerance. May regulate endocytosis and endosome recycling at the plasma membrane and cell-to-cell trafficking of cabbage leaf curl virus (CaLCuV) and tobacco mosaic virus (TMV) movement proteins via plasmodesmata.
Arabidopsis thaliana (taxid: 3702)
>sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 Back     alignment and function description
>sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 Back     alignment and function description
>sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 Back     alignment and function description
>sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 Back     alignment and function description
>sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=2 SV=2 Back     alignment and function description
>sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 Back     alignment and function description
>sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 Back     alignment and function description
>sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query525
224080620538 plant synaptotagmin [Populus trichocarpa 0.942 0.920 0.830 0.0
225457921539 PREDICTED: extended synaptotagmin-2 isof 0.944 0.920 0.820 0.0
359492268538 PREDICTED: extended synaptotagmin-2 isof 0.929 0.907 0.819 0.0
356538638539 PREDICTED: extended synaptotagmin-3-like 0.942 0.918 0.822 0.0
224103201523 plant synaptotagmin [Populus trichocarpa 0.914 0.917 0.820 0.0
356544874539 PREDICTED: extended synaptotagmin-2-B-li 0.942 0.918 0.816 0.0
224061983538 predicted protein [Populus trichocarpa] 0.944 0.921 0.800 0.0
449469877539 PREDICTED: synaptotagmin-2-like [Cucumis 0.944 0.920 0.786 0.0
147816784539 hypothetical protein VITISV_031706 [Viti 0.944 0.920 0.812 0.0
356564373538 PREDICTED: extended synaptotagmin-2-like 0.944 0.921 0.788 0.0
>gi|224080620|ref|XP_002306182.1| plant synaptotagmin [Populus trichocarpa] gi|222849146|gb|EEE86693.1| plant synaptotagmin [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/496 (83%), Positives = 461/496 (92%), Gaps = 1/496 (0%)

Query: 1   MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIP 60
           MG  STI GFCGFGVGIS+GL IGY+LFIYFQP+DVK+PE+RPLVE DSETLQ+MLPEIP
Sbjct: 1   MGFFSTILGFCGFGVGISTGLTIGYYLFIYFQPSDVKDPEVRPLVEHDSETLQRMLPEIP 60

Query: 61  LWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTL 120
           LWVK PD+DR+DWLN+F++LMWPYLDKAICKTA+NIAKPIIAEQIPKYKI++VEFETLTL
Sbjct: 61  LWVKNPDHDRIDWLNRFIQLMWPYLDKAICKTAENIAKPIIAEQIPKYKIDAVEFETLTL 120

Query: 121 GTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRI 180
           GTLPPTF GMKVYVTDEKELIMEPC+KWA NPNVT+ VKAFGLKAT QVVDLQVFA PRI
Sbjct: 121 GTLPPTFHGMKVYVTDEKELIMEPCIKWAGNPNVTVAVKAFGLKATAQVVDLQVFASPRI 180

Query: 181 TLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLW 240
           TLKPLVP+FPCFANIYVSLMEKPHVDFGLKL+GADLMSIPGLYR VQE+IK QVANMYLW
Sbjct: 181 TLKPLVPSFPCFANIYVSLMEKPHVDFGLKLLGADLMSIPGLYRVVQEIIKDQVANMYLW 240

Query: 241 PKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTT 300
           PKTLEVPILDP+KA +RPVGIL VKV++AM LKKKDL+GA+DPYVK+K+TEDKLP+KKTT
Sbjct: 241 PKTLEVPILDPAKAMKRPVGILSVKVLRAMKLKKKDLMGAADPYVKVKLTEDKLPAKKTT 300

Query: 301 VKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVK 360
           VKHKNLNPEWNEE++  V+DPESQA+EL VYDWEQVGKHDKMGMNVVPLKELTPEEP + 
Sbjct: 301 VKHKNLNPEWNEEFHVVVKDPESQALELRVYDWEQVGKHDKMGMNVVPLKELTPEEPKIM 360

Query: 361 TLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFKEEDLPKSFEESQTVQKAPENTPAGGGLL 420
           TL+LLKNMDLND QNEKSRGQL+VE  YKPFKE+D+  SF+E Q  QKAPE TPAGGGLL
Sbjct: 361 TLELLKNMDLNDPQNEKSRGQLMVELTYKPFKEDDVNLSFKE-QVEQKAPEGTPAGGGLL 419

Query: 421 VVIVHEAQDVEGKHHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDRLH 480
           +VIVHEAQDVEGKHHTNPY R+LFRGEE++TKHVKKNRDPRWE+EFQ+ L++PP+N++LH
Sbjct: 420 LVIVHEAQDVEGKHHTNPYVRLLFRGEEKRTKHVKKNRDPRWEDEFQYTLDKPPSNEKLH 479

Query: 481 VEVCSVSSRIGLLHPK 496
           VEV S SS IGLLHPK
Sbjct: 480 VEVISTSSGIGLLHPK 495




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225457921|ref|XP_002272757.1| PREDICTED: extended synaptotagmin-2 isoform 1 [Vitis vinifera] gi|302142694|emb|CBI19897.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492268|ref|XP_003634391.1| PREDICTED: extended synaptotagmin-2 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356538638|ref|XP_003537808.1| PREDICTED: extended synaptotagmin-3-like [Glycine max] Back     alignment and taxonomy information
>gi|224103201|ref|XP_002312964.1| plant synaptotagmin [Populus trichocarpa] gi|222849372|gb|EEE86919.1| plant synaptotagmin [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356544874|ref|XP_003540872.1| PREDICTED: extended synaptotagmin-2-B-like [Glycine max] Back     alignment and taxonomy information
>gi|224061983|ref|XP_002300696.1| predicted protein [Populus trichocarpa] gi|222842422|gb|EEE79969.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449469877|ref|XP_004152645.1| PREDICTED: synaptotagmin-2-like [Cucumis sativus] gi|449503958|ref|XP_004162238.1| PREDICTED: synaptotagmin-2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147816784|emb|CAN71066.1| hypothetical protein VITISV_031706 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356564373|ref|XP_003550429.1| PREDICTED: extended synaptotagmin-2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query525
TAIR|locus:2198581537 SYTB "AT1G20080" [Arabidopsis 0.940 0.919 0.715 5e-202
TAIR|locus:2146688540 SYTC "AT5G04220" [Arabidopsis 0.923 0.898 0.543 5.1e-151
TAIR|locus:2047027256 AT2G21010 "AT2G21010" [Arabido 0.403 0.828 0.645 3.1e-76
TAIR|locus:2201036560 NTMC2T2.1 "AT1G05500" [Arabido 0.718 0.673 0.335 4.2e-63
TAIR|locus:2184931569 SYTD "AT5G11100" [Arabidopsis 0.740 0.683 0.330 2.6e-59
TAIR|locus:2100992510 NTMC2T4 [Arabidopsis thaliana 0.779 0.801 0.310 2.1e-54
FB|FBgn0039208 849 Esyt2 [Drosophila melanogaster 0.874 0.540 0.250 1.9e-38
WB|WBGene00020443 713 esyt-2 [Caenorhabditis elegans 0.777 0.572 0.254 3e-37
UNIPROTKB|Q9BSJ8 1104 ESYT1 "Extended synaptotagmin- 0.851 0.404 0.261 1.3e-34
MGI|MGI:1344426 1092 Esyt1 "extended synaptotagmin- 0.847 0.407 0.257 1.6e-33
TAIR|locus:2198581 SYTB "AT1G20080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1955 (693.3 bits), Expect = 5.0e-202, P = 5.0e-202
 Identities = 355/496 (71%), Positives = 429/496 (86%)

Query:     1 MGVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIP 60
             MG+ISTI G  GFG G + G+VIGY+LFIYFQ TDV++PEI+PLVE DSET+  M PEIP
Sbjct:     1 MGIISTILGVIGFGFGTTIGIVIGYYLFIYFQSTDVEDPEIKPLVELDSETIATMFPEIP 60

Query:    61 LWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTL 120
             +WVK PD+DR+DWLNK +  MWPY+DKAICK AK+IAKPIIAEQIP YKI+SVEFE LTL
Sbjct:    61 MWVKNPDFDRIDWLNKLIGHMWPYMDKAICKMAKSIAKPIIAEQIPNYKIDSVEFEMLTL 120

Query:   121 GTLPPTFQGMKVYVTDEKELIMEPCLKWAANPNVTIGVKAFGLKATVQVVDLQVFAQPRI 180
             G+LPP+FQGMKVY TD+KE+IME  +KWA NPN+ +  KAFGLKATVQV+DLQV+A PRI
Sbjct:   121 GSLPPSFQGMKVYATDDKEIIMELSVKWAGNPNIIVVAKAFGLKATVQVIDLQVYATPRI 180

Query:   181 TLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVGADLMSIPGLYRFVQELIKTQVANMYLW 240
             TLKPLVP+FPCFANI+VSLM+KP VDFGLKL+GAD+M+IPGLYRFVQE+IK QVANMYLW
Sbjct:   181 TLKPLVPSFPCFANIFVSLMDKPQVDFGLKLLGADVMAIPGLYRFVQEIIKDQVANMYLW 240

Query:   241 PKTLEVPILDPSKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTT 300
             PKTL V I+DPSKA ++PVG+L VKV+KA+ LKKKDLLG SDPYVKL ++ DK+P KKT 
Sbjct:   241 PKTLNVQIMDPSKAMKKPVGLLSVKVIKAIKLKKKDLLGGSDPYVKLTLSGDKVPGKKTV 300

Query:   301 VKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVK 360
             VKH NLNPEWNEE++  V++PESQ ++L VYDWEQVGKHDK+GMNV+ LK+LTPEEP + 
Sbjct:   301 VKHSNLNPEWNEEFDLVVKEPESQELQLIVYDWEQVGKHDKIGMNVIQLKDLTPEEPKLM 360

Query:   361 TLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFKEEDLPKSFEESQTVQKAPENTPAGGGLL 420
             TL+LLK+M+  +  +EKSRGQLVVE  YKPFK++D+P++ ++   V+KAPE TP+ GGLL
Sbjct:   361 TLELLKSMEPKEPVSEKSRGQLVVEVEYKPFKDDDIPENIDDPNAVEKAPEGTPSTGGLL 420

Query:   421 VVIVHEAQDVEGKHHTNPYARILFRGEERKTKHVKKNRDPRWEEEFQFMLEEPPTNDRLH 480
             VVIVHEA+D+EGK+HTNP  R+LFRGEERKTK VKKNR+PRW+E+FQF L+EPP ND+LH
Sbjct:   421 VVIVHEAEDLEGKYHTNPSVRLLFRGEERKTKRVKKNREPRWDEDFQFPLDEPPINDKLH 480

Query:   481 VEVCSVSSRIGLLHPK 496
             VEV S SSR  L+HPK
Sbjct:   481 VEVISSSSR--LIHPK 494




GO:0003674 "molecular_function" evidence=ND
GO:0005886 "plasma membrane" evidence=ISM
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0009306 "protein secretion" evidence=IMP
TAIR|locus:2146688 SYTC "AT5G04220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047027 AT2G21010 "AT2G21010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201036 NTMC2T2.1 "AT1G05500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184931 SYTD "AT5G11100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100992 NTMC2T4 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0039208 Esyt2 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00020443 esyt-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BSJ8 ESYT1 "Extended synaptotagmin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1344426 Esyt1 "extended synaptotagmin-like protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B6ETT4SYT2_ARATHNo assigned EC number0.70630.95610.9348nono
Q9SKR2SYT1_ARATHNo assigned EC number0.77300.94470.9168yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
NTMC2T1.2
plant synaptotagmin (538 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-45
pfam0016885 pfam00168, C2, C2 domain 4e-26
smart00239101 smart00239, C2, Protein kinase C conserved region 7e-26
cd00030102 cd00030, C2, C2 domain 8e-26
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 1e-20
cd04033133 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the 9e-19
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 2e-18
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 3e-18
cd04035123 cd04035, C2A_Rabphilin_Doc2, C2 domain first repea 7e-16
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 9e-16
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 2e-15
cd08377119 cd08377, C2C_MCTP_PRT, C2 domain third repeat foun 4e-15
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 4e-15
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 4e-15
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 5e-15
cd04024128 cd04024, C2A_Synaptotagmin-like, C2 domain first r 1e-14
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 2e-14
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 2e-14
COG50381227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 3e-14
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 3e-14
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 4e-14
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 6e-14
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 8e-14
cd04037124 cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer 3e-13
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 4e-13
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 5e-13
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 4e-12
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 7e-12
pfam0016885 pfam00168, C2, C2 domain 1e-11
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 2e-11
cd04047110 cd04047, C2B_Copine, C2 domain second repeat in Co 2e-11
cd08676153 cd08676, C2A_Munc13-like, C2 domain first repeat i 2e-11
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 5e-11
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 1e-10
cd08390123 cd08390, C2A_Synaptotagmin-15-17, C2A domain first 2e-10
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 4e-10
cd08382123 cd08382, C2_Smurf-like, C2 domain present in Smad 4e-10
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 4e-10
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 5e-10
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 6e-10
cd00030102 cd00030, C2, C2 domain 9e-10
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 3e-09
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 8e-09
smart00239101 smart00239, C2, Protein kinase C conserved region 1e-08
cd04027127 cd04027, C2B_Munc13, C2 domain second repeat in Mu 2e-08
cd04021125 cd04021, C2_E3_ubiquitin_ligase, C2 domain present 3e-08
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 3e-08
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 5e-08
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 6e-08
cd08375136 cd08375, C2_Intersectin, C2 domain present in Inte 6e-08
cd04054121 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat 9e-08
cd04041111 cd04041, C2A_fungal, C2 domain first repeat; funga 9e-08
cd08373127 cd08373, C2A_Ferlin, C2 domain first repeat in Fer 1e-07
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 1e-07
cd04045120 cd04045, C2C_Tricalbin-like, C2 domain third repea 2e-07
cd08410135 cd08410, C2B_Synaptotagmin-17, C2 domain second re 2e-07
cd04031125 cd04031, C2A_RIM1alpha, C2 domain first repeat con 3e-07
cd08678126 cd08678, C2_C21orf25-like, C2 domain found in the 5e-07
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 5e-07
cd04050105 cd04050, C2B_Synaptotagmin-like, C2 domain second 6e-07
cd04039108 cd04039, C2_PSD, C2 domain present in Phosphatidyl 6e-07
cd08682126 cd08682, C2_Rab11-FIP_classI, C2 domain found in R 1e-06
cd08393125 cd08393, C2A_SLP-1_2, C2 domain first repeat prese 1e-06
cd08406136 cd08406, C2B_Synaptotagmin-12, C2 domain second re 1e-06
cd04014132 cd04014, C2_PKC_epsilon, C2 domain in Protein Kina 2e-06
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 3e-06
cd08381122 cd08381, C2B_PI3K_class_II, C2 domain second repea 3e-06
cd04018151 cd04018, C2C_Ferlin, C2 domain third repeat in Fer 5e-06
cd04048120 cd04048, C2A_Copine, C2 domain first repeat in Cop 6e-06
cd04025123 cd04025, C2B_RasA1_RasA4, C2 domain second repeat 8e-06
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 2e-05
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 3e-05
cd04010148 cd04010, C2B_RasA3, C2 domain second repeat presen 3e-05
cd08389124 cd08389, C2A_Synaptotagmin-14_16, C2A domain first 3e-05
cd08408138 cd08408, C2B_Synaptotagmin-14_16, C2 domain second 5e-05
cd04022127 cd04022, C2A_MCTP_PRT_plant, C2 domain first repea 6e-05
cd08675137 cd08675, C2B_RasGAP, C2 domain second repeat of Ra 7e-05
cd08688110 cd08688, C2_KIAA0528-like, C2 domain found in the 7e-05
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 8e-05
cd08378121 cd08378, C2B_MCTP_PRT_plant, C2 domain second repe 2e-04
cd04029125 cd04029, C2A_SLP-4_5, C2 domain first repeat prese 2e-04
cd08409137 cd08409, C2B_Synaptotagmin-15, C2 domain second re 4e-04
cd04052111 cd04052, C2B_Tricalbin-like, C2 domain second repe 5e-04
PLN02952599 PLN02952, PLN02952, phosphoinositide phospholipase 7e-04
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 8e-04
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 0.001
cd08395120 cd08395, C2C_Munc13, C2 domain third repeat in Mun 0.001
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 0.002
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 0.002
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 0.002
cd08400126 cd08400, C2_Ras_p21A1, C2 domain present in RAS p2 0.002
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 0.002
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 0.003
PLN02223537 PLN02223, PLN02223, phosphoinositide phospholipase 0.003
PLN032002102 PLN03200, PLN03200, cellulose synthase-interactive 0.003
cd04010148 cd04010, C2B_RasA3, C2 domain second repeat presen 0.004
cd04032127 cd04032, C2_Perforin, C2 domain of Perforin 0.004
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
 Score =  170 bits (433), Expect = 3e-45
 Identities = 119/503 (23%), Positives = 208/503 (41%), Gaps = 63/503 (12%)

Query: 2   GVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVK-NPEIRPLVERDSETLQQMLPEIP 60
            V S IFG+ GF     S   I       ++    +    IR LV++  E  ++ L    
Sbjct: 165 SVASWIFGYLGFSFA--SLFFIILVTMYVYRTCIKRVRRNIRDLVQQ--ELSEEKLEN-- 218

Query: 61  LWVKCPDYDRVDWLNKFLELMWPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTL 120
                 DY+ V+WLN FL+  WP ++ +I +   +     +AE IP + I+++  +  TL
Sbjct: 219 ------DYESVEWLNTFLQKFWPIIEPSISQQVVDQVNQQLAEAIPSF-IDALALDEFTL 271

Query: 121 GTLPPTFQGMKVYV-TDEKELIMEPCLKWAANPN-------------------VTIGVKA 160
           G+ PP   G++ Y  T+   ++M+    +  +                     V  G   
Sbjct: 272 GSKPPRIDGIRSYPSTESDTVVMDVDFSFTPHDISDVTATSARASVNPKISLVVKKGKSF 331

Query: 161 FGLKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVG-----AD 215
                 + V DL    + R+ ++ L+  +P    +   L+E P  DF L  +G      D
Sbjct: 332 GSFTLPILVEDLFFKGRVRVRVE-LMSKYPFIKTVSFQLLEVPEFDFILVPLGGDFFGVD 390

Query: 216 LMSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKAYR-RPVGILHVKVVKAMNLKK 274
           + +IPGL RF+QE+I + +  M L P +L + I           +G++ VK+  A  LKK
Sbjct: 391 IFAIPGLSRFIQEIINSTLGPMLLPPNSLTIDISQIMAGDSGTAIGVVEVKIKSAEGLKK 450

Query: 275 KDLL--GASDPYVKLKITEDKLPSKKTTVKHKNLNPEWNEEYNFTVRDPESQAVELAVYD 332
            D    G  DPY+ +    D++   KT VK   LNP WN E  + + +  +  + L++YD
Sbjct: 451 SDSTINGTVDPYITVT-FSDRVIG-KTRVKKNTLNPVWN-ETFYILLNSFTDPLNLSLYD 507

Query: 333 WEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFK 392
           +        +G   + L  L  + P  K  + L         N K+ G+L  +  + P  
Sbjct: 508 FNSFKSDKVVGSTQLDLALLH-QNPVKK--NELYEFLR----NTKNVGRLTYDLRFFPVI 560

Query: 393 EEDLPKSFEESQTVQKAPENTPAGGGLLVVIVHEAQDVEGKHHTNPYAR---ILFRGEER 449
           E+       E +   +  E++    G+L V + E + ++                  E  
Sbjct: 561 EDKK-----ELKGSVEPLEDSNT--GILKVTLREVKALDELSSKKDNKSAELYTNAKEVY 613

Query: 450 KTKHVKKNRDPRWEEEFQFMLEE 472
            T  +K    P W  ++  ++ +
Sbjct: 614 STGKLKFTNHPSWNLQYNVLVTD 636


Length = 1227

>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine Back     alignment and domain information
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin Back     alignment and domain information
>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group Back     alignment and domain information
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|176051 cd08406, C2B_Synaptotagmin-12, C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine Back     alignment and domain information
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>gnl|CDD|176053 cd08408, C2B_Synaptotagmin-14_16, C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|178538 PLN02952, PLN02952, phosphoinositide phospholipase C Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>gnl|CDD|176041 cd08395, C2C_Munc13, C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|165867 PLN02223, PLN02223, phosphoinositide phospholipase C Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 525
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 100.0
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 100.0
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.87
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.86
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.84
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.83
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.83
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.82
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.82
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.82
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.82
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.82
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.81
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.81
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.8
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.8
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.79
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.79
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.79
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.79
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.79
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.79
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.79
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.79
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.79
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.78
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.78
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.78
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.78
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.77
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.77
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.77
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.76
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.76
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.76
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.76
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.76
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.76
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.76
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.76
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.76
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.76
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.75
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.75
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.75
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.75
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.75
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.75
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.75
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.74
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.74
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.74
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.74
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.73
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.73
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.73
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.73
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.73
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.73
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.72
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.72
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.72
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.72
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.72
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.71
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.71
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.71
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.71
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.71
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.71
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.7
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.7
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.7
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.7
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.7
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.7
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.7
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 99.7
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.7
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.69
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.69
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.69
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.69
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.69
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.68
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.68
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.68
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.68
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.68
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.68
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.67
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.67
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.67
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.67
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.67
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.67
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.67
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.66
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.66
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.66
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.66
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.66
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.66
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.66
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.66
PLN03008 868 Phospholipase D delta 99.66
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.65
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.65
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.65
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.65
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.65
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.65
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.65
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.65
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.64
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.64
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.64
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.64
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.63
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.63
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.63
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.63
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.63
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.63
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.63
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.63
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.63
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.63
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.62
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.62
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.62
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.62
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.62
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.62
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.62
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.62
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.62
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.62
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.61
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.61
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.61
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.61
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.61
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.61
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.59
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.59
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.59
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.59
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.58
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.58
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.58
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.57
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.57
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.57
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.57
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.57
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.57
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.57
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.55
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.55
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.54
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.54
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.54
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.53
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.53
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.53
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.52
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.52
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.52
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.52
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.51
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.51
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.5
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.5
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.49
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.48
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.48
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.48
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.48
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.47
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.46
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.44
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.42
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.41
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.4
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.39
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.38
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.37
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.37
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.37
KOG1028 421 consensus Ca2+-dependent phospholipid-binding prot 99.35
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.35
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.35
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.34
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.34
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.33
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.33
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.29
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.26
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.24
PLN03008 868 Phospholipase D delta 99.18
PF1029691 DUF2404: Putative integral membrane protein conser 99.17
PLN02223537 phosphoinositide phospholipase C 99.14
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 99.14
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.14
PLN02270 808 phospholipase D alpha 99.12
PLN02952599 phosphoinositide phospholipase C 99.05
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.03
PLN02223537 phosphoinositide phospholipase C 98.97
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.96
PLN02230598 phosphoinositide phospholipase C 4 98.95
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.93
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 98.9
PLN02222581 phosphoinositide phospholipase C 2 98.88
PLN02228567 Phosphoinositide phospholipase C 98.87
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.86
PLN02952599 phosphoinositide phospholipase C 98.81
PLN02222581 phosphoinositide phospholipase C 2 98.78
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.77
PLN02230598 phosphoinositide phospholipase C 4 98.77
KOG1327 529 consensus Copine [Signal transduction mechanisms] 98.74
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.72
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.69
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.69
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.63
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.63
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 98.62
PLN02228567 Phosphoinositide phospholipase C 98.6
PLN02352 758 phospholipase D epsilon 98.54
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 98.52
PLN02270 808 phospholipase D alpha 98.49
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.49
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.48
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.23
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 98.14
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 98.05
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 98.02
KOG3532 1051 consensus Predicted protein kinase [General functi 97.9
PLN02964 644 phosphatidylserine decarboxylase 97.73
PF12416340 DUF3668: Cep120 protein; InterPro: IPR022136 This 97.72
KOG1327 529 consensus Copine [Signal transduction mechanisms] 97.72
PLN02964 644 phosphatidylserine decarboxylase 97.64
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.55
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.54
PLN02352 758 phospholipase D epsilon 97.37
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.27
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.21
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 96.8
KOG3837523 consensus Uncharacterized conserved protein, conta 96.78
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 96.49
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 96.3
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 96.15
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 96.05
PF15627156 CEP76-C2: CEP76 C2 domain 95.69
KOG1452 442 consensus Predicted Rho GTPase-activating protein 95.68
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 95.4
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 95.33
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 95.23
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 95.08
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 94.92
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 94.81
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 94.29
KOG3837523 consensus Uncharacterized conserved protein, conta 94.15
cd08397159 C2_PI3K_class_III C2 domain present in class III p 94.07
cd08397159 C2_PI3K_class_III C2 domain present in class III p 93.98
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 93.89
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 93.6
PF15627156 CEP76-C2: CEP76 C2 domain 93.21
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 92.39
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 92.29
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 91.86
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 91.44
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 91.32
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 90.03
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 87.46
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 86.69
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 83.84
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 83.28
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 80.17
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=1.4e-62  Score=521.43  Aligned_cols=469  Identities=26%  Similarity=0.494  Sum_probs=380.6

Q ss_pred             cchhhhHHhhhhhHHHHHHHHHhheeeeEEeccCCCCcccccccccCHHHHHHhcCCCCCcccCCCCCchHHHHHHHHHH
Q 009797            2 GVISTIFGFCGFGVGISSGLVIGYFLFIYFQPTDVKNPEIRPLVERDSETLQQMLPEIPLWVKCPDYDRVDWLNKFLELM   81 (525)
Q Consensus         2 ~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~w~~~~~~E~~~WlN~~l~~~   81 (525)
                      |++||++|++||+++.++.+++.. .++|.+..++-++-+|.+..  ++.-++-+.        .|+||+||||.+|+++
T Consensus       165 ~v~Swifg~~~fs~~slffii~~~-~~vY~~~~~rv~rnird~v~--~~~~~ek~~--------nd~ESveWLNtfL~Kf  233 (1227)
T COG5038         165 SVASWIFGYLGFSFASLFFIILVT-MYVYRTCIKRVRRNIRDLVQ--QELSEEKLE--------NDYESVEWLNTFLQKF  233 (1227)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHH--HHHHHHhhh--------cchhHHHHHHHHHHhh
Confidence            689999999999977765544332 23344422222223343321  111122221        5999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHHHHHhcCCceeeeeEEEeEEeCCCCCCeEeeeEEEec-CCCeEEEEeeeeEe-----------
Q 009797           82 WPYLDKAICKTAKNIAKPIIAEQIPKYKIESVEFETLTLGTLPPTFQGMKVYVT-DEKELIMEPCLKWA-----------  149 (525)
Q Consensus        82 W~~~~~~~~~~i~~~~~~~l~~~~p~~~i~~i~~~~~~lG~~~P~i~~v~~~~~-~~~~~~le~~~~~~-----------  149 (525)
                      ||.++|.+++.|.+.+|+.|+++.|+| |+++++.+||||++||||.+||.|+. ..+.+.||+++++.           
T Consensus       234 W~i~eP~iSqqV~dqvn~~la~~iPsF-I~~l~l~efTLGsk~PrI~~Irsyp~te~dtv~mD~~~sftP~d~sD~t~~~  312 (1227)
T COG5038         234 WPIIEPSISQQVVDQVNQQLAEAIPSF-IDALALDEFTLGSKPPRIDGIRSYPSTESDTVVMDVDFSFTPHDISDVTATS  312 (1227)
T ss_pred             eeccChHHHHHHHHHHHHHHHhhcchh-hhhhhhhhcccCCCCCceeeeeecCCCCCceEEEEeeeccCccchhhhhhHH
Confidence            999999999999999999999999999 99999999999999999999999986 66889999999996           


Q ss_pred             ----CCCcEEEEEEE---cc-eEEEEEEEeEEEEEEEEEEEeecCCCCCeeeEEEEEcCCCCeEEEEEEEcC-----cCc
Q 009797          150 ----ANPNVTIGVKA---FG-LKATVQVVDLQVFAQPRITLKPLVPAFPCFANIYVSLMEKPHVDFGLKLVG-----ADL  216 (525)
Q Consensus       150 ----~~~~i~l~~~~---~~-~~~~v~v~~~~~~g~~rv~l~pl~~~~P~~~~~~~sf~~~P~id~~~~~~g-----~~~  216 (525)
                          -+++|.|.++.   ++ +++||.|+|+.|.|++||+++ |++.+|+++.+.++|||.|.+||.++|+|     .|+
T Consensus       313 ~r~~vn~kIsL~v~~Gk~~~~~~lPI~Vedl~f~g~~Rvr~~-L~~~~PfiktV~~~Lle~Pe~df~l~Plg~~~~g~dI  391 (1227)
T COG5038         313 ARASVNPKISLVVKKGKSFGSFTLPILVEDLFFKGRVRVRVE-LMSKYPFIKTVSFQLLEVPEFDFILVPLGGDFFGVDI  391 (1227)
T ss_pred             HhhhcCcceeEEEEeeeeeeEEeccEEEEeeeeeEEEEEEEE-ecCCCcceeEEEEEEecCcceeEEEEEcCCCccceeE
Confidence                25678888865   45 789999999999999999998 99999999999999999999999999987     478


Q ss_pred             ccCcchHHHHHHHHHHHHhhcccCCccccccccCCCcc-CCCceeEEEEEEEeccCCcccC--cCCCCCcEEEEEEcCCc
Q 009797          217 MSIPGLYRFVQELIKTQVANMYLWPKTLEVPILDPSKA-YRRPVGILHVKVVKAMNLKKKD--LLGASDPYVKLKITEDK  293 (525)
Q Consensus       217 ~~iP~l~~~i~~~i~~~l~~~~v~P~~~~~~i~~~~~~-~~~~~g~L~V~v~~A~~L~~~d--~~g~~dpyv~v~~~~~~  293 (525)
                      +.+|||.+||+++|...+++|+++|+.+++++...... ...+.|+|.|+|.+|++|...+  ..+..|||+++...+..
T Consensus       392 ~~iPGL~~fI~~~i~~~l~pml~~Pnsl~idi~~~m~~~s~~aIGVv~vkI~sa~~lk~~d~~i~~~vDpyit~~~~~r~  471 (1227)
T COG5038         392 FAIPGLSRFIQEIINSTLGPMLLPPNSLTIDISQIMAGDSGTAIGVVEVKIKSAEGLKKSDSTINGTVDPYITVTFSDRV  471 (1227)
T ss_pred             ecCccHHHHHHHHHHhhcCCeeeCCceEEEcHHHhhccccCCeeEEEEEEEeeccCcccccccccCCCCceEEEEecccc
Confidence            99999999999999999999999999999988754443 7889999999999999999988  57899999999976544


Q ss_pred             CCceeeeecCCCCCCeEeeEEEEEeeCCCCCeEEEEEEecCCCCCCCccEEEEEECcccCCCCCeeE-EEecccccccCC
Q 009797          294 LPSKKTTVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVK-TLDLLKNMDLND  372 (525)
Q Consensus       294 ~~~~kT~v~~~t~nP~w~e~f~f~v~~~~~~~L~i~v~d~~~~~~d~~lG~~~i~L~~l~~~~~~~~-~~~l~~~~~~~~  372 (525)
                      .  .||++++++.||+|||+|++.+... .+.|.++|||.+...+|+.+|.+.++|..|.....+.. ...+.       
T Consensus       472 ~--gkT~v~~nt~nPvwNEt~Yi~lns~-~d~L~LslyD~n~~~sd~vvG~~~l~L~~L~~~~~~~ne~~e~~-------  541 (1227)
T COG5038         472 I--GKTRVKKNTLNPVWNETFYILLNSF-TDPLNLSLYDFNSFKSDKVVGSTQLDLALLHQNPVKKNELYEFL-------  541 (1227)
T ss_pred             C--CccceeeccCCccccceEEEEeccc-CCceeEEEEeccccCCcceeeeEEechHHhhhccccccceeeee-------
Confidence            3  5999999999999999999999764 68999999999999999999999999999987764432 22222       


Q ss_pred             CCCCceeeEEEEEEEEEecCCCCCCCcccccccccCCCCCCCCCcceEEEEEEeeecCCCC--CCCCcEEEEEECCeEE-
Q 009797          373 GQNEKSRGQLVVEFIYKPFKEEDLPKSFEESQTVQKAPENTPAGGGLLVVIVHEAQDVEGK--HHTNPYARILFRGEER-  449 (525)
Q Consensus       373 ~~~~~~~G~l~l~l~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~g~L~V~v~~a~~L~~~--~~~dPyv~v~l~~~~~-  449 (525)
                       .+.+..|+|+.+++|+|..++........     ..+  ....+|++.++++++++|...  ....-|++++++++.. 
T Consensus       542 -~~~k~vGrL~yDl~ffp~~e~k~~~~~s~-----e~~--ed~n~GI~k~tl~~~~~l~~~~~~~~~~~a~l~~~~keV~  613 (1227)
T COG5038         542 -RNTKNVGRLTYDLRFFPVIEDKKELKGSV-----EPL--EDSNTGILKVTLREVKALDELSSKKDNKSAELYTNAKEVY  613 (1227)
T ss_pred             -ccCccceEEEEeeeeecccCCcccccccc-----CCc--ccCCcceeEEEeeccccccCccccccceeEEEEecceEEe
Confidence             24788999999999999877643322110     001  123579999999999999763  2233448999988765 


Q ss_pred             EeeeecCCCCCcccceEEEEecCCCCCCeEEEEEEEcccCccCCCCCccceEEEEEcccc
Q 009797          450 KTKHVKKNRDPRWEEEFQFMLEEPPTNDRLHVEVCSVSSRIGLLHPKVLFQFYFIFYLVH  509 (525)
Q Consensus       450 kT~v~~~t~nP~wne~f~f~v~~~~~~~~l~i~V~d~~~~~~~~~~d~~lG~v~I~l~~~  509 (525)
                      .|+..+.+.+|.||+.++-.+.+. .+..+.+.++|...       .+.+|....+|.++
T Consensus       614 st~~~k~t~~~~wn~~~~~~v~~~-~ns~~~~~~~d~~~-------g~~i~~~~~~l~~l  665 (1227)
T COG5038         614 STGKLKFTNHPSWNLQYNVLVTDR-KNSSIKVVTFDVQS-------GKVIATEGSTLPDL  665 (1227)
T ss_pred             ccceeeeccCCceeeecceEeccC-cceeEEEEeccccc-------CceeccccccchHh
Confidence            568999999999999999999875 55689999988842       45666666666554



>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>PF10296 DUF2404: Putative integral membrane protein conserved region (DUF2404); InterPro: IPR019411 This is entry represents a domain of unknown function found in mitochondrial distribution and morphology proteins Mdm12 and Mdm34, and in maintenance of mitochondrial morphology protein Mmm1 Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
2nsq_A155 Crystal Structure Of The C2 Domain Of The Human E3 1e-13
3m7f_B176 Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX 1e-12
3b7y_A153 Crystal Structure Of The C2 Domain Of The E3 Ubiqui 4e-12
2ep6_A133 Solution Structure Of The Second C2 Domain From Hum 9e-12
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 4e-11
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 4e-11
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 3e-10
1rsy_A152 Structure Of The First C2-domain Of Synaptotagmin I 9e-10
3f04_A143 Crystal Structure Of Synaptotagmin I C2a Domain Len 1e-09
3f00_A143 Crystal Structure Of Synaptotagmin I C2a Domain Wit 1e-09
1byn_A128 Solution Structure Of The Calcium-Bound First C2-Do 1e-09
2r83_A284 Crystal Structure Analysis Of Human Synaptotagmin 1 2e-09
2uzp_A144 Crystal Structure Of The C2 Domain Of Human Protein 1e-08
3gpe_A137 Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain 1e-08
1dsy_A139 C2 Domain From Protein Kinase C (Alpha) Complexed W 1e-08
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 1e-08
1a25_A149 C2 Domain From Protein Kinase C (Beta) Length = 149 3e-08
2cm5_A166 Crystal Structure Of The C2b Domain Of Rabphilin Le 4e-08
4dnl_A140 Crystal Structure Of A C2 Domain Of A Protein Kinas 6e-08
2cm6_A166 Crystal Structure Of The C2b Domain Of Rabphilin3a 6e-08
3rpb_A140 The C2b-Domain Of Rabphilin: Structural Variations 7e-08
1tjm_A159 Crystallographic Identification Of Sr2+ Coordinatio 6e-07
2lha_A151 Solution Structure Of C2b With Ip6 Length = 151 6e-07
1k5w_A152 Three-Dimensional Structure Of The Synaptotagmin 1 6e-07
1wfj_A136 C2 Domain-Containing Protein From Putative Elicitor 1e-05
3kwt_A148 Munc13-1 C2b-Domain, Calcium-Free Length = 148 1e-05
2jqz_A131 Solution Structure Of The C2 Domain Of Human Smurf2 2e-05
3pyc_A132 Crystal Structure Of Human Smurf1 C2 Domain Length 2e-05
3jzy_A510 Crystal Structure Of Human Intersectin 2 C2 Domain 2e-05
2chd_A142 Crystal Structure Of The C2a Domain Of Rabphilin-3a 2e-05
1w15_A153 Rat Synaptotagmin 4 C2b Domain In The Presence Of C 2e-05
2k3h_A140 Structural Determinants For Ca2+ And Pip2 Binding B 3e-05
2enp_A147 Solution Structure Of The First C2 Domain From Huma 6e-05
3n5a_A138 Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 3e-04
2dmg_A142 Solution Structure Of The Third C2 Domain Of Kiaa12 8e-04
>pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 Back     alignment and structure

Iteration: 1

Score = 74.7 bits (182), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 51/136 (37%), Positives = 76/136 (55%), Gaps = 8/136 (5%) Query: 261 ILHVKVVKAMNLKKKDLLGASDPYVKLKI----TEDKLPSKKTTVKHKNLNPEWNEEYNF 316 IL VKVV ++L KKD+ GASDPYVKL + +L +T K LNP+WNEE+ F Sbjct: 22 ILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYF 81 Query: 317 TVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNE 376 V +P + + V+D ++ + D +G VPL L E+P+++ K+ L ++ Sbjct: 82 RV-NPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRP-RSH 139 Query: 377 KSR--GQLVVEFIYKP 390 KSR G L ++ Y P Sbjct: 140 KSRVKGFLRLKMAYMP 155
>pdb|3M7F|B Chain B, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 176 Back     alignment and structure
>pdb|3B7Y|A Chain A, Crystal Structure Of The C2 Domain Of The E3 Ubiquitin- Protein Ligase Nedd4 Length = 153 Back     alignment and structure
>pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 Back     alignment and structure
>pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 Back     alignment and structure
>pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 Back     alignment and structure
>pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 Back     alignment and structure
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure
>pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 Back     alignment and structure
>pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 Back     alignment and structure
>pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|1A25|A Chain A, C2 Domain From Protein Kinase C (Beta) Length = 149 Back     alignment and structure
>pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 Back     alignment and structure
>pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 Back     alignment and structure
>pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 Back     alignment and structure
>pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 Back     alignment and structure
>pdb|1TJM|A Chain A, Crystallographic Identification Of Sr2+ Coordination Site In Synaptotagmin I C2b Domain Length = 159 Back     alignment and structure
>pdb|2LHA|A Chain A, Solution Structure Of C2b With Ip6 Length = 151 Back     alignment and structure
>pdb|1K5W|A Chain A, Three-Dimensional Structure Of The Synaptotagmin 1 C2b- Domain: Synaptotagmin 1 As A Phospholipid Binding Machine Length = 152 Back     alignment and structure
>pdb|1WFJ|A Chain A, C2 Domain-Containing Protein From Putative Elicitor- Responsive Gene Length = 136 Back     alignment and structure
>pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 Back     alignment and structure
>pdb|2JQZ|A Chain A, Solution Structure Of The C2 Domain Of Human Smurf2 Length = 131 Back     alignment and structure
>pdb|3PYC|A Chain A, Crystal Structure Of Human Smurf1 C2 Domain Length = 132 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 Back     alignment and structure
>pdb|1W15|A Chain A, Rat Synaptotagmin 4 C2b Domain In The Presence Of Calcium Length = 153 Back     alignment and structure
>pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 Back     alignment and structure
>pdb|2ENP|A Chain A, Solution Structure Of The First C2 Domain From Human BK Protein Length = 147 Back     alignment and structure
>pdb|3N5A|A Chain A, Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 138 Back     alignment and structure
>pdb|2DMG|A Chain A, Solution Structure Of The Third C2 Domain Of Kiaa1228 Protein Length = 142 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 6e-45
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 3e-06
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 6e-45
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 2e-10
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 3e-44
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 2e-07
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 4e-44
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 1e-21
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 9e-42
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 2e-12
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 3e-40
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 4e-10
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 2e-37
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 8e-08
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 2e-37
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 9e-23
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 3e-33
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 7e-08
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 7e-33
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 6e-08
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 6e-32
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 2e-08
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 7e-32
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 2e-14
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 3e-31
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 6e-07
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 5e-31
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 2e-11
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 2e-30
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 1e-08
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 2e-28
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 2e-06
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 2e-28
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 3e-09
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 5e-28
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 3e-08
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 4e-27
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 2e-06
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 1e-25
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 1e-05
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-24
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-06
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 2e-23
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 2e-04
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 5e-23
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 5e-08
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 6e-23
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 3e-05
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 7e-23
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 3e-07
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 2e-22
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 2e-04
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 2e-22
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 8e-07
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 3e-22
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 9e-13
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 4e-22
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 3e-04
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 8e-22
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 2e-04
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 2e-21
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 1e-08
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 2e-21
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 2e-06
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 6e-21
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 2e-06
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 6e-21
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 2e-07
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 6e-21
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 1e-06
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 1e-20
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 3e-06
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 4e-20
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 5e-08
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 3e-13
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 1e-06
3nsj_A540 Perforin-1; pore forming protein, immune system; H 3e-13
3nsj_A540 Perforin-1; pore forming protein, immune system; H 2e-08
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 2e-11
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 5e-06
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 1e-07
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 2e-05
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 4e-04
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 4e-04
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 7e-04
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
 Score =  155 bits (392), Expect = 6e-45
 Identities = 49/170 (28%), Positives = 78/170 (45%), Gaps = 10/170 (5%)

Query: 255 YRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKI---TEDKLPSKKTTVKHKNLNPEWN 311
           +     ++ VKV+  + L KKD+LGASDPYV++ +       L S +T    K+LNP+WN
Sbjct: 3   HNDDTRVVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMSGILTSVQTKTIKKSLNPKWN 62

Query: 312 EEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLN 371
           EE  F V  P+   +   V+D  ++ + D +G   VPL  L  E P ++     K+  L+
Sbjct: 63  EEILFRV-LPQRHRILFEVFDENRLTRDDFLGQVDVPLYPLPTENPRMERPYTFKDFVLH 121

Query: 372 -DGQNEKSRGQLVVEFIYKPFKEE-----DLPKSFEESQTVQKAPENTPA 415
                 + +G L ++  Y P         D  +  E    V   P+    
Sbjct: 122 PRSHKSRVKGYLRLKMTYLPKNGSEDENADQAEELEPGWVVLDQPDAATH 171


>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Length = 816 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Length = 799 Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query525
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 100.0
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 100.0
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.85
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.85
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.83
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.83
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.83
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.82
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.82
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.81
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.81
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.79
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.77
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.76
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.76
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.76
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.76
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.76
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.74
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.73
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.73
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.72
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.72
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.72
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.72
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.71
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.71
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.71
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.71
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.71
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.71
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.71
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.71
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.71
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.71
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.71
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.7
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.7
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.7
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.7
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.7
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.7
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.7
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.7
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.7
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.7
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.69
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.69
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.69
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.69
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.68
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.68
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.68
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.67
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.67
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.66
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.66
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.66
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.65
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.65
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.64
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.64
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.63
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.63
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.62
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.62
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.61
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.6
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.6
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.6
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.58
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.58
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.57
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.57
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.55
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.54
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.51
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.5
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.49
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.46
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.4
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.39
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.38
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.29
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.26
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.22
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.15
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.12
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.1
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.1
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.07
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.0
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.98
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.95
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.93
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.92
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.13
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.1
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 92.11
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 90.31
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 90.26
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 89.12
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 88.67
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 82.84
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 81.81
2y3a_A 1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 80.92
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 80.66
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
Probab=100.00  E-value=1.2e-34  Score=285.28  Aligned_cols=230  Identities=26%  Similarity=0.404  Sum_probs=193.6

Q ss_pred             CCCceeEEEEEEEeccCCcccCcCCCCCcEEEEEEcCCcCCceeeeecCCCCCCeEeeEEEEEeeCC--CCCeEEEEEEe
Q 009797          255 YRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTTVKHKNLNPEWNEEYNFTVRDP--ESQAVELAVYD  332 (525)
Q Consensus       255 ~~~~~g~L~V~v~~A~~L~~~d~~g~~dpyv~v~~~~~~~~~~kT~v~~~t~nP~w~e~f~f~v~~~--~~~~L~i~v~d  332 (525)
                      +....|.|.|+|++|++|+.+|..|.+||||++++++.....++|+++++++||.|||+|.|.+...  ....|.|+|||
T Consensus        14 y~~~~~~L~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~T~~~~~~~nP~wne~f~f~v~~~~~~~~~l~~~V~d   93 (284)
T 2r83_A           14 YDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELAGKTLVMAVYD   93 (284)
T ss_dssp             EETTTTEEEEEEEEEECCCCCSSSSSCCEEEEEEEETCTTSCEECCCCCSCSSCEEEEEEEECCCGGGCTTCEEEEEEEE
T ss_pred             EECCCCEEEEEEEEeeCCCCCCCCCCCCeEEEEEEEcCCCceEeCCcccCCCCCeeCceEEEEechHHhCcCEEEEEEEE
Confidence            3456799999999999999999889999999999986544467999999999999999999998643  35799999999


Q ss_pred             cCCCCCCCccEEEEEECcccCCCCCeeEEEecccccccCCCCCCceeeEEEEEEEEEecCCCCCCCcccccccccCCCCC
Q 009797          333 WEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNEKSRGQLVVEFIYKPFKEEDLPKSFEESQTVQKAPEN  412 (525)
Q Consensus       333 ~~~~~~d~~lG~~~i~L~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~G~l~l~l~~~p~~~~~~~~~~~~~~~~~~~~~~  412 (525)
                      ++.+++|++||++.++|.++..+.....|++|....    .......|+|.+++.|.|                      
T Consensus        94 ~d~~~~~~~lG~~~i~l~~l~~~~~~~~w~~L~~~~----~~~~~~~G~i~l~l~~~p----------------------  147 (284)
T 2r83_A           94 FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAE----KEEQEKLGDICFSLRYVP----------------------  147 (284)
T ss_dssp             CCSSSCCCEEEEEEEEGGGCCCSSCEEEEEECBCCS----SCCCCCCCEEEEEEEEET----------------------
T ss_pred             CCCCCCCceeEEEEEcchhcccCCcceeEEEeeccc----cccccccccEEEEEEecC----------------------
Confidence            999999999999999999998887778888875321    112356899999999976                      


Q ss_pred             CCCCcceEEEEEEeeecCCCC---CCCCcEEEEEEC--C---eEEEeeeecCCCCCcccceEEEEecCCCCC-CeEEEEE
Q 009797          413 TPAGGGLLVVIVHEAQDVEGK---HHTNPYARILFR--G---EERKTKHVKKNRDPRWEEEFQFMLEEPPTN-DRLHVEV  483 (525)
Q Consensus       413 ~~~~~g~L~V~v~~a~~L~~~---~~~dPyv~v~l~--~---~~~kT~v~~~t~nP~wne~f~f~v~~~~~~-~~l~i~V  483 (525)
                         ..+.|.|.|++|+||+..   +.+||||++++.  +   .+++|+++++|.||+|||.|.|.+...... ..|.|+|
T Consensus       148 ---~~~~l~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~~~~~~~~kT~v~~~t~nP~wne~f~f~v~~~~l~~~~l~i~V  224 (284)
T 2r83_A          148 ---TAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTV  224 (284)
T ss_dssp             ---TTTEEEEEEEEEESCCCCSTTSCCCEEEEEEEEETTEEEEEEECCCCCSCSSCEEEEEEEEECCTTTGGGEEEEEEE
T ss_pred             ---cCCceEEEEEEeECCCCcCCCCCcCeEEEEEEEeCCcEeeeeccceecCCCCCEEceeEEEeCCHHHhCceEEEEEE
Confidence               467899999999999863   578999999985  3   356999999999999999999999765333 3799999


Q ss_pred             EEcccCccCCCCCccceEEEEEccccccchhhhc
Q 009797          484 CSVSSRIGLLHPKVLFQFYFIFYLVHRFKQECCR  517 (525)
Q Consensus       484 ~d~~~~~~~~~~d~~lG~v~I~l~~~~~~~~~~~  517 (525)
                      ||++.    ++++++||++.|++.++..+.++|.
T Consensus       225 ~d~d~----~~~~~~iG~~~i~l~~~~~~~~~w~  254 (284)
T 2r83_A          225 LDYDK----IGKNDAIGKVFVGYNSTGAELRHWS  254 (284)
T ss_dssp             EECCS----SSCCCEEEEEEEETTCCHHHHHHHH
T ss_pred             EeCCC----CCCCcEEEEEEECCCCCCcHHHHHH
Confidence            99986    7889999999999998765555543



>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 525
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 3e-27
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 0.003
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 5e-23
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 2e-19
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 5e-07
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 3e-19
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 2e-18
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 3e-04
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 4e-18
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 2e-04
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 7e-18
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 7e-18
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 8e-18
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 0.001
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 9e-18
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 5e-17
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 2e-16
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 2e-16
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 1e-04
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 6e-16
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 1e-15
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 8e-14
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 5e-04
d1gmia_136 b.7.1.1 (A:) Domain from protein kinase C epsilon 2e-13
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 3e-12
d2cjta1128 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no 2e-07
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 2e-11
d1bdya_123 b.7.1.1 (A:) Domain from protein kinase C delta {R 2e-10
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score =  104 bits (261), Expect = 3e-27
 Identities = 36/144 (25%), Positives = 60/144 (41%), Gaps = 10/144 (6%)

Query: 252 SKAYRRPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTTVKHKNLNPEWN 311
           S     P G L V +V A  L+  D L   DPYV+L         K    +     PEWN
Sbjct: 2   SSGSSGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQ--KSNVAEGMGTTPEWN 59

Query: 312 EEYNFTVRDPESQAVELAVYDWEQVGKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLN 371
           E + FTV +  ++     ++D +   + D +G   +PL+ +  E         +     N
Sbjct: 60  ETFIFTVSEGTTELK-AKIFDKDVGTEDDAVGEATIPLEPVFVEGS-------IPPTAYN 111

Query: 372 DGQNEKSRGQLVVEFIYKPFKEED 395
             ++E+ +G++ V   +KP     
Sbjct: 112 VVKDEEYKGEIWVALSFKPSGPSS 135


>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query525
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.87
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.85
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.83
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.79
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.77
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.76
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.76
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.75
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.75
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.74
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.73
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.73
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.73
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.72
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.72
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.71
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.7
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.7
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.69
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.69
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.69
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.69
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.66
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.65
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.65
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.64
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.64
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.63
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.63
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.63
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.63
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.62
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.62
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.6
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.59
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.59
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.52
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.33
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.28
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.27
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 95.09
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 93.37
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=2.7e-22  Score=169.70  Aligned_cols=122  Identities=33%  Similarity=0.559  Sum_probs=104.1

Q ss_pred             CceeEEEEEEEeccCCcccCcCCCCCcEEEEEEcCCcCCceeeeecCCCCCCeEeeEEEEEeeCCCCCeEEEEEEecCCC
Q 009797          257 RPVGILHVKVVKAMNLKKKDLLGASDPYVKLKITEDKLPSKKTTVKHKNLNPEWNEEYNFTVRDPESQAVELAVYDWEQV  336 (525)
Q Consensus       257 ~~~g~L~V~v~~A~~L~~~d~~g~~dpyv~v~~~~~~~~~~kT~v~~~t~nP~w~e~f~f~v~~~~~~~L~i~v~d~~~~  336 (525)
                      ++.|+|+|+|++|++|+.++..|.+||||+++++++.   ++|+++++|.||.|||+|.|.+.++ .+.|.|+|||++..
T Consensus         3 ~~~G~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~~~~---~~T~~~~~t~nP~wne~f~f~v~~~-~~~L~i~V~d~~~~   78 (126)
T d2ep6a1           3 KDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDR---LQTHTVYKNLNPEWNKVFTFPIKDI-HDVLEVTVFDEDGD   78 (126)
T ss_dssp             CCSEEEEEEEEEEESCCCSSSSSCCCEEEEEEETTEE---EECCCCSSCSSCCCCEEEEEEESCT-TCEEEEEEEEEETT
T ss_pred             CccEEEEEEEEEeECCCCCCCCCCcCeEEEEEcCCeE---EEEEeeCCceeEEEEEEEEEEEecc-CceeEEEEEEccCC
Confidence            5789999999999999999999999999999998765   6999999999999999999999875 57899999999999


Q ss_pred             CCCCccEEEEEECcccCCCCCeeEEEecccccccCCCCCCceeeEEEEEEEEE
Q 009797          337 GKHDKMGMNVVPLKELTPEEPSVKTLDLLKNMDLNDGQNEKSRGQLVVEFIYK  389 (525)
Q Consensus       337 ~~d~~lG~~~i~L~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~G~l~l~l~~~  389 (525)
                      ++|++||++.++|+++..+..+++++..      .. .....+|+|+++++|.
T Consensus        79 ~~d~~lG~~~i~l~~l~~~~~~~~~l~~------~~-~~~~~~G~i~l~~~~i  124 (126)
T d2ep6a1          79 KPPDFLGKVAIPLLSIRDGQPNCYVLKN------KD-LEQAFKGVIYLEMDLI  124 (126)
T ss_dssp             EEEEECCBCEEEGGGCCSSCCEECCCBC------SC-TTSCCSSEEEEEEEEE
T ss_pred             cCcceEEEEEEEHHHCCCCCceEEEccc------cC-CCCceeEEEEEEEEEE
Confidence            9999999999999999877655443322      11 1245679999999875



>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure