Citrus Sinensis ID: 010158


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510------
MEATLLSSHHFTPQLFTTTPVKLGGGHVLADNRFCHPLCTKTFVSVRLSLLDSKRRQVPLLNRPFLSRANKRYSVYSSDQLRSDYVNVEASSALSVNLEAVPPRLDDEVDSQGLRDVTDNETFRSKPKMYKNRFLNFIRLSSVLNNAAESFFKSEIRRRLFVTAVLIVISRIGYFIPLPGFDRRLIPQDYLSFVSGSVDELGDFGAELKLSFFQLGISPQIVASILMQVLCHIVPSLVQLRKEGLDGHEKIKSYIWWISLGFAILEAVIVACYSLPYSIYAASHSVKHVMVTAFLLVCGAMTMSWICDTISESGFGQGSSLIICVGILTGYTETLYKMLSQLLGSSVRWWPFMLGLLGVFTIVTMWAVVVTEGCRKVKLQYYGFKLASAAREDSPITEVEPYIPFNINPSGMQPVLTTTYLLAFPSILASILGSPFWQHVKEILNPETSVGARPWVYYTIYAFFVFLFNIFDIVSILYTLLFTITLGVNDSYFVEHFVIIVFPFSCFLLFHLAIVS
ccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccCEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHEEEEEccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
********HHFTPQLFTTTPVKLGGGHVLADNRFCHPLCTKTFVSVRLSLLDSKRRQVPLLNRPFLSRANKRYSVYS******DYVNV****************************************MYKNRFLNFIRLSSVLNNAAESFFKSEIRRRLFVTAVLIVISRIGYFIPLPGFDRRLIPQDYLSFVSGSVDELGDFGAELKLSFFQLGISPQIVASILMQVLCHIVPSLVQLRKEGLDGHEKIKSYIWWISLGFAILEAVIVACYSLPYSIYAASHSVKHVMVTAFLLVCGAMTMSWICDTISESGFGQGSSLIICVGILTGYTETLYKMLSQLLGSSVRWWPFMLGLLGVFTIVTMWAVVVTEGCRKVKLQYYGFKLASAAREDSPITEVEPYIPFNINPSGMQPVLTTTYLLAFPSILASILGSPFWQHVKEILNPETSVGARPWVYYTIYAFFVFLFNIFDIVSILYTLLFTITLGVNDSYFVEHFVIIVFPFSCFLLFHLAIVS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEATLLSSHHFTPQLFTTTPVKLGGGHVLADNRFCHPLCTKTFVSVRLSLLDSKRRQVPLLNRPFLSRANKRYSVYSSDQLRSDYVNVEASSALSVNLEAVPPRLDDEVDSQGLRDVTDNETFRSKPKMYKNRFLNFIRLSSVLNNAAESFFKSEIRRRLFVTAVLIVISRIGYFIPLPGFDRRLIPQDYLSFVSGSVDELGDFGAELKLSFFQLGISPQIVASILMQVLCHIVPSLVQLRKEGLDGHEKIKSYIWWISLGFAILEAVIVACYSLPYSIYAASHSVKHVMVTAFLLVCGAMTMSWICDTISESGFGQGSSLIICVGILTGYTETLYKMLSQLLGSSVRWWPFMLGLLGVFTIVTMWAVVVTEGCRKVKLQYYGFKLASAAREDSPITEVEPYIPFNINPSGMQPVLTTTYLLAFPSILASILGSPFWQHVKEILNPETSVGARPWVYYTIYAFFVFLFNIFDIVSILYTLLFTITLGVNDSYFVEHFVIIVFPFSCFLLFHLAIVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Preprotein translocase subunit SCY2, chloroplastic Involved in protein export. Probably interacts with other proteins to allow the postimport or conservative sorting pathway for inner membrane proteins in plastids. Central subunit of the protein translocation channel SecYE. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug.probableF4IQV7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DL8, chain G
Confidence level:very confident
Coverage over the Query: 150-182,199-514
View the alignment between query and template
View the model in PyMOL
Template: 2WW9, chain A
Confidence level:very confident
Coverage over the Query: 131-514
View the alignment between query and template
View the model in PyMOL