Citrus Sinensis ID: 010206


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-----
MDNGGGSSEAAAQPLEWKFSQVFGERTAGEEVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTRDNGGQRRDLEMMDYSMSRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQSANSALYLLSTNDKTIKLWKVQEKKVKKVFDWNVHPEKAAGNGPIFGSHVSAIPKSYMANGGCGERNFGCASNDSSFPPGGVSSLRLPVVVVTSQETNLVAGCRRIYAHAHDYHINSISNNSDGETFISADDLRINLWNLEISNQSFNIVDVKPANMEDLTEVITSAEFHPTHCNMLAYSSSKGSIRLIDMRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTPSRPSRPLGSLSGVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMYYA
ccccccccccccccccEEEEEECccccccccccccccEEEEEEcccccEEEECcccccEEEEEEccccccccccccccEEEECcccccccEEEEEECcccccccccccEEEEcEEEEEEEEEcccccEEEEccccccEEEEEcccccEEEEccccccccccccccccccCECcccccCECccccCCcCEEECccccccccccccccccCEEEEEccccEEEEEEEEEcccccccccEEEEEEcccccEEEEEEcccEEEEEcccccCEEEEEECcccccccccccEEEEEECccccCEEEEECcccCEEEEEccccccccccccEEEECcccccccccccEEEEEEEEEEcccccEEEEEcccEEEEEccccccccEEEEEEccccccccccccccccccccEEEEECccccEEEEECcccEEEEEEcccccCEEEEEEcccccEEEEECcccccccccccccccCEEECcccccccccccccccccccEEEEECcccccEEEEEEcccEEEEEc
***************EWKFSQVFGERTAGEEVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTRDNGGQRRDLEMMDYSMSRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQSANSALYLLSTNDKTIKLWKVQEKKVKKVFDWNVHPEKAAGNGPIFGSHVSAIPKSYMANGGCGERNFGCASNDSSFPPGGVSSLRLPVVVVTSQETNLVAGCRRIYAHAHDYHINSISNNSDGETFISADDLRINLWNLEISNQSFNIVDVKPANMEDLTEVITSAEFHPTHCNMLAYSSSKGSIRLIDMRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKN************************************NGNAFDFSMKLLHLAWHPSENSIACAASNSLYMYYA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNGGGSSEAAAQPLEWKFSQVFGERTAGEEVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTRDNGGQRRDLEMMDYSMSRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQSANSALYLLSTNDKTIKLWKVQEKKVKKVFDWNVHPEKAAGNGPIFGSHVSAIPKSYMANGGCGERNFGCASNDSSFPPGGVSSLRLPVVVVTSQETNLVAGCRRIYAHAHDYHINSISNNSDGETFISADDLRINLWNLEISNQSFNIVDVKPANMEDLTEVITSAEFHPTHCNMLAYSSSKGSIRLIDMRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTPSRPSRPLGSLSGVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMYYA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.confidentQ0E2P1
Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.confidentQ39247
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Within the PP2A holoenzyme complex, isoform 2 is required to promote proapoptotic activity. Isoform 2 regulates neuronal survival through the mitochondrial fission and fusion balance.probableP36877

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DW8, chain B
Confidence level:very confident
Coverage over the Query: 13-66,84-157,201-463,476-515
View the alignment between query and template
View the model in PyMOL
Template: 1NR0, chain A
Confidence level:confident
Coverage over the Query: 15-186,199-386,402-515
View the alignment between query and template
View the model in PyMOL
Template: 2Z3Z, chain A
Confidence level:confident
Coverage over the Query: 36-70,95-100,113-325,338-386,402-432
View the alignment between query and template
View the model in PyMOL