Citrus Sinensis ID: 009836

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520----
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGYSDSGPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVKKNEEIERKREEEKERKKRLEKERMERAKRYEEPAWARIDDEGDNEVGNEEGLEEEEIEKKRSEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDEDEVMADFGELDGEVEELGERFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKEDEDEDEDADDEVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKNKKDRGKKSGGEAAKGDRDGFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQPVDGKGTKKDRKAKLKNSSKGNKTKTASKNSSNVCEKCGQEFETRNKLHKHLGDTGHASLKFR
ccccccccEEEccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHcccHHHHHHHcccccccccccccHHHccHHHHHHHHHHHcccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHcccccccccc
cccccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHcccccccccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccccccHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHEccccccccccccccccccccccHHHHHcccccccEEEcccccccccccHHcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEcccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccHHHccccHcHHHHHHHHHcccccEEEccc
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEvlsdpkerawydshrsqilfsdlnsasncgpvpnlysyfsntafsgysdsgpnrksrrVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVKKNEEIERKREEEKERKKRLEKERMERAKryeepawariddegdnevgneegleeEEIEKKRSEFYCvlcgkkfksekqwtnheqskKHKEKVADLRESFVDEDEVMADFGELDGEVEELGERfkdnvgveereigsgvgglsgdedveseffdvadgvevnevddrfgkededededaDDEVNMLKAMLSGhknrkrvavrkedevlKTEAHveneigesefmeydnckstrrknkkdrgkksggeaakgdrdgfkstneeanghhnsgvieessshscvgnknngisdnhsekdpkipdqpvdgkgtkkdrkaklknsskgnktktasknssnVCEKCGQEFETRNKLHkhlgdtghaslkfr
masekrclyevlglrkecttDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFsgysdsgpnrksrrvmeeenkklrkkakreynetvrelaafvkkrdkrvMDMMvkkneeierkreeekerkkrlekermerakryeepawariddegdnevgneegleeeeiekkrSEFYCVLCGKKfksekqwtnheqskkhkekvaDLRESFVDEDEVMADFGELDGEVEELGerfkdnvgveereigsgvgglsgdeDVESEFfdvadgvevnevddrfgkededededadDEVNMLKAmlsghknrkrvavrkedevlkteahveneigesefmeydnckstrrknkkdrgkksggeaakgdrdgfkstneeanGHHNSGVIEESSSHSCVGNKNNgisdnhsekdpkipdqpvdgkgtkkdrkaklknsskgnktktasknssnvcEKCGQEFETRnklhkhlgdtghaslkfr
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGYSDSGPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVkkneeierkreeekerkkrlekermerakrYEEPAWARiddegdnevgneegleeeeieKKRSEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDEDEVMADFgeldgeveelgeRFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKededededaddeVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKNKKDRGKKSGGEAAKGDRDGFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQPVDGKGTKKDRKAKLKNSSKGNKTKTASKNSSNVCEKCGQEFETRNKLHKHLGDTGHASLKFR
******CLYEVLGLRKECTTDEIRSAYKKLALQR**************ATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAF*********************************************************************************************************************EFYCVLCGKKF*****************************************************************************FFDVA*****************************************************************************************************************************************************************************************************************
***EKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSH*******DLNSASNCGPVPNLYSYFSNTAFSGYSDSGPNRK**********KLRKKAKREYNETVRELAAFVKKRDKRVM*******************************************************************EFYCVLCGKKFKSE******************************************************************************************************************************************************************************************************************************************************************VCEKCGQEFETRNKLHKHLGDTGHASLK**
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGY***************************YNETVRELAAFVKKRDKRVMDMMVKKNEEI**************EKERMERAKRYEEPAWARIDDEGDN*************EKKRSEFYCVLCGKKFKS*****************ADLRESFVDEDEVMADFGELDGEVEELGERFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDR*************DEVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNC************************DGFKSTNEEANGHHN*************GNKNNGISDNHSEKDPKIPDQP***********************************KCGQEFETRNKLHKHLGDTGHASLKFR
*****RCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSD****SNCGPVPNLYSYFSNTAFSGYSDSGPNRKSRRV*EEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVKKNEEIE**R**************MER****E**AWARID********************KRSEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDEDEVMADF********ELGERF******************S*******EF*DVADGVE*****************DADDEVNMLKAMLSG*****************************EF******************************************************************************************************TKTASK*SSNVCEKCGQEFETRNKLHKHLGDTGHASLK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGYSDSGPNRKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDKRVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYEEPAWARIDDEGDNEVGNEEGLEEEEIEKKRSEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDEDEVMADFGELDGEVEELGERFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKEDEDEDEDADDEVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKNKKDRGKKSGGEAAKGDRDGFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQPVDGKGTKKDRKAKLKNSSKGNKTKTASKNSSNVCEKCGQEFETRNKLHKHLGDTGHASLKFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query524 2.2.26 [Sep-21-2011]
Q0II91533 DnaJ homolog subfamily C yes no 0.484 0.476 0.278 6e-22
Q5F1R6531 DnaJ homolog subfamily C yes no 0.473 0.467 0.288 1e-20
Q6PGY5545 DnaJ homolog subfamily C yes no 0.290 0.278 0.342 4e-18
P53863590 J protein JJJ1 OS=Sacchar yes no 0.139 0.123 0.526 1e-14
Q54ED3459 DnaJ homolog subfamily A no no 0.143 0.163 0.461 2e-11
Q74H58373 Chaperone protein DnaJ OS yes no 0.131 0.184 0.506 2e-11
P39102459 DnaJ protein homolog XDJ1 no no 0.146 0.167 0.428 7e-11
Q8EUM4388 Chaperone protein DnaJ OS yes no 0.125 0.170 0.492 3e-10
A5UYW4370 Chaperone protein DnaJ OS yes no 0.202 0.286 0.362 3e-10
Q9XCA6383 Chaperone protein DnaJ OS yes no 0.127 0.174 0.492 3e-10
>sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 Back     alignment and function desciption
 Score =  105 bits (263), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 99/356 (27%), Positives = 164/356 (46%), Gaps = 102/356 (28%)

Query: 6   RCLYEVLGLRKECTTDEIRSAYKKLALQRHPDK-------------LVQSG---LSQAEA 49
           +C YE LG+R++ + +E++ AY+KLAL+ HPDK             L+Q+    LS  + 
Sbjct: 2   KCHYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQE 61

Query: 50  TAQFQ--------------------ELVHAYEVLSDP----KERAWYDSHRSQI------ 79
            A +                     +L+H + V         E+ +Y  +R+        
Sbjct: 62  RAWYDNHREALLKGGLDGEYQDDSLDLLHYFTVTCYSGYGDDEKGFYTVYRNVFEMIAKE 121

Query: 80  --------------LFSDLNSASNCGPVPNLYSYFS------NTAFSGYSDS--GPNRKS 117
                          F D  S  +    P  Y+Y+       N A+    D+    NR  
Sbjct: 122 ELESALEEDMEDFPTFGDSQSDYDTVVHP-FYAYWQSFCTQKNFAWKEEYDTRQASNRWE 180

Query: 118 RRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVM---DMMVKKNEEIERKREEEKE 174
           +R ME+ENKK+R KA++E NE VR+L AF++KRD+RV     ++ ++N E  RK E  + 
Sbjct: 181 KRAMEKENKKIRDKARKEKNELVRQLVAFIRKRDRRVQAHRKLVEEQNAEKARKAEAMR- 239

Query: 175 RKKRLEKERMERAKRYEEPAWARIDD----------EGDNEVGNEEGLEEEEIEKKR--- 221
           R+++L++ ++  A++Y E +W  + D          + + + G+  G +E E ++ R   
Sbjct: 240 RQQKLKQAKL--AEQYREQSWMAVADLEKELREMEAQYEKQFGDGSGEDEAEDQELRDGQ 297

Query: 222 --------------SEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDED 263
                            YC  C K FK+EK   NHE+SKKH+E VA L++   +E+
Sbjct: 298 DGKDSDEAEDAELYDGLYCPACDKSFKTEKAMRNHEKSKKHREMVALLKQQLEEEE 353
May act as a co-chaperone for HSP70.
Bos taurus (taxid: 9913)
>sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 Back     alignment and function description
>sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 Back     alignment and function description
>sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 Back     alignment and function description
>sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 Back     alignment and function description
>sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P39102|XDJ1_YEAST DnaJ protein homolog XDJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XDJ1 PE=1 SV=2 Back     alignment and function description
>sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query524
359481801595 PREDICTED: dnaJ homolog subfamily C memb 0.963 0.848 0.478 1e-106
255547203553 conserved hypothetical protein [Ricinus 0.900 0.853 0.516 2e-99
449524982588 PREDICTED: LOW QUALITY PROTEIN: dnaJ hom 0.942 0.840 0.430 3e-84
449441091588 PREDICTED: dnaJ homolog subfamily C memb 0.950 0.846 0.442 3e-83
356511845620 PREDICTED: dnaJ homolog subfamily C memb 0.839 0.709 0.437 7e-70
15221189 630 DNAJ heat shock N-terminal domain-contai 0.748 0.622 0.455 7e-61
356562611 626 PREDICTED: dnaJ homolog subfamily C memb 0.845 0.707 0.421 4e-58
297839305 632 hypothetical protein ARALYDRAFT_339622 [ 0.814 0.675 0.416 1e-57
293334195604 hypothetical protein [Zea mays] gi|22403 0.946 0.821 0.351 5e-48
242083512609 hypothetical protein SORBIDRAFT_08g01562 0.954 0.821 0.348 9e-48
>gi|359481801|ref|XP_002278802.2| PREDICTED: dnaJ homolog subfamily C member 21-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  392 bits (1007), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 294/614 (47%), Positives = 365/614 (59%), Gaps = 109/614 (17%)

Query: 1   MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAY 60
           MASE RCLYEVLGL  + T DEIRSAYKKLALQRHPDKLV SGLS+A+ATAQFQEL++AY
Sbjct: 1   MASEGRCLYEVLGLTTDATADEIRSAYKKLALQRHPDKLVHSGLSKADATAQFQELLNAY 60

Query: 61  EVLSDPKERAWYDSHRSQILFSD------------------------------------- 83
           EVLS+P+ERAWYDSHRSQILFS+                                     
Sbjct: 61  EVLSNPEERAWYDSHRSQILFSNPTSSNGSVPNLFSFFSNSVYSGYDDTRKGFYKVYSEV 120

Query: 84  ----------------LNSASNCGPVPNLYSYFSN-TAFSGY-----------------S 109
                           L S      + NL S +S  TAF GY                  
Sbjct: 121 FDKIYATEVNFAKKLGLGSIKEAPMMGNLESPYSQVTAFYGYWIGFSTVMDFAWVDEYDV 180

Query: 110 DSGPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVKKNEEIERKR 169
            +GPNRKSRR+MEEEN+KLRKKAKREYNETVR LA FVK+RDKRV+DM VKK+ E E+++
Sbjct: 181 RAGPNRKSRRLMEEENRKLRKKAKREYNETVRGLAKFVKRRDKRVIDMQVKKSLEEEKRK 240

Query: 170 EEEKERK-KRLEKERMERAKRYEEPAWAR-IDDEGDNEVGNEEGLEEEEI---EKKRSEF 224
           EEEK RK +  E+ R+ERA+   EP W R ++D+     GN++  E E+     K+  EF
Sbjct: 241 EEEKTRKWEEFERGRLERARAKVEPEWVRAVEDD-----GNDDDWEFEDAGGGRKEEEEF 295

Query: 225 YCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDEDEVMAD-----FGELDGEVEEL 279
           YCVLC KKFKSEKQW NHE+SKKHKE VA+ RES  +EDE   D      G  D    EL
Sbjct: 296 YCVLCRKKFKSEKQWKNHEKSKKHKEWVAEFRESVKEEDERYGDAEAGIHGNGDQSEVEL 355

Query: 280 GERFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEV-NEVDDRFGKEDEDEDEDA 338
            E+F+D + +EE EI  G    S +E    E F V D     N  +   G         +
Sbjct: 356 QEQFEDGLELEEEEIEDGAQIESSNE----EEFVVGDVSHSGNGTNAELG---------S 402

Query: 339 DDEVNMLKAMLSGHKNRKR----VAVRKEDEVLKTEAHVENEIGESEFMEYDN-CKSTRR 393
           DDE+++L+AMLSGHKNRK     VA   E E   TEA V+    E +FMEYDN   S RR
Sbjct: 403 DDEMSVLEAMLSGHKNRKNGKTAVASVLEPESSVTEAPVDINNDEMDFMEYDNRKSSRRR 462

Query: 394 KNKKDRGKKSGGEAAKGDRD-GFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHS 452
           + KKD+GK+S GEA K D   G K   +E N   ++  I++SS++S   N+ +G  D+H+
Sbjct: 463 RGKKDKGKRSNGEAMKPDSSTGDKGGQDEQNSGSDASHIQDSSTYSVAENETDGKEDHHA 522

Query: 453 EKDPKIPDQPVDGKGTKK-DRKAKLKNSSKGNKTKTASKNS-SNVCEKCGQEFETRNKLH 510
           E + KIP QPV+ K T K +   K K S+K  K K A + +  N CE CG++FE+RNKLH
Sbjct: 523 ETN-KIPKQPVNRKATSKGEIDTKPKESNKVRKAKVAQRKALGNTCETCGEDFESRNKLH 581

Query: 511 KHLGDTGHASLKFR 524
           +HLGDTGHA L+ R
Sbjct: 582 QHLGDTGHAMLRAR 595

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255547203|ref|XP_002514659.1| conserved hypothetical protein [Ricinus communis] gi|223546263|gb|EEF47765.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449524982|ref|XP_004169500.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily C member 21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441091|ref|XP_004138317.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356511845|ref|XP_003524632.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Glycine max] Back     alignment and taxonomy information
>gi|15221189|ref|NP_177565.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|12324903|gb|AAG52405.1|AC020579_7 putative heat shock protein; 32627-30541 [Arabidopsis thaliana] gi|332197449|gb|AEE35570.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356562611|ref|XP_003549563.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Glycine max] Back     alignment and taxonomy information
>gi|297839305|ref|XP_002887534.1| hypothetical protein ARALYDRAFT_339622 [Arabidopsis lyrata subsp. lyrata] gi|297333375|gb|EFH63793.1| hypothetical protein ARALYDRAFT_339622 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|293334195|ref|NP_001169735.1| hypothetical protein [Zea mays] gi|224031273|gb|ACN34712.1| unknown [Zea mays] gi|413916444|gb|AFW56376.1| hypothetical protein ZEAMMB73_755634 [Zea mays] Back     alignment and taxonomy information
>gi|242083512|ref|XP_002442181.1| hypothetical protein SORBIDRAFT_08g015620 [Sorghum bicolor] gi|241942874|gb|EES16019.1| hypothetical protein SORBIDRAFT_08g015620 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query524
TAIR|locus:2019647630 AT1G74250 [Arabidopsis thalian 0.694 0.577 0.350 1.9e-91
DICTYBASE|DDB_G0286579 633 dnaja5 "DnaJ homolog subfamily 0.206 0.170 0.438 2.9e-39
UNIPROTKB|F1LPX6533 Dnajc21 "Protein Dnajc21" [Rat 0.192 0.189 0.447 2.3e-37
UNIPROTKB|Q0II91533 DNAJC21 "DnaJ homolog subfamil 0.192 0.189 0.447 3.8e-37
UNIPROTKB|G4N7F1548 MGG_03581 "Uncharacterized pro 0.171 0.164 0.479 4.4e-37
UNIPROTKB|F1SND3533 DNAJC21 "Uncharacterized prote 0.192 0.189 0.443 7.3e-37
UNIPROTKB|E2QZB7532 DNAJC21 "Uncharacterized prote 0.192 0.189 0.447 1.6e-36
UNIPROTKB|Q5F1R6531 DNAJC21 "DnaJ homolog subfamil 0.192 0.190 0.438 3.3e-35
SGD|S000005171590 JJJ1 "Co-chaperone that stimul 0.139 0.123 0.526 4.3e-35
FB|FBgn0027599540 CG2790 [Drosophila melanogaste 0.188 0.183 0.462 5.4e-28
TAIR|locus:2019647 AT1G74250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 512 (185.3 bits), Expect = 1.9e-91, Sum P(2) = 1.9e-91
 Identities = 137/391 (35%), Positives = 192/391 (49%)

Query:   112 GPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVXXXXXXXXXXXX 171
             GPNRKSRR+MEEENKK RKKAKREYN+TVR LA FVKKRDKRV+DM+V            
Sbjct:   195 GPNRKSRRMMEEENKKSRKKAKREYNDTVRGLAEFVKKRDKRVIDMLVKKNAEMEKKKEE 254

Query:   172 XXXXXXXXXXXXXXXXXXYEEPAWARXXXXXXXXXXXXXXXXXXXXXKKRSE-FYCVLCG 230
                               YEEP WA+                     K+++E  YC++C 
Sbjct:   255 ERERKKKMEKERLERAMNYEEPEWAKAHEGEDEGAGLSELEEEDDDAKRKNEQLYCIVCS 314

Query:   231 KKFKSEKQWTNHEQSKKHKEKVADLRESFVD------EDEVMADFXXXXXXXXXXXXRFK 284
             KKFKSEKQW NHEQSKKHKEKVA+LRESF D      E+E+                  +
Sbjct:   315 KKFKSEKQWKNHEQSKKHKEKVAELRESFTDYEEENEEEEIDGPLDSPESVEELHEKLQE 374

Query:   285 D-NVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKXXXXXXXXXXXXVN 343
             + N+  EER++   V G   DE  + E+F VA+       +D  G             + 
Sbjct:   375 ELNIDNEERDVKKEVVG-EADE-TDDEYF-VAE-------EDMQGSSESEDEDDE---MT 421

Query:   344 MLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKN--KKDRGK 401
             +LK M+SG KN+++  V KE++  +TE  +E +   +EF E+DN KST R    K++R K
Sbjct:   422 LLKKMVSGQKNKQKNVVSKEEDEDETEVEIEGDT--AEFSEFDNQKSTGRNKEAKEERNK 479

Query:   402 KSGGEAAKGDRDGFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQ 461
             ++ G     D    +   E  N   N    E +S       K+   S  +  +      +
Sbjct:   480 QNAGNDMADDTSKVQIPGEGGNPDENMNATESASGALADSQKDEANSMEYDNRK-STGRR 538

Query:   462 PVDGKGTKKDRKAKL-KNSSKGNKTKTASKN 491
                 KG  K+ + +L + SS+ + T+  +++
Sbjct:   539 RRSKKGKDKNNQGELNEKSSEADDTQYVNRD 569
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031072 "heat shock protein binding" evidence=IEA
DICTYBASE|DDB_G0286579 dnaja5 "DnaJ homolog subfamily A member 5" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPX6 Dnajc21 "Protein Dnajc21" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q0II91 DNAJC21 "DnaJ homolog subfamily C member 21" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G4N7F1 MGG_03581 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|F1SND3 DNAJC21 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZB7 DNAJC21 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F1R6 DNAJC21 "DnaJ homolog subfamily C member 21" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
SGD|S000005171 JJJ1 "Co-chaperone that stimulates the ATPase activity of Ssa1p" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
FB|FBgn0027599 CG2790 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00025651001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (570 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query524
pfam0022663 pfam00226, DnaJ, DnaJ domain 6e-19
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 7e-16
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 9e-16
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 5e-15
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 6e-14
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 6e-14
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 1e-13
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-13
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-13
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 3e-12
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 4e-12
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 5e-12
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 5e-12
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 6e-12
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 8e-12
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-11
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-11
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 3e-11
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 4e-11
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 4e-11
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 1e-10
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-10
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-10
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 7e-10
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 7e-10
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 8e-10
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-09
pfam1217127 pfam12171, zf-C2H2_jaz, Zinc-finger double-strande 3e-09
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 5e-09
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 8e-09
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 4e-08
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 4e-08
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 5e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 6e-08
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-07
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 4e-07
pfam1287425 pfam12874, zf-met, Zinc-finger of C2H2 type 4e-07
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 5e-06
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 7e-06
smart0045135 smart00451, ZnF_U1, U1-like zinc finger 1e-05
COG5407610 COG5407, SEC63, Preprotein translocase subunit Sec 1e-05
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 2e-05
pfam04147 809 pfam04147, Nop14, Nop14-like family 9e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.004
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 80.3 bits (199), Expect = 6e-19
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  CLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDP 66
            YE+LG+ ++ + +EI+ AY+KLAL+ HPDK          A  +F+E+  AYEVLSDP
Sbjct: 1  DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDP----AAEEKFKEINEAYEVLSDP 56

Query: 67 KERAWYD 73
          ++RA YD
Sbjct: 57 EKRAIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 524
KOG0717508 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.87
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.86
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.78
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.78
PRK14296372 chaperone protein DnaJ; Provisional 99.78
PRK14288369 chaperone protein DnaJ; Provisional 99.77
PRK14286372 chaperone protein DnaJ; Provisional 99.74
PTZ003411136 Ring-infected erythrocyte surface antigen; Provisi 99.73
PRK14287371 chaperone protein DnaJ; Provisional 99.73
PRK14298377 chaperone protein DnaJ; Provisional 99.72
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.71
PRK14282369 chaperone protein DnaJ; Provisional 99.71
PRK14276380 chaperone protein DnaJ; Provisional 99.71
PRK14297380 chaperone protein DnaJ; Provisional 99.7
PRK14277386 chaperone protein DnaJ; Provisional 99.7
PRK14285365 chaperone protein DnaJ; Provisional 99.7
PRK14278378 chaperone protein DnaJ; Provisional 99.7
PRK14294366 chaperone protein DnaJ; Provisional 99.69
PRK14280376 chaperone protein DnaJ; Provisional 99.69
PRK10767371 chaperone protein DnaJ; Provisional 99.69
PRK14279392 chaperone protein DnaJ; Provisional 99.69
PRK14283378 chaperone protein DnaJ; Provisional 99.68
PRK14301373 chaperone protein DnaJ; Provisional 99.68
PRK14299291 chaperone protein DnaJ; Provisional 99.67
KOG0718546 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
PRK14295389 chaperone protein DnaJ; Provisional 99.67
PRK14290365 chaperone protein DnaJ; Provisional 99.66
PRK14291382 chaperone protein DnaJ; Provisional 99.66
PRK14281397 chaperone protein DnaJ; Provisional 99.66
PRK14284391 chaperone protein DnaJ; Provisional 99.66
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.65
PRK14289386 chaperone protein DnaJ; Provisional 99.64
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.64
PRK14300372 chaperone protein DnaJ; Provisional 99.63
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.62
PRK14292371 chaperone protein DnaJ; Provisional 99.62
PRK14293374 chaperone protein DnaJ; Provisional 99.61
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.59
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.55
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.54
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.52
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.5
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.48
PHA03102153 Small T antigen; Reviewed 99.43
PRK01356166 hscB co-chaperone HscB; Provisional 99.4
PRK05014171 hscB co-chaperone HscB; Provisional 99.38
PRK03578176 hscB co-chaperone HscB; Provisional 99.37
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.35
PRK00294173 hscB co-chaperone HscB; Provisional 99.28
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.28
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.24
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.24
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.13
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.08
PTZ00100116 DnaJ chaperone protein; Provisional 99.03
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.98
PRK01773173 hscB co-chaperone HscB; Provisional 98.94
PHA02624 647 large T antigen; Provisional 98.94
COG5407610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.8
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.77
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 98.5
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 98.14
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 98.03
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.82
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.77
KOG3408129 consensus U1-like Zn-finger-containing protein, pr 97.65
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.15
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 97.07
COG5112126 UFD2 U1-like Zn-finger-containing protein [General 96.63
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 96.54
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.52
KOG0431453 consensus Auxilin-like protein and related protein 96.13
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.61
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 95.5
KOG0724335 consensus Zuotin and related molecular chaperones 95.4
PLN02748468 tRNA dimethylallyltransferase 95.25
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.94
KOG4727193 consensus U1-like Zn-finger protein [General funct 94.66
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 94.31
COG5188470 PRP9 Splicing factor 3a, subunit 3 [RNA processing 94.04
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 94.02
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 92.05
KOG3032264 consensus Uncharacterized conserved protein [Funct 91.7
smart0035526 ZnF_C2H2 zinc finger. 90.9
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 90.43
KOG2837309 consensus Protein containing a U1-type Zn-finger a 88.67
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 86.95
PF0753549 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc 86.75
PHA0276855 hypothetical protein; Provisional 86.21
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 85.02
smart0058649 ZnF_DBF Zinc finger in DBF-like proteins. 84.82
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 84.04
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 82.43
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 80.89
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-68  Score=556.14  Aligned_cols=412  Identities=38%  Similarity=0.551  Sum_probs=293.8

Q ss_pred             CCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCcCCCCCChHHHHHHHHHHHHHHHHhcCchhhhhhhhhcchhhccC
Q 009836            4 EKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSD   83 (524)
Q Consensus         4 ~~~d~YevLGV~~~As~~eIKkAYRkLalk~HPDKn~~~~~~~~eA~e~F~~I~~AYevLsDp~kR~~YD~~~~~~l~~~   83 (524)
                      .++|||+||||.++|++.+||++||+|||+||||||+   ...++|+++|+.|+.||+|||||+.|+|||+|+.+||++.
T Consensus         6 ~~~c~YE~L~v~~~a~d~eik~~YRklALq~HPDknp---d~ieeat~~F~~i~aAYeVLSdp~eR~wyd~hreqil~~~   82 (508)
T KOG0717|consen    6 KKRCYYEVLGVERDADDDEIKKNYRKLALQYHPDKNP---DRIEEATQQFQLIQAAYEVLSDPQERAWYDSHREQILRGK   82 (508)
T ss_pred             hhhHHHHHhcccccCCHHHHHHHHHHHHHhhCCCCCC---ccHHHHHHHHHHHHHHHHHhcChHhhhhHHHHHHHHhcCC
Confidence            5789999999999999999999999999999999983   2688999999999999999999999999999999999987


Q ss_pred             CCCCCCCCCCCccccccCCCCCCCCCCC----------------------------------------------------
Q 009836           84 LNSASNCGPVPNLYSYFSNTAFSGYSDS----------------------------------------------------  111 (524)
Q Consensus        84 ~~~~~~~~~~~dlf~ff~~~~F~gf~d~----------------------------------------------------  111 (524)
                      ....  +..++++|.||+.++|.||.++                                                    
T Consensus        83 ~s~~--~~~~~dlf~ff~~~~y~gy~~~~~gfy~vy~dvf~~~~~~e~~~~~d~~~~ap~fg~~~t~ye~~~~fY~~W~a  160 (508)
T KOG0717|consen   83 NSDT--GVQIEDLFQFFTSSCYIGYENTSAGFYRVYQDVFNALASDELPFLGDSKLLYPLFGYSTTDYEQVVPFYQFWLA  160 (508)
T ss_pred             CCcc--ccchHHHHHHhhhhhhcccccccchhHHHHHHHHHHHhhhhhhhccCCccccccccCCCCcHHHHHHHHHHHHh
Confidence            6532  5677899999999998888655                                                    


Q ss_pred             -----------------CCCcccchhhHHHhHHHHHHHHHHHHHHHHHHHHHHHhhCHHHHhHHHHhHHHHHHHHHHHHH
Q 009836          112 -----------------GPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVKKNEEIERKREEEKE  174 (524)
Q Consensus       112 -----------------a~~R~~RR~mEkeNkk~r~k~rkeyn~~IR~Lve~~kkrDpRv~~~~~k~~~eeerkk~Ee~~  174 (524)
                                       +.+|..+|+|+++|+++|...+++||.+||.||.||++|||||+.++.++..+.++.+.++.+
T Consensus       161 fsT~Ksf~W~d~Ydv~~~~~r~~~R~v~~enkk~rq~ak~eyNe~Vr~lv~fvkKrDpRvk~~l~~k~~E~~r~kqe~~R  240 (508)
T KOG0717|consen  161 FSTKKSFEWLDEYDVEEESDRFTRRLMERENKKQRQYARQEYNETVRNLVGFVKKRDPRVKAMLELKDAEAYRSKQEESR  240 (508)
T ss_pred             hhhhhhHHhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCHHHHHHHHHHHHHHHHHHHHHHH
Confidence                             778999999999999999999999999999999999999999999777766666654444433


Q ss_pred             HHHHHHHHHHH---HHhhhcchhhhhhccccCcccCCcccchHHH-HhhhccccccccccccccCHHHHHHhhhhHHHHH
Q 009836          175 RKKRLEKERME---RAKRYEEPAWARIDDEGDNEVGNEEGLEEEE-IEKKRSEFYCVLCGKKFKSEKQWTNHEQSKKHKE  250 (524)
Q Consensus       175 rk~~~ek~r~e---ra~~~~e~~w~~~~eee~~~~~~~~~~~ee~-~e~~~~~~~C~~C~K~F~s~~~~~nH~~SkKHk~  250 (524)
                      +. +...+++.   +...+....|+...+.++.+....++..+.+ .+...+.+||+||+|+|+|++||+||++||||++
T Consensus       241 k~-~~~~r~e~~e~r~n~~e~~~~~~~~e~ed~~e~~~d~~~e~de~d~~ge~lyC~vCnKsFKseKq~kNHEnSKKHke  319 (508)
T KOG0717|consen  241 KQ-QLRKRREYAETRKNNGEGSEEALKEEIEDELEKSSDDETESDEADNEGEVLYCVVCNKSFKSEKQLKNHENSKKHKE  319 (508)
T ss_pred             HH-HHHHHHHHHHHHHhcccchHHHHHHHHHhhhhhccccchhhhhhhhcCCceEEeeccccccchHHHHhhHHHHHHHH
Confidence            33 22222222   2222222334433333333222222222222 2344555999999999999999999999999999


Q ss_pred             HHHHHHHHhhhhhhhhhccCCCchhHHHHHHHhhhcccchhhhhcCCCCCCCCCCcccccccccccCccccccccccCCC
Q 009836          251 KVADLRESFVDEDEVMADFGELDGEVEELGERFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKE  330 (524)
Q Consensus       251 ~~~~l~~~~~~e~~~~~~~~~~e~~~~~l~e~l~~~le~~~~e~ek~~~~~s~~~~~ere~~~~~~~~e~~~~dd~~~~~  330 (524)
                      +|.+|+++|.+|++        +..          .+.+.+.               +.+.|..        .   +..+
T Consensus       320 nv~eLrqemEEEe~--------d~~----------~~qaee~---------------e~e~~se--------e---e~~~  355 (508)
T KOG0717|consen  320 NVAELRQEMEEEEE--------DEA----------QGQAEEN---------------ELEDFSE--------E---EPED  355 (508)
T ss_pred             HHHHHHHHHHHhhh--------hhh----------hhccccc---------------hhhhhhh--------h---cccc
Confidence            99999999987752        000          0001000               1122211        1   1113


Q ss_pred             CCCCCchhhhHHHHHHHHhcccccccccccccccccccccccccccCCCccccccccchhhhhhhhhhcCCCCCCCCCCC
Q 009836          331 DEDEDEDADDEVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKNKKDRGKKSGGEAAKG  410 (524)
Q Consensus       331 d~~~~ed~ddE~~~l~~m~s~~k~rk~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~n~k~~~~~r~~~k~~~~~~~~~~~  410 (524)
                      +.+.+++...+..-.+-|+|+..|-+.....-...+-+.++  +.+.+..++.++++.|.++..+..|--.     .+++
T Consensus       356 d~ses~~~n~~~~~~k~~~s~d~n~~~n~~~E~~d~~~e~~--e~d~dtae~ee~d~qk~~~~~k~~K~~~-----D~k~  428 (508)
T KOG0717|consen  356 DPSESEYKNKEKDRDKKNVSFDENEKVNTFAEISDEDFEPA--EEDGDTAESEEFDQQKNKSVNKKIKPCD-----DKKD  428 (508)
T ss_pred             CCCCCchhhhHhhhhhcccchhhhhhhccccccccCCCccc--ccccccccchhhccccccchhhhccccc-----cchh
Confidence            33445567788899999999999988877665555544444  5555666778889999988777655111     3444


Q ss_pred             CCCCCCCCCccCCCCCCCCccccCCccccccccCCCCCCCCCCCCCCCCCCCCCCCCcccchhhhhcccCCCCccccccc
Q 009836          411 DRDGFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQPVDGKGTKKDRKAKLKNSSKGNKTKTASK  490 (524)
Q Consensus       411 ~~~~~~~~~~~~~~~~n~~~~e~~s~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~~~~k~~~kg~k~k~~~~  490 (524)
                      ++..++.+....+...+..++.+||+                                                   ...
T Consensus       429 ~a~kvk~pk~~~~kd~~k~a~~~p~~---------------------------------------------------~~p  457 (508)
T KOG0717|consen  429 EAKKVKKPKGKVTKDNKKPATVAPSS---------------------------------------------------QTP  457 (508)
T ss_pred             hhhhccCCCCCCCCccCCCccCCCCC---------------------------------------------------CCc
Confidence            44455533322222222223333332                                                   122


Q ss_pred             cCCchhhhcccccchhhhhhhhhcCCCCccccc
Q 009836          491 NSSNVCEKCGQEFETRNKLHKHLGDTGHASLKF  523 (524)
Q Consensus       491 ~~~~~c~~c~~~f~sr~kl~~hl~~~gh~~~k~  523 (524)
                      .+-.+|.||+..|+||||||.||..||||++..
T Consensus       458 sa~~~C~tCr~~FdSRnkLF~Hlk~tgHa~~~~  490 (508)
T KOG0717|consen  458 SALISCTTCRESFDSRNKLFAHLKKTGHARLPS  490 (508)
T ss_pred             chhHhhhhhhhhccchhHHHHHhhhcCCeeccc
Confidence            245899999999999999999999999999864

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4727 consensus U1-like Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG3032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2837 consensus Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing [RNA processing and modification] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query524
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 6e-10
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 7e-10
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-10
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-09
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-08
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 1e-08
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-08
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-08
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 4e-08
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 3e-07
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 4e-07
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 5e-07
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 8e-07
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-06
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-06
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 5e-06
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 7e-06
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-05
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-05
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 4e-05
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 1e-04
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 4/71 (5%)
Query: 5  KRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLS 64
          K+  YE+LG+ K     EIR AYK+LA++ HPD+         EA A+F+E+  AYEVL+
Sbjct: 2  KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDR----NQGDKEAEAKFKEIKEAYEVLT 57
Query: 65 DPKERAWYDSH 75
          D ++RA YD +
Sbjct: 58 DSQKRAAYDQY 68
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query524
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 7e-19
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 4e-18
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 1e-16
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 1e-16
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-16
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-16
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-16
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-16
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 5e-16
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 5e-16
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 5e-16
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 6e-16
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 9e-16
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-15
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-15
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-15
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-15
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 4e-15
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 4e-15
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 4e-15
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 3e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-14
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 2e-13
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-13
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-12
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-09
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-08
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-07
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 3e-07
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 3e-07
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 5e-06
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 6e-06
3iyl_X 1214 VP3; non-enveloped virus, membrane penetration pro 9e-06
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 1e-05
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 2e-05
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-05
2guz_A71 Mitochondrial import inner membrane translocase su 2e-04
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
 Score = 82.6 bits (204), Expect = 7e-19
 Identities = 24/109 (22%), Positives = 42/109 (38%), Gaps = 5/109 (4%)

Query: 3   SEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKL--VQSGLSQAEATAQFQELVHAY 60
             K+  Y +LG        +++  Y+KL L  HPDK        +  E   +F E+  A+
Sbjct: 7   MPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAW 66

Query: 61  EVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGYS 109
           ++L + + +  YD  R +    DL +         L     N     + 
Sbjct: 67  KILGNEETKREYDLQRCE---DDLRNVGPVDAQVYLEEMSWNEGDHSFY 112
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>3iyl_X VP3; non-enveloped virus, membrane penetration protein, autocleav myristol group, icosahedral virus; HET: MYR; 3.30A {Grass carp reovirus} PDB: 3k1q_C 3k1q_B Length = 1214 Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Length = 402 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Length = 124 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query524
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.78
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.78
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.78
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.78
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.77
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.76
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.76
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.76
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.75
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.75
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.74
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.73
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.73
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.73
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.72
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.69
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.66
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.66
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.64
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.63
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.6
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.59
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.58
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.57
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.56
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.55
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.55
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.53
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.52
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.52
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.49
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.47
2guz_A71 Mitochondrial import inner membrane translocase su 99.45
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.87
2guz_B65 Mitochondrial import inner membrane translocase su 98.42
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 98.06
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 97.66
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.49
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.66
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 96.61
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 94.94
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 93.67
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 93.13
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 93.01
1ard_A29 Yeast transcription factor ADR1; transcription reg 93.01
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 92.48
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 92.09
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 92.06
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 91.97
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 91.97
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 91.94
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 91.17
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.85
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.77
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.74
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.61
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.6
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 91.49
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 91.47
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 91.33
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.04
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.94
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 90.01
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 90.35
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 89.79
1paa_A30 Yeast transcription factor ADR1; transcription reg 90.18
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 90.07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 90.06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.05
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.03
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 89.94
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.62
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.53
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 89.52
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.5
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.5
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 89.49
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 89.43
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.41
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.37
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 89.21
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.19
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.19
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 89.19
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.18
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.16
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 89.06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 89.05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.99
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 88.98
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 88.93
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 88.91
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.88
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.88
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 88.86
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.84
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.83
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.83
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.78
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.77
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.72
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.62
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 88.6
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.58
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.56
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.55
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 88.53
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.52
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 88.52
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.48
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.48
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 88.47
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 88.46
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 88.45
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.43
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 88.41
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 88.41
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.38
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.38
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 88.29
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 88.25
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.23
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.21
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.19
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 88.15
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 88.0
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 87.96
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 87.93
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 87.92
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 87.89
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.84
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.82
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.8
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 87.79
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 87.79
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.78
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.78
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.77
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.74
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 87.7
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 87.65
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 87.63
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 87.61
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 87.56
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.53
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 87.47
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 87.43
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 87.37
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 87.33
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 87.31
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 87.3
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 87.26
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.22
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.16
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 87.01
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 86.99
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.98
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.98
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 86.94
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 86.61
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 86.55
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 86.44
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 86.43
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 86.42
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 86.38
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 86.21
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 86.19
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.12
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 85.89
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 85.72
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 85.72
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 85.35
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.79
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 84.62
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 84.36
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 84.17
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 83.83
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 83.62
1ard_A29 Yeast transcription factor ADR1; transcription reg 83.46
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 83.19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 83.18
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 83.14
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 82.69
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 82.62
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 82.47
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 82.34
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 82.31
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 82.26
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 82.16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 81.97
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 81.69
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 81.49
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 81.26
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 81.14
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 80.9
2lv2_A85 Insulinoma-associated protein 1; structural genomi 80.65
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 81.45
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 80.28
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 80.19
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 80.14
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.78  E-value=3e-19  Score=150.30  Aligned_cols=76  Identities=36%  Similarity=0.609  Sum_probs=68.8

Q ss_pred             CCCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCcCCCCCChHHHHHHHHHHHHHHHHhcCchhhhhhhhhcchhhcc
Q 009836            3 SEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFS   82 (524)
Q Consensus         3 s~~~d~YevLGV~~~As~~eIKkAYRkLalk~HPDKn~~~~~~~~eA~e~F~~I~~AYevLsDp~kR~~YD~~~~~~l~~   82 (524)
                      ....+||+||||+++|+..+||+|||+|+++||||++.     .+.+.+.|+.|+.||+||+||..|..||..+..++.+
T Consensus         4 ~~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~-----~~~a~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~~~   78 (88)
T 2ctr_A            4 GSSGSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNK-----SPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTS   78 (88)
T ss_dssp             CCCCSHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCC-----SHHHHHHHHHHHHHHHHHHSSHHHHHHHHTCHHHHTC
T ss_pred             CCCCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCC-----ChHHHHHHHHHHHHHHHHCCHHHHHHHHHhCcccccc
Confidence            35678999999999999999999999999999999992     3568999999999999999999999999999877654


Q ss_pred             C
Q 009836           83 D   83 (524)
Q Consensus        83 ~   83 (524)
                      .
T Consensus        79 ~   79 (88)
T 2ctr_A           79 G   79 (88)
T ss_dssp             S
T ss_pred             C
Confidence            4
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 524
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-13
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 9e-12
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 4e-11
d1zr9a167 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 5e-10
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 5e-10
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-09
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-09
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 5e-08
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 5e-06
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 64.7 bits (157), Expect = 1e-13
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 2/77 (2%)

Query: 3  SEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLV--QSGLSQAEATAQFQELVHAY 60
          + K+  Y +LG        +++  Y+KL L  HPDK        +  E   +F E+  A+
Sbjct: 13 TLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAW 72

Query: 61 EVLSDPKERAWYDSHRS 77
          ++L + + +  YD  RS
Sbjct: 73 KILGNEETKKKYDLQRS 89
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query524
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.83
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.76
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.71
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.61
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.58
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.57
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.53
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 99.07
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 96.25
d1zu1a172 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 95.11
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.29
d2vrda161 Spliceosomal protein U1C {Human (Homo sapiens) [Ta 93.71
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.24
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 93.2
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 92.84
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 92.47
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 92.08
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 92.02
d2cota238 Zinc finger and SCAN domain-containing protein 16, 91.61
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 90.78
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 90.46
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 90.34
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 90.22
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.38
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 89.33
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 89.06
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.33
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 88.31
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 86.18
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 85.08
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 84.44
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 83.18
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 82.97
d1fu9a_36 U-shaped transcription factor, different fingers { 81.71
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 81.65
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 81.07
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 80.81
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.83  E-value=2.4e-21  Score=157.30  Aligned_cols=72  Identities=44%  Similarity=0.696  Sum_probs=64.9

Q ss_pred             CCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCcCCCCCChHHHHHHHHHHHHHHHHhcCchhhhhhhhhcchh
Q 009836            4 EKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQI   79 (524)
Q Consensus         4 ~~~d~YevLGV~~~As~~eIKkAYRkLalk~HPDKn~~~~~~~~eA~e~F~~I~~AYevLsDp~kR~~YD~~~~~~   79 (524)
                      +++|||+||||+++||..+||+|||+|+++||||+++.    .+.+...|..|+.||+||+||.+|..||.+|..+
T Consensus         1 ak~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~----~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~   72 (75)
T d1xbla_           1 AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQG----DKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA   72 (75)
T ss_dssp             CCCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTT----TCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred             CCCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCC----ChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence            36899999999999999999999999999999999832    3467889999999999999999999999987643
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure