Citrus Sinensis ID: 010123


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------
MLLLNVLTLARTTMPRNDVVFEADDIEFGNPWWFVYAGVSCVLVLFAGIMSGLTLGLMSLGLVELEILQRSGTSTEKQQAAAILPVVQKQHQLLVTLLLCNACAMEALPIYLDKIFHPFVAVLLSVTFVLAFGEIIPQAICSRYGLAVGANFVWLVRILMIICYPIAYPIGKILDAVLGHHDALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPKNIIGLLLVKSLLTVRAETETPVSAVSIRRMPRVPADMPLYDILNEFQKGSSHMAAVVKVKGKSKKSQSISLGEKFGGNGVFSGNSQLTTPLLTNDVTSETTPLLTNDVTSESVVVGIDRTSRPNTNNQSLPPQLGAAAENLPYSLEDIEEGVVIGIITLEDVFEELLQEEIVDETDVYVDVHKRIRVAAAAAAASTMARAPSSWKLTAQKPAGAQGKQGQTTKRSVESGLHSVRFPGTEKEALLGNKQ
cccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEHHHHcccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc
**LLNVLTLARTTMPRNDVVFEADDIEFGNPWWFVYAGVSCVLVLFAGIMSGLTLGLMSLGLVELEILQRS********AAAILPVVQKQHQLLVTLLLCNACAMEALPIYLDKIFHPFVAVLLSVTFVLAFGEIIPQAICSRYGLAVGANFVWLVRILMIICYPIAYPIGKILDAVLGHHDALFRRAQLKALVSIHS***********DETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPKNIIGLLLVKSLLTVRAETETPVSAVSIRRMPRVPADMPLYDILNEFQKGSSHMAAVVKVKGKSKKSQSISLGEKFGGNGVFSGNSQLTTPLLTNDVTSETTP***********VV**********************AENLPYSLEDIEEGVVIGIITLEDVFEELLQEEIVDETDVYVDVHKRIRVA************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxHxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLLNVLTLARTTMPRNDVVFEADDIEFGNPWWFVYAGVSCVLVLFAGIMSGLTLGLMSLGLVELEILQRSGTSTEKQQAAAILPVVQKQHQLLVTLLLCNACAMEALPIYLDKIFHPFVAVLLSVTFVLAFGEIIPQAICSRYGLAVGANFVWLVRILMIICYPIAYPIGKILDAVLGHHDALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPKNIIGLLLVKSLLTVRAETETPVSAVSIRRMPRVPADMPLYDILNEFQKGSSHMAAVVKVKGKSKKSQSISLGEKFGGNGVFSGNSQLTTPLLTNDVTSETTPLLTNDVTSESVVVGIDRTSRPNTNNQSLPPQLGAAAENLPYSLEDIEEGVVIGIITLEDVFEELLQEEIVDETDVYVDVHKRIRVAAAAAAASTMARAPSSWKLTAQKPAGAQGKQGQTTKRSVESGLHSVRFPGTEKEALLGNKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative DUF21 domain-containing protein At1g03270 confidentQ9ZVS8
DUF21 domain-containing protein At4g14230 probableQ4V3C7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JTF, chain A
Confidence level:very confident
Coverage over the Query: 223-327
View the alignment between query and template
View the model in PyMOL
Template: 3LHH, chain A
Confidence level:very confident
Coverage over the Query: 225-327
View the alignment between query and template
View the model in PyMOL