Citrus Sinensis ID: 009985


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-
MSRAPVDHSTSLSRTFKYLLATQFLSRGIPFVFNSWIVRHLTEADYAIYAVQFHLFVTCVLFLSREGFRRACMRADIKCDGASREENAAKLLKVAWLTLPLGIFITIGACFFVLWWQGLSYSNPYAQAIFINGFACVLELLAEPLYILSQNLLLLRLRLVVETVATFSRCFTMCILIVKQYEMEKGIVFALSQVAYAASLFLGYWGYFLLFGAFKTSDLFPFRLGNMMSYDKQLANMCTLFTFQSFRKLLLQEGEKLVLVWLDTPYNQAVYGLVDKLGSLVVRMVFLPFEESSYATFARSASGQYPQKSKKIGNSLAEALKLVLLIGLVFMAFGPSYSYSLVRLLYGKKWSDGEASTALRYYCLYVVVLAMNGTSEAFLHAVATEDQLKRSNDSLLVFSVIYIVMNVILIQSAGSVGLILANSLNMILRIIYSAIFIKHYFQGSSSFSFRSSLPSGWPILLVSGVITLFSERIFLDRQDFWATFLIHFSVGLTCFCISSIVIYHRERSFIYKIIRFRNHKD
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*************RTFKYLLATQFLSRGIPFVFNSWIVRHLTEADYAIYAVQFHLFVTCVLFLSREGFRRACMRADIK****SREENAAKLLKVAWLTLPLGIFITIGACFFVLWWQGLSYSNPYAQAIFINGFACVLELLAEPLYILSQNLLLLRLRLVVETVATFSRCFTMCILIVKQYEMEKGIVFALSQVAYAASLFLGYWGYFLLFGAFKTSDLFPFRLGNMMSYDKQLANMCTLFTFQSFRKLLLQEGEKLVLVWLDTPYNQAVYGLVDKLGSLVVRMVFLPFEESSYATFARSA**********IGNSLAEALKLVLLIGLVFMAFGPSYSYSLVRLLYGKKWSDGEASTALRYYCLYVVVLAMNGTSEAFLHAVATEDQLKRSNDSLLVFSVIYIVMNVILIQSAGSVGLILANSLNMILRIIYSAIFIKHYFQGSSSFSFRSSLPSGWPILLVSGVITLFSERIFLDRQDFWATFLIHFSVGLTCFCISSIVIYHRERSFIYKIIRFR****
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRAPVDHSTSLSRTFKYLLATQFLSRGIPFVFNSWIVRHLTEADYAIYAVQFHLFVTCVLFLSREGFRRACMRADIKCDGASREENAAKLLKVAWLTLPLGIFITIGACFFVLWWQGLSYSNPYAQAIFINGFACVLELLAEPLYILSQNLLLLRLRLVVETVATFSRCFTMCILIVKQYEMEKGIVFALSQVAYAASLFLGYWGYFLLFGAFKTSDLFPFRLGNMMSYDKQLANMCTLFTFQSFRKLLLQEGEKLVLVWLDTPYNQAVYGLVDKLGSLVVRMVFLPFEESSYATFARSASGQYPQKSKKIGNSLAEALKLVLLIGLVFMAFGPSYSYSLVRLLYGKKWSDGEASTALRYYCLYVVVLAMNGTSEAFLHAVATEDQLKRSNDSLLVFSVIYIVMNVILIQSAGSVGLILANSLNMILRIIYSAIFIKHYFQGSSSFSFRSSLPSGWPILLVSGVITLFSERIFLDRQDFWATFLIHFSVGLTCFCISSIVIYHRERSFIYKIIRFRNHKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein RFT1 homolog May be involved in N-linked oligosaccharide assembly. May participate in the translocation of oligosaccharide from the cytoplasmic side to the lumenal side of the endoplasmic reticulum membrane.probableQ0D2E8
Protein RFT1 homolog May be involved in N-linked oligosaccharide assembly. May participate in the translocation of oligosaccharide from the cytoplasmic side to the lumenal side of the endoplasmic reticulum membrane.probableQ8C3B8
Protein RFT1 homolog May be involved in N-linked oligosaccharide assembly. May participate in the translocation of oligosaccharide from the cytoplasmic side to the lumenal side of the endoplasmic reticulum membrane.probableQ96AA3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MKT, chain A
Confidence level:confident
Coverage over the Query: 7-439
View the alignment between query and template
View the model in PyMOL