Citrus Sinensis ID: 009870

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520---

MQTYVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSGKHAELWGAQKANNNQNNLPNQFKNMQLDNGKGGNNNNNNNKGQKGGNNNNNNNNPPKGGGGGGGQQPNAQQQLQQQLQHLQQIKGFQDLKLPPHFKDMKLPSMPNQSQNQKAVKFNIPDDDEDFSDDEFDYDDEYDDEYDDDLDEPLPPLNKMKPITGNGGPPGMMPNNMMMMNGINPLMNGINPQLMNAQKGAPIPAQNAKKGGNGGPMPVQVNMANNEGKNGNGGKKGGLGGGGGGGGGGGGNQNGANNQNQGGKNGKNGGGQNGNNGGGGGGGANNKNGNNGGGANGHNMNGNGGKKGNGGPNPMGDMNGGFQNMGGAAAAMAAANAKMGQMPMGQMGSMPMGQMGNVPAVQGLPAAAMNGGAGGGAGYFQGAGPDLMPGNPYHQQQQQQYMAAAMMNQQRAIGNERFQPMMYARPPPAVNYMPQHPYPPYPYPQHPYPPQDPGYTHFFSDENTSSCNVM

ccEEEEEEEEccHHHHHHHHHHHcccccEEEEEEccccccEEEEEEccHHHHHHHHHHccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccEEEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccEEEEEEEccHHHHHHHHHHccccEEEcccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccHccccccHHHHcccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

MQTYVLKVNIHCDGCKHKVKKILQKIDGVFttsidseqgkvtvsgnvdPSVLIKKLAKSGKHAELWGaqkannnqnnlpnqfknmqldngkggnnnnnnnkgqkggnnnnnnnnppkgggggggqqpnAQQQLQQQLQHLQQIkgfqdlklpphfkdmklpsmpnqsqnqkavkfnipdddedfsddefdyddeyddeydddldeplpplnkmkpitgnggppgmmpnnmmmmnginplmnginpqlmnaqkgapipaqnakkggnggpmpvqvnmannegkngnggkkgglggggggggggggnqngannqnqggkngkngggqngnngggggggannkngnnggganghnmngnggkkgnggpnpmgdmnggfqnMGGAAAAMAAANAKmgqmpmgqmgsmpmgqmgnvpavqglpaaamnggagggagyfqgagpdlmpgnpyhqqQQQQYMAAAMMNQQRAignerfqpmmyarpppavnympqhpyppypypqhpyppqdpgythffsdentsscnvm

MQTYVLKVnihcdgckhKVKKILQKIDGVFTtsidseqgkvtvsgnvdpSVLIKKLAKSGKHAELWGAQKannnqnnlpNQFKNMQLDNGKGGNNNNNNNKGQKGGNNNNNNNNPPKGGGGGGGQQPNAQQQLQQQLQHLQQIKGFQDLKLPPHFKDMKLPSMPNQSQNQKAVKFnipdddedfsdDEFDYDDEYDDEYDDDLDEPLPPLNKMKPITGNGGPPGMMPNNMMMMNGINPLMNGINPQLMNAQKGAPIPAQNAKKGGNGGPMPVQVNMANNEGKNGNGGKKGGLGGGGGGGGGGGGNQNGANNQNQGGKNGKNGGGQNGNNGGGGGGGANNKNGNNGGGANGHNMNGNGGKKGNGGPNPMGDMNGGFQNMGGAAAAMAAANAKMGQMPMGQMGSMPMGQMGNVPAVQGLPAAAMNGGAGGGAGYFQGAGPDLMPGNPYHQQQQQQYMAAAMMNQQRAIGNERFQPMMYARPPPAVNYMPQHPYPPYPYPQHPYPPQDPGYTHFFSDENTSSCNVM

MQTYVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSGKHAELWGaqkannnqnnlpnqfknMqldngkggnnnnnnnkgqkggnnnnnnnnppkgggggggqqpnaqqqlqqqlqhlqqIKGFQDLKLPPHFKDMKLPSMPNQSQNQKAVKFNIPdddedfsddefdyddeyddeydddldeplpplNKMKpitgnggppgmmpnnmmmmnginplmnginpQLMNAQKGAPIPAQNAKKGGNGGPMPVQVnmannegkngnggkkgglggggggggggggnqngannqnqggkngkngggqngnngggggggannkngnnggganghnmngnggkkgnggpnpmgdmnggfqnmggaaaamaaanakmgqmpmgqmgsmpmgqmgNVPAVQglpaaamnggagggagyfqgagPDLMPGNPYHqqqqqqymaaammnqqRAIGNERFQPMMYARPPPAVNYMpqhpyppypypqhpyppqDPGYTHFFSDENTSSCNVM

***YVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKL***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************

MQTYVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSGKH*************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YTHFFSDENTSSC***

MQTYVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSGKHAELWGAQKANNNQNNLPNQFKNMQLDNGKGGNNNNNNNKGQKGGNNNNNNNNPPK*********************HLQQIKGFQDLKLPPHFKDMKLPSMPNQSQNQKAVKFNIPDDDEDFSDDEFDYDDEYDDEYDDDLDEPLPPLNKMKPITGNGGPPGMMPNNMMMMNGINPLMNGINPQLMNAQKGAPIPAQNAKKGGNGGPMPVQVNMANNEGKNGNGGKKGGLGGGGGGGGGGGGNQNGANNQNQGGKNGKNGGGQNGNNGGGGGGGANNKNGNNGGGANGHNMNGNGGKKGNGGPNPMGDMNGGFQNMGGAAAAMAAANAKMGQMPMGQMGSMPMGQMGNVPAVQGLPAAAMNGGAGGGAGYFQGAGPDLMPGNPYHQQQQQQYMAAAMMNQQRAIGNERFQPMMYARPPPAVNYMPQHPYPPYPYPQHPYPPQDPGYTHFFSDE********

MQTYVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSGKHAELWGAQK***********************************************************QQQLQQQLQHLQQIKGFQDLKLPPHFKDMKLPSMPNQ***QKAVKFNIPDDDEDFSDDEFDYDDEYDDEYDDDLDEPLPPLNKMKPITGNGGPPGMMPNNMMMMNGINPLMNGINPQLMNAQKGAPIPAQN*****NGGPMPVQVNMANNEGK***************************************************G********************************PMGDMNGGFQNMGGAAAAMAAANAKMGQMPMGQMGSMPMGQMGNVPAVQGLPAAAMNGGAGGGAGYFQGAGPDLMPGNPYHQQQQQQYMAAAMMNQQRAIGNERFQPMMYARPPPAVNYMPQHPYPPYPYPQHPYPPQDPGYTHFFS**********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		523
297833356		445	hypothetical protein ARALYDRAFT_477915 [	0.323	0.379	0.609	2e-41
356504058		467	PREDICTED: uncharacterized protein LOC10	0.841	0.942	0.357	4e-41
255552225		526	chloroplast-targeted copper chaperone, p	0.449	0.446	0.597	1e-40
356546434		503	PREDICTED: uncharacterized protein LOC10	0.326	0.339	0.705	3e-38
334185123		349	heavy-metal-associated domain-containing	0.319	0.478	0.578	5e-38
18397481		473	heavy-metal-associated domain-containing	0.319	0.353	0.589	8e-38
356571127		456	PREDICTED: uncharacterized protein LOC10	0.351	0.403	0.457	1e-37
449527566		502	PREDICTED: uncharacterized LOC101203695	0.420	0.438	0.550	2e-37
449433343		500	PREDICTED: uncharacterized protein LOC10	0.420	0.44	0.550	2e-37
356563547		499	PREDICTED: uncharacterized protein LOC10	0.325	0.340	0.562	2e-36

>gi\|297833356\|ref\|XP_002884560.1\| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata] gi\|297330400\|gb\|EFH60819.1\| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

 Score =  177 bits (448), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 111/182 (60%), Positives = 127/182 (69%), Gaps = 13/182 (7%)

Query: 1   MQTYVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSG 60
           +QT VLKVNIHCDGCK KVKKILQKI+GVFTT IDSEQGKVTVSG+VDPSVLIKKLAKSG
Sbjct: 9   IQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPSVLIKKLAKSG 68

Query: 61  KHAELWGAQKANN--NQNNLPNQFKNMQLDNGKGGNNNNNNNKGQKGGNNNNNNNNPPKG 118
           KHAE+WGA K NN  NQ+ + NQFK MQ+DNGKG       N         +        
Sbjct: 69  KHAEIWGAPKGNNNPNQSQMANQFKGMQIDNGKGAGGGGGGNNNNNKKGQKSGGGG---- 124

Query: 119 GGGGGGQQPNAQQQLQ-QQLQHLQQIKGFQDLKLPPHFKDMKLPSMP-NQSQNQKAVKFN 176
            GGG    P   QQL  Q +Q LQ++KGFQDLKLPP  K     S+P N++QNQK VKF+
Sbjct: 125 -GGGNSNAPKMGQQLNPQHMQQLQKMKGFQDLKLPPQLKG----SVPVNKNQNQKGVKFD 179

Query: 177 IP 178
           +P
Sbjct: 180 VP 181

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356504058\|ref\|XP_003520816.1\| PREDICTED: uncharacterized protein LOC100783289 [Glycine max]	Back alignment and taxonomy information

>gi\|255552225\|ref\|XP_002517157.1\| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi\|223543792\|gb\|EEF45320.1\| chloroplast-targeted copper chaperone, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356546434\|ref\|XP_003541631.1\| PREDICTED: uncharacterized protein LOC100811318 [Glycine max]	Back alignment and taxonomy information

>gi\|334185123\|ref\|NP_001189822.1\| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi\|332640828\|gb\|AEE74349.1\| heavy-metal-associated domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|18397481|ref|NP_566273.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|6862917|gb|AAF30306.1|AC018907_6 hypothetical protein [Arabidopsis thaliana] gi|11908104|gb|AAG41481.1|AF326899_1 unknown protein [Arabidopsis thaliana] gi|13194808|gb|AAK15566.1|AF349519_1 unknown protein [Arabidopsis thaliana] gi|15010768|gb|AAK74043.1| AT3g06130/F28L1_7 [Arabidopsis thaliana] gi|23506209|gb|AAN31116.1| At3g06130/F28L1_7 [Arabidopsis thaliana] gi|332640827|gb|AEE74348.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356571127\|ref\|XP_003553732.1\| PREDICTED: uncharacterized protein LOC100811813 [Glycine max]	Back alignment and taxonomy information

>gi\|449527566\|ref\|XP_004170781.1\| PREDICTED: uncharacterized LOC101203695 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449433343\|ref\|XP_004134457.1\| PREDICTED: uncharacterized protein LOC101203695 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356563547\|ref\|XP_003550023.1\| PREDICTED: uncharacterized protein LOC100777182 [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		523
TAIR\|locus:2082425		473	AT3G06130 [Arabidopsis thalian	0.128	0.141	0.895	1.5e-56
TAIR\|locus:2179604		587	AT5G19090 [Arabidopsis thalian	0.128	0.114	0.865	8.2e-54
TAIR\|locus:2096204		577	AT3G05220 [Arabidopsis thalian	0.128	0.116	0.686	1.9e-33
TAIR\|locus:2017709		358	AT1G23000 "AT1G23000" [Arabido	0.126	0.184	0.621	3.1e-23
TAIR\|locus:2180265		352	AT5G27690 [Arabidopsis thalian	0.122	0.181	0.687	1.9e-21
TAIR\|locus:2153794		262	AT5G37860 "AT5G37860" [Arabido	0.124	0.248	0.6	1.2e-17
TAIR\|locus:2011841		364	AT1G56210 [Arabidopsis thalian	0.112	0.162	0.627	1.9e-17
TAIR\|locus:2135277		158	AT4G39700 [Arabidopsis thalian	0.124	0.411	0.492	2.9e-17
TAIR\|locus:2026336		152	HIPP20 "heavy metal associated	0.126	0.434	0.409	3.5e-15
TAIR\|locus:2202265		159	AT1G06330 "AT1G06330" [Arabido	0.126	0.415	0.454	7.2e-15

TAIR\|locus:2082425 AT3G06130 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 314 (115.6 bits), Expect = 1.5e-56, Sum P(4) = 1.5e-56
 Identities = 60/67 (89%), Positives = 64/67 (95%)

Query:     1 MQTYVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSG 60
             +QT VLKVNIHCDGCK KVKKILQKI+GVFTT IDSEQGKVTVSG+VDPSVLIKKLAKSG
Sbjct:     9 IQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPSVLIKKLAKSG 68

Query:    61 KHAELWG 67
             KHAE+WG
Sbjct:    69 KHAEIWG 75

GO:0005737 "cytoplasm" evidence=ISM

GO:0030001 "metal ion transport" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

GO:0005618 "cell wall" evidence=IDA

TAIR\|locus:2179604 AT5G19090 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2096204 AT3G05220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2017709 AT1G23000 "AT1G23000" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2180265 AT5G27690 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153794 AT5G37860 "AT5G37860" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2011841 AT1G56210 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2135277 AT4G39700 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2026336 HIPP20 "heavy metal associated isoprenylated plant protein 20" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2202265 AT1G06330 "AT1G06330" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh2_kg.3__616__AT3G06130.1	annotation not avaliable (445 aa)
		(Arabidopsis lyrata)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		523
pfam00403		62	pfam00403, HMA, Heavy-metal-associated domain	3e-14
cd00371		63	cd00371, HMA, Heavy-metal-associated domain (HMA)	3e-13
COG2608		71	COG2608, CopZ, Copper chaperone [Inorganic ion tra	1e-10
PTZ00146		293	PTZ00146, PTZ00146, fibrillarin; Provisional	9e-07
PTZ00146		293	PTZ00146, PTZ00146, fibrillarin; Provisional	2e-06
pfam12810		248	pfam12810, Gly_rich, Glycine rich protein	5e-06
PTZ00146		293	PTZ00146, PTZ00146, fibrillarin; Provisional	6e-06
PHA00370		297	PHA00370, III, attachment protein	8e-05
PRK07772		186	PRK07772, PRK07772, single-stranded DNA-binding pr	2e-04
PRK06958		182	PRK06958, PRK06958, single-stranded DNA-binding pr	3e-04
TIGR01628		562	TIGR01628, PABP-1234, polyadenylate binding protei	5e-04
PRK02363		129	PRK02363, PRK02363, DNA-directed RNA polymerase su	5e-04
PRK06958		182	PRK06958, PRK06958, single-stranded DNA-binding pr	6e-04
pfam05764		238	pfam05764, YL1, YL1 nuclear protein	6e-04
pfam09770		804	pfam09770, PAT1, Topoisomerase II-associated prote	7e-04
pfam09770		804	pfam09770, PAT1, Topoisomerase II-associated prote	0.001
TIGR02052		92	TIGR02052, MerP, mercuric transport protein peripl	0.001
PRK07772		186	PRK07772, PRK07772, single-stranded DNA-binding pr	0.002
TIGR01628		562	TIGR01628, PABP-1234, polyadenylate binding protei	0.002
COG3846		452	COG3846, TrbL, Type IV secretory pathway, TrbL com	0.002
pfam06682		317	pfam06682, DUF1183, Protein of unknown function (D	0.002
PTZ00146		293	PTZ00146, PTZ00146, fibrillarin; Provisional	0.003
PTZ00146		293	PTZ00146, PTZ00146, fibrillarin; Provisional	0.003
COG5271		4600	COG5271, MDN1, AAA ATPase containing von Willebran	0.003
PRK10590		456	PRK10590, PRK10590, ATP-dependent RNA helicase Rhl	0.003
pfam09606		768	pfam09606, Med15, ARC105 or Med15 subunit of Media	0.003

>gnl\|CDD\|215902 pfam00403, HMA, Heavy-metal-associated domain	Back alignment and domain information

 Score = 67.2 bits (165), Expect = 3e-14
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 5  VLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDP---SVLIKKLAKSGK 61
          +    + C GC  KV+K L K+ GV + S+D E GKVTV+G+ DP     L K + K+G 
Sbjct: 2  LRVPGMTCAGCAKKVEKALSKLPGVSSVSVDLETGKVTVTGDPDPLKLEKLKKAIEKAGY 61

Query: 62 H 62
           
Sbjct: 62 E 62

Length = 62

>gnl\|CDD\|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones	Back alignment and domain information

>gnl\|CDD\|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|240291 PTZ00146, PTZ00146, fibrillarin; Provisional	Back alignment and domain information

>gnl\|CDD\|240291 PTZ00146, PTZ00146, fibrillarin; Provisional	Back alignment and domain information

>gnl\|CDD\|221784 pfam12810, Gly_rich, Glycine rich protein	Back alignment and domain information

>gnl\|CDD\|240291 PTZ00146, PTZ00146, fibrillarin; Provisional	Back alignment and domain information

>gnl\|CDD\|164795 PHA00370, III, attachment protein	Back alignment and domain information

>gnl\|CDD\|236092 PRK07772, PRK07772, single-stranded DNA-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>gnl\|CDD\|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed	Back alignment and domain information

>gnl\|CDD\|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|218737 pfam05764, YL1, YL1 nuclear protein	Back alignment and domain information

>gnl\|CDD\|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1	Back alignment and domain information

>gnl\|CDD\|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1	Back alignment and domain information

>gnl\|CDD\|131107 TIGR02052, MerP, mercuric transport protein periplasmic component	Back alignment and domain information

>gnl\|CDD\|236092 PRK07772, PRK07772, single-stranded DNA-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>gnl\|CDD\|226365 COG3846, TrbL, Type IV secretory pathway, TrbL components [Intracellular trafficking and secretion]	Back alignment and domain information

>gnl\|CDD\|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183)	Back alignment and domain information

>gnl\|CDD\|240291 PTZ00146, PTZ00146, fibrillarin; Provisional	Back alignment and domain information

>gnl\|CDD\|240291 PTZ00146, PTZ00146, fibrillarin; Provisional	Back alignment and domain information

>gnl\|CDD\|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>gnl\|CDD\|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		523
PF00403		62	HMA: Heavy-metal-associated domain; InterPro: IPR0	99.24
COG2608		71	CopZ Copper chaperone [Inorganic ion transport and	99.2
KOG1603		73	consensus Copper chaperone [Inorganic ion transpor	98.97
KOG4656		247	consensus Copper chaperone for superoxide dismutas	98.59
PLN02957		238	copper, zinc superoxide dismutase	98.23
PRK10671		834	copA copper exporting ATPase; Provisional	98.05
TIGR00003		68	copper ion binding protein. This model describes a	98.02
COG2217		713	ZntA Cation transport ATPase [Inorganic ion transp	97.91
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	97.46
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	97.43
PRK10671		834	copA copper exporting ATPase; Provisional	96.91
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	96.48
PF06524		314	NOA36: NOA36 protein; InterPro: IPR010531 This fam	95.78
PF06524		314	NOA36: NOA36 protein; InterPro: IPR010531 This fam	95.27
TIGR02052		92	MerP mercuric transport protein periplasmic compon	94.78
cd00371		63	HMA Heavy-metal-associated domain (HMA) is a conse	93.78
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	93.15
PRK13748		561	putative mercuric reductase; Provisional	92.17
COG1888		97	Uncharacterized protein conserved in archaea [Func	91.65
PF05764		240	YL1: YL1 nuclear protein; InterPro: IPR008895 The	91.41
PF05764		240	YL1: YL1 nuclear protein; InterPro: IPR008895 The	89.22
KOG1991		1010	consensus Nuclear transport receptor RANBP7/RANBP8	89.02
PF15243		92	ANAPC15: Anaphase-promoting complex subunit 15	88.4
PF02680		95	DUF211: Uncharacterized ArCR, COG1888; InterPro: I	87.96
KOG3241		227	consensus Uncharacterized conserved protein [Funct	86.41
PF04889		244	Cwf_Cwc_15: Cwf15/Cwc15 cell cycle control protein	86.3
KOG3241		227	consensus Uncharacterized conserved protein [Funct	82.96
PF01206		70	TusA: Sulfurtransferase TusA; InterPro: IPR001455	81.93
PRK14054		172	methionine sulfoxide reductase A; Provisional	81.18

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures	Back alignment and domain information

Probab=99.24  E-value=3.4e-11  Score=94.86  Aligned_cols=58  Identities=34%  Similarity=0.596  Sum_probs=54.3

Q ss_pred             EEEEe-ecCHHHHHHHHHHHhcCCCeeEEEEecCCCEEEEEec---CCHHHHHHHHHHcCCc
Q 009870            5 VLKVN-IHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGN---VDPSVLIKKLAKSGKH   62 (523)
Q Consensus         5 ~LkVe-M~C~~Ca~kIEKaL~kl~GV~sV~VDl~sgkVtV~g~---vd~~eIikaI~kaGy~   62 (523)
                      ||+|. |+|.+|+++|+++|++++||.+++||+.+++|+|+.+   +++++|+++|+++||+
T Consensus         1 t~~v~~m~C~~C~~~v~~~l~~~~GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~~~Gy~   62 (62)
T PF00403_consen    1 TFKVPGMTCEGCAKKVEKALSKLPGVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIEKAGYE   62 (62)
T ss_dssp             EEEEESTTSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEESTTTSCHHHHHHHHHHTTSE
T ss_pred             CEEECCcccHHHHHHHHHHHhcCCCCcEEEEECCCCEEEEEEecCCCCHHHHHHHHHHhCcC
Confidence            68998 9999999999999999999999999999999999964   5679999999999995

These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A ....

>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN02957 copper, zinc superoxide dismutase	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>TIGR00003 copper ion binding protein	Back alignment and domain information

>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues	Back alignment and domain information

>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues	Back alignment and domain information

>TIGR02052 MerP mercuric transport protein periplasmic component	Back alignment and domain information

>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>COG1888 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>PF05764 YL1: YL1 nuclear protein; InterPro: IPR008895 The proteins in this family are designated YL1 []	Back alignment and domain information

>PF05764 YL1: YL1 nuclear protein; InterPro: IPR008895 The proteins in this family are designated YL1 []	Back alignment and domain information

>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF15243 ANAPC15: Anaphase-promoting complex subunit 15	Back alignment and domain information

>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function	Back alignment and domain information

>KOG3241 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04889 Cwf_Cwc_15: Cwf15/Cwc15 cell cycle control protein; InterPro: IPR006973 This family represents Cwf15/Cwc15 (from Schizosaccharomyces pombe and Saccharomyces cerevisiae respectively) and their homologues	Back alignment and domain information

>KOG3241 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF01206 TusA: Sulfurtransferase TusA; InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase	Back alignment and domain information

>PRK14054 methionine sulfoxide reductase A; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		523
3iwl_A		68	Copper transport protein ATOX1; beta-alpha-beta-BE	99.41
3dxs_X		74	Copper-transporting ATPase RAN1; CXXC motif, ferre	99.36
1cc8_A		73	Protein (metallochaperone ATX1); copper transport,	99.35
4a4j_A		69	Pacszia, cation-transporting ATPase PACS; hydrolas	99.32
3fry_A		73	Probable copper-exporting P-type ATPase A; transpo	99.29
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	99.23
2xmw_A		71	PACS-N, cation-transporting ATPase PACS; hydrolase	99.15
1mwy_A		73	ZNTA; open-faced beta-sandwich fold, beta-alpha-be	99.15
2xmm_A		64	SSR2857 protein, ATX1; metal transport, copper hom	99.14
2l3m_A		71	Copper-ION-binding protein; structural genomics, c	99.13
2qif_A		69	Copper chaperone COPZ; tetranuclear Cu(I) cluster;	99.12
1y3j_A		77	Copper-transporting ATPase 1; ferrodoxin-like fold	99.12
2roe_A		66	Heavy metal binding protein; NMR {Thermus thermoph	99.12
1osd_A		72	MERP, hypothetical protein MERP; mercury resistanc	99.11
1aw0_A		72	Menkes copper-transporting ATPase; copper-binding	99.1
3cjk_B		75	Copper-transporting ATPase 1; HAH1, ATP7B, menkes	99.09
2k2p_A		85	Uncharacterized protein ATU1203; putative metal-bi	99.08
1kvi_A		79	Copper-transporting ATPase 1; menkes, Cu-protein,	99.08
1opz_A		76	Potential copper-transporting ATPase; mutation, fo	99.07
1jww_A		80	Potential copper-transporting ATPase; beta-alpha-b	99.07
2g9o_A		90	Copper-transporting ATPase 1; menkes disease, solu	99.06
2kt2_A		69	Mercuric reductase; nmera, MERA, HMA domain, mercu	99.05
1fvq_A		72	Copper-transporting ATPase; APO-CCC2A, hydrolase;	99.04
1q8l_A		84	Copper-transporting ATPase 1; metal binding protei	99.04
1cpz_A		68	Protein (COPZ); copper chaperone, metal transport,	99.03
1yjr_A		75	Copper-transporting ATPase 1; metallochaperone, pr	99.02
1yg0_A		66	COP associated protein; open-faced beta-sandwich,	99.0
2ldi_A		71	Zinc-transporting ATPase; metal homeostasis, metal	99.0
2kyz_A		67	Heavy metal binding protein; structural genomics,	98.98
2kkh_A		95	Putative heavy metal transporter; zinc transport,	98.98
2ofg_X		111	Zinc-transporting ATPase; ferredoxin-like fold, be	98.98
1qup_A		222	Superoxide dismutase 1 copper chaperone; two domai	98.97
2ew9_A		149	Copper-transporting ATPase 2; copper trafficking,	98.92
1p6t_A		151	Potential copper-transporting ATPase; COPA, P-type	98.92
1jk9_B		249	CCS, copper chaperone for superoxide dismutase; pr	98.85
2aj0_A		71	Probable cadmium-transporting ATPase; ferrodoxin-l	98.82
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	98.8
2ew9_A		149	Copper-transporting ATPase 2; copper trafficking,	98.75
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	98.45
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	98.45
1p6t_A		151	Potential copper-transporting ATPase; COPA, P-type	98.41
2x3d_A		96	SSO6206; unknown function; 2.70A {Sulfolobus solfa	88.54
3bpd_A		100	Uncharacterized protein; heptamer, Mg+2 ION, PSI-2	88.27
2raq_A		97	Conserved protein MTH889; alpha-beta protein, stru	86.94
3iot_A		449	Maltose-binding protein, huntingtin fusion protei;	82.33

>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A	Back alignment and structure

Probab=99.41  E-value=5.8e-13  Score=104.52  Aligned_cols=67  Identities=30%  Similarity=0.550  Sum_probs=62.8

Q ss_pred             CeEEEEEEeecCHHHHHHHHHHHhcCCCeeEEEEecCCCEEEEEecCCHHHHHHHHHHcCCceEEcCc
Q 009870            1 MQTYVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSGKHAELWGA   68 (523)
Q Consensus         1 Mqkv~LkVeM~C~~Ca~kIEKaL~kl~GV~sV~VDl~sgkVtV~g~vd~~eIikaI~kaGy~a~l~~~   68 (523)
                      |.+++|+|.|+|.+|+.+|+++|++++|| +++||+.+++++|+..+++++|+++|+++||++++|+.
T Consensus         1 m~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~~~Gy~~~~~~~   67 (68)
T 3iwl_A            1 MPKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL   67 (68)
T ss_dssp             -CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTCSCEEEEEC
T ss_pred             CceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEecCCHHHHHHHHHHcCCceEecCC
Confidence            57888999999999999999999999999 99999999999999989999999999999999998764

PyMOL of 3iwl

>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0	Back alignment and structure

>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A	Back alignment and structure

>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A	Back alignment and structure

>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A	Back alignment and structure

>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A	Back alignment and structure

>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A	Back alignment and structure

>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis}	Back alignment and structure

>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A	Back alignment and structure

>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A	Back alignment and structure

>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A	Back alignment and structure

>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A	Back alignment and structure

>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A	Back alignment and structure

>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A	Back alignment and structure

>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str}	Back alignment and structure

>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A	Back alignment and structure

>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A	Back alignment and structure

>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A	Back alignment and structure

>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A	Back alignment and structure

>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A	Back alignment and structure

>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B	Back alignment and structure

>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A	Back alignment and structure

>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1	Back alignment and structure

>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A	Back alignment and structure

>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori}	Back alignment and structure

>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP}	Back alignment and structure

>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima}	Back alignment and structure

>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana}	Back alignment and structure

>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens}	Back alignment and structure

>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A	Back alignment and structure

>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens}	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A	Back alignment and structure

>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus}	Back alignment and structure

>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1	Back alignment and structure

>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1	Back alignment and structure

>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		523
d1qupa2		72	d.58.17.1 (A:2-73) Copper chaperone for superoxide	8e-21
d1cc8a_		72	d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX	3e-20
d1fe0a_		66	d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX	8e-18
d1osda_		72	d.58.17.1 (A:) Mercuric ion binding protein MerP {	7e-15
d2ggpb1		72	d.58.17.1 (B:1-72) Copper transporter domain ccc2a	4e-14
d1sb6a_		64	d.58.17.1 (A:) Copper chaperone {Synechocystis sp.	1e-13
d1p6ta2		79	d.58.17.1 (A:73-151) Potential copper-translocatin	4e-13
d2qifa1		69	d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt	2e-12
d2aw0a_		72	d.58.17.1 (A:) Menkes copper-transporting ATPase {	3e-12
d1mwza_		73	d.58.17.1 (A:) Metal ion-transporting ATPase ZntA,	1e-11
d1cpza_		68	d.58.17.1 (A:) Copper chaperone {Enterococcus hira	1e-11
d1kvja_		79	d.58.17.1 (A:) Menkes copper-transporting ATPase {	2e-11
d1p6ta1		72	d.58.17.1 (A:1-72) Potential copper-translocating	4e-11
d1q8la_		84	d.58.17.1 (A:) Menkes copper-transporting ATPase {	2e-07

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 84.1 bits (208), Expect = 8e-21
 Identities = 20/64 (31%), Positives = 35/64 (54%)

Query: 5  VLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSGKHAE 64
             + +HC+ C + +K  L+ + G+ + + D EQ  ++V  +V PS +I  L   GK A 
Sbjct: 9  TYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAI 68

Query: 65 LWGA 68
          + GA
Sbjct: 69 IRGA 72

PyMOL of d1qupa2

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure

>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66	Back information, alignment and structure

>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72	Back information, alignment and structure

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64	Back information, alignment and structure

>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79	Back information, alignment and structure

>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69	Back information, alignment and structure

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72	Back information, alignment and structure

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73	Back information, alignment and structure

>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68	Back information, alignment and structure

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72	Back information, alignment and structure

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		523
d1fe0a_		66	ATX1 metallochaperone protein (ATOX1) {Human (Homo	99.51
d1qupa2		72	Copper chaperone for superoxide dismutase, N-termi	99.51
d1cc8a_		72	ATX1 metallochaperone protein (ATOX1) {Baker's yea	99.5
d2qifa1		69	Copper chaperone {Bacillus subtilis, CopZ [TaxId:	99.43
d1kvja_		79	Menkes copper-transporting ATPase {Human (Homo sap	99.41
d2ggpb1		72	Copper transporter domain ccc2a {Baker's yeast (Sa	99.41
d2aw0a_		72	Menkes copper-transporting ATPase {Human (Homo sap	99.4
d1osda_		72	Mercuric ion binding protein MerP {Ralstonia metal	99.4
d1sb6a_		64	Copper chaperone {Synechocystis sp. pcc 6803, Scat	99.38
d1cpza_		68	Copper chaperone {Enterococcus hirae [TaxId: 1354]	99.38
d1q8la_		84	Menkes copper-transporting ATPase {Human (Homo sap	99.34
d1p6ta2		79	Potential copper-translocating P-type ATPase CopA	99.34
d1mwza_		73	Metal ion-transporting ATPase ZntA, N-terminal dom	99.32
d1p6ta1		72	Potential copper-translocating P-type ATPase CopA	99.32
d3bpda1		91	Uncharacterized protein AF1549 {Archaeoglobus fulg	90.51
d2raqa1		93	Uncharacterized protein MTH889 {Methanobacterium t	89.81
d1dcja_		81	SirA {Escherichia coli [TaxId: 562]}	81.77

>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Human (Homo sapiens), HAH1 [TaxId: 9606]

Probab=99.51  E-value=1.9e-14  Score=113.53  Aligned_cols=64  Identities=30%  Similarity=0.561  Sum_probs=61.1

Q ss_pred             EEEEEEeecCHHHHHHHHHHHhcCCCeeEEEEecCCCEEEEEecCCHHHHHHHHHHcCCceEEcC
Q 009870            3 TYVLKVNIHCDGCKHKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPSVLIKKLAKSGKHAELWG   67 (523)
Q Consensus         3 kv~LkVeM~C~~Ca~kIEKaL~kl~GV~sV~VDl~sgkVtV~g~vd~~eIikaI~kaGy~a~l~~   67 (523)
                      +++|+|+|+|.+|+.+|+++|+++++| +|+||+.+.+|+|++++++++|+++|+++||+++++.
T Consensus         2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~~~~~~i~~~I~~~Gy~a~lig   65 (66)
T d1fe0a_           2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLG   65 (66)
T ss_dssp             EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTTSCEEEEE
T ss_pred             CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEeeCCHHHHHHHHHHhCCeEEEee
Confidence            579999999999999999999999998 6999999999999999999999999999999999874

PyMOL of d1fe0a_

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}	Back information, alignment and structure

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]}	Back information, alignment and structure

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]}	Back information, alignment and structure

>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]}	Back information, alignment and structure

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1dcja_ d.68.3.3 (A:) SirA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure