Citrus Sinensis ID: 010147


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------
MESCDCIDTQWPPDELLVRYQYISDILIALAYFSIPVELIYFVQKSAFFPYRWVLMQFGSFIILCGLTHFISLWTFTVHSKAVAVVMTIAKMACAFVSCITALMLVHIIPDLLSVKTRELFLKNRADELDREMGLILTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLGLEECALWMPSRTGLNLELSYTLNNQIQIGSSVPINLPIVTDVFNSAQAMRLPYNCPLARIRLLVGRYVPPDIVAVRVPLLHLSNFQINDWPELPAKSYAVMVLMLPTDGGRKWRDHELELIDVVADQVAVALSHAAILEDSMRARNQLMEQNVALDSARREAEKAIHARNDFRAVMNHEMRTLMHAIIALSSLLLETDLTPEQRVMIETVLKSSNLLTTLVDDVLDLSRLEDGSLELDNGPFNLQIVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEGYVSIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVCI
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccCEEEEccccccccEEEEEEcccccccccccccccccHHHHccccccccccccccHHHHHHHcccccccccHHccccccccccccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccCEcccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccccccccccccccccEEEEEEEEEc
***CDCIDTQWPPDELLVRYQYISDILIALAYFSIPVELIYFVQKSAFFPYRWVLMQFGSFIILCGLTHFISLWTFTVHSKAVAVVMTIAKMACAFVSCITALMLVHIIPDLLSVKTRELFLKNRADELDREMGLILTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLGLEECALWMPSRTGLNLELSYTLNNQIQIGSSVPINLPIVTDVFNSAQAMRLPYNCPLARIRLLVGRYVPPDIVAVRVPLLHLSNFQINDWPELPAKSYAVMVLMLPTDGGRKWRDHELELIDVVADQVAVALSHAAILEDSMRARNQLMEQNVALDSARREAEKAIHARNDFRAVMNHEMRTLMHAIIALSSLLLETDLTPEQRVMIETVLKSSNLLTTLVDDVLDLSRLEDGSLELDNGPFNLQIVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEGYVSIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVCI
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESCDCIDTQWPPDELLVRYQYISDILIALAYFSIPVELIYFVQKSAFFPYRWVLMQFGSFIILCGLTHFISLWTFTVHSKAVAVVMTIAKMACAFVSCITALMLVHIIPDLLSVKTRELFLKNRADELDREMGLILTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLGLEECALWMPSRTGLNLELSYTLNNQIQIGSSVPINLPIVTDVFNSAQAMRLPYNCPLARIRLLVGRYVPPDIVAVRVPLLHLSNFQINDWPELPAKSYAVMVLMLPTDGGRKWRDHELELIDVVADQVAVALSHAAILEDxxxxxxxxxxxxxxxxxxxxxxxxxIHARNDFRAVMNHEMRTLMHAIIALSSLLLETDLTPEQRVMIETVLKSSNLLTTLVDDVLDLSRLEDGSLELDNGPFNLQIVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEGYVSIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVCI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ethylene response sensor 1 Ethylene receptor related to bacterial two-component regulators. Acts as a redundant negative regulator of ethylene signaling.confidentQ38846
Ethylene receptor 2 May act early in the ethylene signal transduction pathway, possibly as an ethylene receptor, or as a regulator of the pathway.probableQ9XH57
Ethylene receptor May act early in the ethylene signal transduction pathway, possibly as an ethylene receptor, or as a regulator of the pathway.probableQ9M7M1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.13.-Protein-histidine kinases.probable
2.7.13.3Histidine kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2C2A, chain A
Confidence level:very confident
Coverage over the Query: 336-509
View the alignment between query and template
View the model in PyMOL
Template: 3P01, chain A
Confidence level:confident
Coverage over the Query: 125-258,273-312
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 286-346
View the alignment between query and template
View the model in PyMOL