Citrus Sinensis ID: 009985

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-

MSRAPVDHSTSLSRTFKYLLATQFLSRGIPFVFNSWIVRHLTEADYAIYAVQFHLFVTCVLFLSREGFRRACMRADIKCDGASREENAAKLLKVAWLTLPLGIFITIGACFFVLWWQGLSYSNPYAQAIFINGFACVLELLAEPLYILSQNLLLLRLRLVVETVATFSRCFTMCILIVKQYEMEKGIVFALSQVAYAASLFLGYWGYFLLFGAFKTSDLFPFRLGNMMSYDKQLANMCTLFTFQSFRKLLLQEGEKLVLVWLDTPYNQAVYGLVDKLGSLVVRMVFLPFEESSYATFARSASGQYPQKSKKIGNSLAEALKLVLLIGLVFMAFGPSYSYSLVRLLYGKKWSDGEASTALRYYCLYVVVLAMNGTSEAFLHAVATEDQLKRSNDSLLVFSVIYIVMNVILIQSAGSVGLILANSLNMILRIIYSAIFIKHYFQGSSSFSFRSSLPSGWPILLVSGVITLFSERIFLDRQDFWATFLIHFSVGLTCFCISSIVIYHRERSFIYKIIRFRNHKD

ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

*************RTFKYLLATQFLSRGIPFVFNSWIVRHLTEADYAIYAVQFHLFVTCVLFLSREGFRRACMRADIK****SREENAAKLLKVAWLTLPLGIFITIGACFFVLWWQGLSYSNPYAQAIFINGFACVLELLAEPLYILSQNLLLLRLRLVVETVATFSRCFTMCILIVKQYEMEKGIVFALSQVAYAASLFLGYWGYFLLFGAFKTSDLFPFRLGNMMSYDKQLANMCTLFTFQSFRKLLLQEGEKLVLVWLDTPYNQAVYGLVDKLGSLVVRMVFLPFEESSYATFARSA**********IGNSLAEALKLVLLIGLVFMAFGPSYSYSLVRLLYGKKWSDGEASTALRYYCLYVVVLAMNGTSEAFLHAVATEDQLKRSNDSLLVFSVIYIVMNVILIQSAGSVGLILANSLNMILRIIYSAIFIKHYFQGSSSFSFRSSLPSGWPILLVSGVITLFSERIFLDRQDFWATFLIHFSVGLTCFCISSIVIYHRERSFIYKIIRFR****

xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein RFT1 homolog	May be involved in N-linked oligosaccharide assembly. May participate in the translocation of oligosaccharide from the cytoplasmic side to the lumenal side of the endoplasmic reticulum membrane.	probable	Q0D2E8
Protein RFT1 homolog	May be involved in N-linked oligosaccharide assembly. May participate in the translocation of oligosaccharide from the cytoplasmic side to the lumenal side of the endoplasmic reticulum membrane.	probable	Q8C3B8
Protein RFT1 homolog	May be involved in N-linked oligosaccharide assembly. May participate in the translocation of oligosaccharide from the cytoplasmic side to the lumenal side of the endoplasmic reticulum membrane.	probable	Q96AA3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MKT, chain A
Confidence level:confident
Coverage over the Query: 7-439
View the alignment between query and template
View the model in PyMOL