Citrus Sinensis ID: 010210

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-----
MDFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADALMSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ
cccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccHHHHHHHHHHHccccEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHccccccccEEEEccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccEEEEEcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccHHccccccccccccccccHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccEcccccccHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccHHHHHHHHHHHccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccEEEEEEEEEc
MDFDSFLTSLGTSFIIFVVLMCLFAWlsskpgntvvyypnrilkgldpweggsrtrnpFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIillpallpvaatddsiqaagknttsigtfndldklsmgnitaKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRadalmspevrpqQFAVLVRdlpdlpkgqsrkeQVDSYFKaiypdtfyrSMVVTNNKEANKIYEELEGYKKKLARAEAVYAesksagkpegtrptiktgFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVdtwtvsdapesreLIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLsktegipaVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKtfksiekdpnsIVDVLanslpgnatFFLTYVALQ
MDFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRIlkgldpweggsRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADALMSPEVRPQQFAVLVRdlpdlpkgqsrkeqvdSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYaesksagkpegtrptiktgflgllGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ
MDFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIIllpallpvaaTDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADALMSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAieyynekikeiiPKLEAEQKITLKEKQLGAALVFFTSRvaaasaaqslhaqlvDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIAlivflallpklllflSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ
*****FLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKGLDPWEGGSRTRNPFTWIKEA*****QDVINMSGLDTAVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADALMSPEVRPQQFAVLVRDL************VDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARA******************TIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVA**
MDFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPN*****************PFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADALMSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIP**************LGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ
MDFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADALMSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAE**************TRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ
MDFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKG*D***GGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAA**NTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADALMSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ
ooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiii
ooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADALMSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKExxxxxxxxxxxxxxxxxxxxxxxxxxxxGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query515 2.2.26 [Sep-21-2011]
Q09766 871 Uncharacterized membrane yes no 0.937 0.554 0.234 7e-26
Q09809 793 Uncharacterized membrane no no 0.935 0.607 0.215 2e-25
Q12252 991 Phosphate metabolism prot yes no 0.916 0.476 0.233 2e-24
Q03516 953 Uncharacterized protein R no no 0.842 0.455 0.251 2e-24
O43022 865 Uncharacterized protein C no no 0.642 0.382 0.246 4e-14
Q06538 782 Uncharacterized membrane no no 0.473 0.312 0.244 3e-13
Q91YT8 804 Transmembrane protein 63A yes no 0.811 0.519 0.221 6e-13
Q5T3F8 832 Transmembrane protein 63B yes no 0.784 0.485 0.215 5e-10
Q9P1W3 806 Transmembrane protein 63C no no 0.823 0.526 0.213 7e-10
Q3TWI9 832 Transmembrane protein 63B no no 0.784 0.485 0.211 2e-09
>sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 Back     alignment and function desciption
 Score =  119 bits (297), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 123/525 (23%), Positives = 232/525 (44%), Gaps = 42/525 (8%)

Query: 13  SFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKGLDPWEGGSRT-RNPFTWIKEAMSSSEQ 71
           +F IF   + LF  L  +P    VY P  I+      E    +  +PF      +  SE 
Sbjct: 19  NFAIFCAFIGLFLCL--RPREKHVYQPRCIIDTQPKEEKPEPSPSSPFGLFAYVVKRSET 76

Query: 72  DVINMSGLDTAVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFND 131
            +I  +G+D   +  ++ T   +  L  ++L P LLPV AT+            +G    
Sbjct: 77  YLIQYAGVDGYFFIRYLFTFGALCILGCLVLFPILLPVNATN-----------GVGE-KG 124

Query: 132 LDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADALMSPEVR---PQ 188
            D LS  N+    +R +A +  ++     T F+++R  ++    R  A+ S  +    P 
Sbjct: 125 FDILSFSNV-KNHNRFYAHVFLSWLFFGFTIFIIYRELRYYVIFR-HAMQSSGLYNNLPS 182

Query: 189 QFAVLVRDLPD--LPKGQSRKEQVD--SYFKAIYPDTFYRSMVVTNNKEANKIYEELEGY 244
              +L+ +LP+  L   ++  E     S F  +         V   +   NK    L   
Sbjct: 183 SSTMLLTELPNSVLNDEETLHELFPNASEFTCVRDLKKLEKKVKKRSDLGNKYESTLNSL 242

Query: 245 -------KKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEII 297
                    KL +       +         RPT +  FL  +GK+VD I+Y  + I E+ 
Sbjct: 243 INKSVKKHNKLVKKHKPLPSTLDYTAYVKKRPTHRLKFL--IGKKVDTIDYCRDTIAELD 300

Query: 298 PKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQS-LHAQLVDTWT-----VSDAPESRE 351
             ++  Q    + K++G+  + F S+    +A Q+ L+++    +      V  APE  +
Sbjct: 301 EVVDKLQTSLEERKKVGSVFIRFRSQTDLQTAYQAFLYSKKFRKYRFGRALVGIAPE--D 358

Query: 352 LIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINI 411
           ++W+NL++  + R+ ++ +   I+ L I+F+  P+ ++  ++ ++ L + + FLK + ++
Sbjct: 359 IVWSNLDLSMYTRRGKKTISNTILTLMIIFWAFPVAVVGCISNVNYLIEKVHFLKFIDHM 418

Query: 412 TA-LKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVF 470
              L  ++   LP +AL + ++L+P  + FL K  G   V          Y+ F V+ VF
Sbjct: 419 PPKLLGIITGILPSVALSILMSLVPPFIKFLGKFGGALTVQEIENYCQNWYYAFQVVQVF 478

Query: 471 IGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ 515
           +  T+          + K+P S + +LA++LP  + F+++Y  LQ
Sbjct: 479 LVTTMTSAATSAVVQVIKEPASSMTLLASNLPKASNFYISYFLLQ 523

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q09809|YAB9_SCHPO Uncharacterized membrane protein C2G11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 Back     alignment and function description
>sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 Back     alignment and function description
>sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 Back     alignment and function description
>sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=4 SV=1 Back     alignment and function description
>sp|Q06538|YL241_YEAST Uncharacterized membrane protein YLR241W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR241W PE=1 SV=1 Back     alignment and function description
>sp|Q91YT8|TM63A_MOUSE Transmembrane protein 63A OS=Mus musculus GN=Tmem63a PE=2 SV=1 Back     alignment and function description
>sp|Q5T3F8|TM63B_HUMAN Transmembrane protein 63B OS=Homo sapiens GN=TMEM63B PE=1 SV=1 Back     alignment and function description
>sp|Q9P1W3|TM63C_HUMAN Transmembrane protein 63C OS=Homo sapiens GN=TMEM63C PE=2 SV=1 Back     alignment and function description
>sp|Q3TWI9|TM63B_MOUSE Transmembrane protein 63B OS=Mus musculus GN=Tmem63b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query515
224061057 724 predicted protein [Populus trichocarpa] 0.996 0.708 0.765 0.0
225443962 724 PREDICTED: uncharacterized membrane prot 1.0 0.711 0.743 0.0
147827322 676 hypothetical protein VITISV_037471 [Viti 1.0 0.761 0.743 0.0
357447203 722 Early-responsive to dehydration [Medicag 0.994 0.709 0.710 0.0
449433557 725 PREDICTED: uncharacterized membrane prot 0.998 0.708 0.713 0.0
449490576 725 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.998 0.708 0.711 0.0
356555504 723 PREDICTED: uncharacterized membrane prot 0.994 0.708 0.733 0.0
356549126 724 PREDICTED: uncharacterized membrane prot 0.994 0.707 0.722 0.0
18397470 724 Early-responsive to dehydration stress p 0.986 0.701 0.672 0.0
14596049532 Unknown protein [Arabidopsis thaliana] 0.986 0.954 0.668 0.0
>gi|224061057|ref|XP_002300337.1| predicted protein [Populus trichocarpa] gi|222847595|gb|EEE85142.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/515 (76%), Positives = 452/515 (87%), Gaps = 2/515 (0%)

Query: 1   MDFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKGLDPWEGGSRTRNPFT 60
           MDF SFLTSLGTSF+IFVVLM LF WLS KPGN+ VYYPNRILKGL+PW+G SR+RNPF 
Sbjct: 1   MDFSSFLTSLGTSFLIFVVLMLLFTWLSRKPGNSFVYYPNRILKGLEPWDGASRSRNPFA 60

Query: 61  WIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAAG 120
           WI+EA SSSEQDVINMSG+DTAVYFVF+ST L I  LSG++LLP LLPVAATDD+++   
Sbjct: 61  WIREAFSSSEQDVINMSGVDTAVYFVFLSTALAILVLSGLVLLPVLLPVAATDDNVKTQK 120

Query: 121 KNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRADAL 180
                  +F+D+DKL MGN+   S RLWAFL+ATYWVS VTYFLLW+ Y HVS LRA+AL
Sbjct: 121 DKGNQ--SFSDIDKLLMGNVKGGSPRLWAFLIATYWVSLVTYFLLWKAYVHVSGLRANAL 178

Query: 181 MSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEE 240
           MSPE+ P+QFAVLVRD+P +P+G++RKEQVDSYFK+IYP+TFYRSMVVTNNKE NKIY E
Sbjct: 179 MSPELTPEQFAVLVRDIPPVPEGRTRKEQVDSYFKSIYPETFYRSMVVTNNKEVNKIYIE 238

Query: 241 LEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKL 300
           LEGYKKKLA AEAVY ESK  GKPEG RPTI+TG LG++G++VD+IE+YNEKIKE+IPKL
Sbjct: 239 LEGYKKKLAHAEAVYDESKKTGKPEGLRPTIRTGPLGIVGRKVDSIEHYNEKIKELIPKL 298

Query: 301 EAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIK 360
           EAEQK+TL+E Q   A  FFT+RV AASAAQSLHAQ+VDTWTV +APE R++IW+NL IK
Sbjct: 299 EAEQKVTLRENQQACAFAFFTNRVTAASAAQSLHAQMVDTWTVMEAPEPRQIIWSNLKIK 358

Query: 361 FFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEA 420
           +FQR IRQYVV  IVALTI+FYMIPIGLISALTTLDNLKKILPFLKP++NI A+KTVLEA
Sbjct: 359 YFQRIIRQYVVCFIVALTILFYMIPIGLISALTTLDNLKKILPFLKPIVNIVAVKTVLEA 418

Query: 421 YLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLF 480
           YLPQIALIVFLALLPKLLL LSK EGIP+V HAVRA SGKYFYFT+LNVFIGVT+GGTLF
Sbjct: 419 YLPQIALIVFLALLPKLLLALSKAEGIPSVGHAVRATSGKYFYFTILNVFIGVTLGGTLF 478

Query: 481 KTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ 515
            TFKSIE+ PNSIV +LA+SLPGNATFFLT+VAL+
Sbjct: 479 TTFKSIEEKPNSIVSLLASSLPGNATFFLTFVALK 513

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225443962|ref|XP_002280109.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147827322|emb|CAN64310.1| hypothetical protein VITISV_037471 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357447203|ref|XP_003593877.1| Early-responsive to dehydration [Medicago truncatula] gi|355482925|gb|AES64128.1| Early-responsive to dehydration [Medicago truncatula] Back     alignment and taxonomy information
>gi|449433557|ref|XP_004134564.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449490576|ref|XP_004158645.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein C2G11.09-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356555504|ref|XP_003546071.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine max] Back     alignment and taxonomy information
>gi|356549126|ref|XP_003542948.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine max] Back     alignment and taxonomy information
>gi|18397470|ref|NP_564354.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] gi|12322128|gb|AAG51102.1|AC025295_10 unknown protein [Arabidopsis thaliana] gi|14334838|gb|AAK59597.1| unknown protein [Arabidopsis thaliana] gi|17104683|gb|AAL34230.1| unknown protein [Arabidopsis thaliana] gi|332193088|gb|AEE31209.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|14596049|gb|AAK68752.1| Unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query515
TAIR|locus:2204227 724 ERD4 "early-responsive to dehy 0.984 0.700 0.594 5.7e-162
TAIR|locus:2031735 806 AT1G32090 "AT1G32090" [Arabido 0.965 0.616 0.319 1.5e-60
TAIR|locus:2140210 785 AT4G02900 [Arabidopsis thalian 0.926 0.607 0.312 1.2e-58
TAIR|locus:2089850 756 AT3G21620 "AT3G21620" [Arabido 0.941 0.641 0.319 6.6e-58
TAIR|locus:2027119 769 AT1G62320 "AT1G62320" [Arabido 0.935 0.626 0.294 5.3e-56
TAIR|locus:2008860 771 AT1G11960 "AT1G11960" [Arabido 0.939 0.627 0.300 8.6e-56
TAIR|locus:2134882 772 AT4G04340 [Arabidopsis thalian 0.945 0.630 0.294 3.7e-55
TAIR|locus:2120673 771 AT4G22120 [Arabidopsis thalian 0.961 0.642 0.284 9.9e-55
TAIR|locus:2130130 761 AT4G15430 "AT4G15430" [Arabido 0.941 0.637 0.298 9.2e-52
TAIR|locus:2102117 703 HYP1 "hypothetical protein 1" 0.939 0.688 0.254 2.5e-38
TAIR|locus:2204227 ERD4 "early-responsive to dehydration 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1577 (560.2 bits), Expect = 5.7e-162, P = 5.7e-162
 Identities = 309/520 (59%), Positives = 382/520 (73%)

Query:     1 MDFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKGLDPWEGGSRTRNPFT 60
             M+F SFL SLGTSF+IFV+LM LF WLS K GN  +YYPNRILKGL+PWEG S TRNPF 
Sbjct:     1 MEFGSFLVSLGTSFVIFVILMLLFTWLSRKSGNAPIYYPNRILKGLEPWEGTSLTRNPFA 60

Query:    61 WIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFALSGIIXXXXXXXXXXTDDSIQAAG 120
             W++EA++SSEQDV+N+SG+DTAV+FVF+STVLGIFA S ++          TD++I+   
Sbjct:    61 WMREALTSSEQDVVNLSGVDTAVHFVFLSTVLGIFACSSLLLLPTLLPLAATDNNIKNT- 119

Query:   121 KN---TTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVTYFLLWRGYKHVSELRA 177
             KN   TTS GTF+ LD LSM NIT KSSRLWAFL A YW+S VTYF LW+ YKHVS LRA
Sbjct:   120 KNATDTTSKGTFSQLDNLSMANITKKSSRLWAFLGAVYWISLVTYFFLWKAYKHVSSLRA 179

Query:   178 DALMSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKI 237
              ALMS +V+P+QFA+LVRD+P  P GQ++KE +DSYF+ IYP+TFYRS+V T N + NKI
Sbjct:   180 QALMSADVKPEQFAILVRDMPAPPDGQTQKEFIDSYFREIYPETFYRSLVATENSKVNKI 239

Query:   238 YEELEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAXXXXXXXXXXXX 297
             +E+LEGYKKKLARAEA+ A + +       RPT KTGF GL+GK+VD+            
Sbjct:   240 WEKLEGYKKKLARAEAILAATNN-------RPTNKTGFCGLVGKQVDSIEYYTELINESV 292

Query:   298 PKLEAEQKITLKEKQLGAALVFFTSRXXXXXXXXXXXXXXXDTWTVSDAPESRELIWNNL 357
              KLE EQK  L EKQ  AA+VFFT+R               D WTV++APE R+L+W NL
Sbjct:   293 AKLETEQKAVLAEKQQTAAVVFFTTRVAAASAAQSLHCQMVDKWTVTEAPEPRQLLWQNL 352

Query:   358 NIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTV 417
             NIK F R IRQY +Y  VA+TI+FYMIPI  +SA+TTL NL++I+PF+KPV+ ITA++TV
Sbjct:   353 NIKLFSRIIRQYFIYFFVAVTILFYMIPIAFVSAITTLKNLQRIIPFIKPVVEITAIRTV 412

Query:   418 LEAYLPQIAXXXXXXXXXXXXXXXSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGG 477
             LE++LPQIA               SK EGIP+ SHA+RAASGKYFYF+V NVFIGVT+ G
Sbjct:   413 LESFLPQIALIVFLAMLPKLLLFLSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAG 472

Query:   478 TLFKTFKSIEKDP--NSIVDVLANSLPGNATFFLTYVALQ 515
             TLF T K I K+P  + I+++LA SLP +ATFFLTYVAL+
Sbjct:   473 TLFNTVKDIAKNPKLDMIINLLATSLPKSATFFLTYVALK 512
GO:0005576 "extracellular region" evidence=ISM
GO:0016020 "membrane" evidence=IEA;IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2031735 AT1G32090 "AT1G32090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140210 AT4G02900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089850 AT3G21620 "AT3G21620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027119 AT1G62320 "AT1G62320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008860 AT1G11960 "AT1G11960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134882 AT4G04340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120673 AT4G22120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130130 AT4G15430 "AT4G15430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102117 HYP1 "hypothetical protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
pfam02714 325 pfam02714, DUF221, Domain of unknown function DUF2 2e-56
COG5594 827 COG5594, COG5594, Uncharacterized integral membran 4e-53
pfam13967151 pfam13967, RSN1_TM, Late exocytosis, associated wi 3e-34
>gnl|CDD|190398 pfam02714, DUF221, Domain of unknown function DUF221 Back     alignment and domain information 
 Score =  190 bits (486), Expect = 2e-56
 Identities = 75/201 (37%), Positives = 119/201 (59%), Gaps = 1/201 (0%)

Query: 316 ALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIV 375
           A V F S+ AA  AAQ+L       W    APE R++IW NL++  ++R +R+ +V +++
Sbjct: 1   AFVTFKSQAAAQMAAQALQHHNPLKWPTYLAPEPRDIIWENLSLSRWERWLRRLIVNLLL 60

Query: 376 ALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINI-TALKTVLEAYLPQIALIVFLALL 434
            L I+F+ IP+  +  L+ L+ L K+ PFLK ++++   L  ++   LP + L + +ALL
Sbjct: 61  FLLIIFWAIPVAFVGLLSNLETLTKVWPFLKWILDLPPVLLGLVTGLLPTLLLSLLMALL 120

Query: 435 PKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIV 494
           P +L FLSK +G P+ S    +   KYF F V+NVF+ VT+  T       I  +P SI 
Sbjct: 121 PIILRFLSKLQGHPSRSDVELSVQSKYFAFLVVNVFLVVTLASTASSLITEIIDNPTSIP 180

Query: 495 DVLANSLPGNATFFLTYVALQ 515
            +LA +LP  + FF++Y+ LQ
Sbjct: 181 TLLATNLPKASNFFISYILLQ 201

This family consists of hypothetical transmembrane proteins none of which have any function, the aligned region is at 538 residues at maximum length. Length = 325
>gnl|CDD|227881 COG5594, COG5594, Uncharacterized integral membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|222479 pfam13967, RSN1_TM, Late exocytosis, associated with Golgi transport Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 515
COG5594 827 Uncharacterized integral membrane protein [Functio 100.0
KOG1134 728 consensus Uncharacterized conserved protein [Gener 100.0
PF02714 325 DUF221: Domain of unknown function DUF221; InterPr 100.0
PF13967157 RSN1_TM: Late exocytosis, associated with Golgi tr 100.0
PF1470385 DUF4463: Domain of unknown function (DUF4463) 99.18
PF04547 452 Anoctamin: Calcium-activated chloride channel; Int 97.33
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 97.1
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 96.36
KOG2513 647 consensus Protein required for meiotic chromosome 96.2
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 96.09
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 96.09
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 95.96
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 95.9
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 95.83
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 95.47
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 95.07
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 94.95
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 93.95
KOG0122270 consensus Translation initiation factor 3, subunit 93.62
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 93.42
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 92.29
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 91.89
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 91.42
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 91.2
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 91.17
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 90.79
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 90.62
PLN03121243 nucleic acid binding protein; Provisional 90.22
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 89.89
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 89.61
KOG2514 861 consensus Uncharacterized conserved protein [Funct 88.37
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 88.28
PLN03120260 nucleic acid binding protein; Provisional 88.1
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 88.07
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 87.91
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 87.34
KOG1548382 consensus Transcription elongation factor TAT-SF1 87.13
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 86.63
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 85.87
KOG1457284 consensus RNA binding protein (contains RRM repeat 85.17
smart0036272 RRM_2 RNA recognition motif. 85.07
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 82.49
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 80.16
>COG5594 Uncharacterized integral membrane protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=6e-94  Score=745.39  Aligned_cols=503  Identities=25%  Similarity=0.454  Sum_probs=462.1

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHhhCCCCCceeecccccCCCCCCCCCCCCCCCcccchHHhhcCCHHHHHHHhChhH
Q 010210            2 DFDSFLTSLGTSFIIFVVLMCLFAWLSSKPGNTVVYYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDT   81 (515)
Q Consensus         2 ~~~~~~~~l~~~~~i~~~~~~~F~~lR~~~~~~~iY~pr~~~~~~~p~~~~~~~~~~~~Wi~~~~~~~d~~i~~~~GlDa   81 (515)
                      ++++++|++.+++.++++.+++|++||+|  ++++|+||+..++.+...+.+.++|+|||+.++++++|+.+++++|+||
T Consensus        20 s~~~~~t~l~f~~~~~~~~l~~f~iLR~r--~k~lY~pr~~~~~~~~~~P~~~~ss~~gWl~~L~~i~d~~~l~~aGlD~   97 (827)
T COG5594          20 STSAVITQLVFAGLIFLVFLILFLILRKR--WKRLYAPRTNFDGQNECLPEPNPSSYWGWLEPLVKIPDEFLLQYAGLDG   97 (827)
T ss_pred             chhhhHHHHHHHHHHHHHHHHHHHHHHHH--HhHhcCcceeecCCCcccCCCCccchHHHHHHHHhCCHHHHHHHcCcch
Confidence            57899999999999999999999999987  5899999999886431212267899999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhheeeeeeeCCcccccCCCCCCCCCCCcccccccCCccCCCcchHHHHHHHHHHHHHH
Q 010210           82 AVYFVFMSTVLGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYWVSFVT  161 (515)
Q Consensus        82 ~~flrflk~~~~~f~~~~~~~~~iLlPin~~~~~~~~~~~~~~~~~~~~~l~~~Ti~Nv~~~s~~lw~h~i~~~l~~~~~  161 (515)
                      |+||||+|||+++|++.|+++++||+|+|++.++..+..     ....++++++|++|+.+ ++++|+|++.+|++.+++
T Consensus        98 y~fLrflkm~~~~~~i~sl~~ipIL~Pvn~~~~~~~~gn-----~~s~s~l~~Ls~~Nv~~-~n~~~aHvf~~~~f~~~v  171 (827)
T COG5594          98 YFFLRFLKMLIKLLFILSLILIPILLPVNYHFQKATNGN-----SDSESGLDKLSISNVSP-SNRLYAHVFLSWFFFGYV  171 (827)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHhHEeeeeeecccccccCC-----ccchhhhhHhhhhcccC-CCceeeeeehhHHHHHHH
Confidence            999999999999999999999999999999885543211     12468999999999976 789999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhcCCC---------CCCccceEEEecCCCCCCCCChHHHHHHHHHHhCCCCcceEEEecCch
Q 010210          162 YFLLWRGYKHVSELRADALMSPE---------VRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNK  232 (515)
Q Consensus       162 ~~~l~~e~~~~~~~R~~~l~~~~---------~~~~~~TVlV~~IP~~~~~~~~~~~l~~~f~~~~p~~v~~v~i~~d~~  232 (515)
                      +|.+++|++.|..+||++++++.         .+.++||++++++|.++++   +++|.++|+++.-|++.+..+|||.+
T Consensus       172 lfii~~el~~y~~lr~a~~~~p~y~qs~~~~~~~~ssRTvlis~LP~~~~~---~e~L~~~~~kl~~~~i~~~~l~~~~~  248 (827)
T COG5594         172 LFIIFRELRFYVVLRQAYLRSPLYQQSLLTLQNNLSSRTVLISGLPSELRS---DEELKELFDKLKVGEIDSDVLCRDLG  248 (827)
T ss_pred             HHHHHHHHHHHHHHHHHHHccHHHHHHHHhhccCCCCceEEeecCChhhcC---chhHHHHHhhcCeeeeccchhhhhhH
Confidence            99999999999999999999875         3459999999999999999   88899999999888999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh----------cc------C----------CCCCCCCCccccCCC--CCCCcccc
Q 010210          233 EANKIYEELEGYKKKLARAEAVYAES----------KS------A----------GKPEGTRPTIKTGFL--GLLGKRVD  284 (515)
Q Consensus       233 ~l~~l~~~~~~~~~~Le~~~~~~~~~----------k~------~----------~~~~~~rp~~r~~~~--~~~g~kvd  284 (515)
                      .++++.++|++..+++|.+..++..+          |+      .          ..|+++||+||.+-.  +++|||||
T Consensus       249 ~l~~l~k~R~ki~~klE~~~~~~~~~~~K~~~~~~~K~~~~L~~~~~k~~~~~~~y~~~~~Rp~~~i~k~~~~i~gKkVd  328 (827)
T COG5594         249 TLQELYKERDKILKKLEKALNELLNKLLKKSHLKTNKKSGKLTPSRKKEFEILPEYVPDKKRPKHRIKKLNKGIFGKKVD  328 (827)
T ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhhHhhccCCCCCCCcccccchhhhhhccccccchhhhhhhhhhhccceec
Confidence            99999999999999999998876432          10      0          135678999998755  67899999


Q ss_pred             HHHHHHHHHHhHHHHHHHHHhhhhcccCCceEEEEeCCHHHHHHHHHHhccCCCCcee-eeeCCCCCcccccccccchHH
Q 010210          285 AIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWT-VSDAPESRELIWNNLNIKFFQ  363 (515)
Q Consensus       285 ~i~~~~~~i~~l~~~I~~~r~~~~~~~~~~~aFVtF~~~~~a~~a~q~~~~~~~~~~~-v~~AP~P~DIiW~NL~~~~~~  363 (515)
                      +|||+++++.+++++|++.|+......++++|||||+|+..||+|+|.+.++++.... ++.||+|+||+|+|+..++++
T Consensus       329 aI~y~s~~l~~l~~~i~~~r~~~~~~t~~~~~FItFkSq~~Aq~~aQ~~~~sr~~~~~~v~iapaPnDi~W~Nl~ls~~~  408 (827)
T COG5594         329 AIDYYSAKLTKLDAEIENARKSLYENTPTKSGFITFKSQASAQIAAQSQIYSRVLGKLKVEIAPAPNDIIWDNLRLSRKE  408 (827)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCccccCccccEEEEEehhHHHHHHHHhhhhhhhhcceeeeecCCccccccccchHHHHH
Confidence            9999999999999999999999877777889999999999999999999888887665 999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchHhHHhhcCcchhhhc-hhhHHHHHHhhhhHHHHHHHHHHHHHHHHHHH
Q 010210          364 RQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVIN-ITALKTVLEAYLPQIALIVFLALLPKLLLFLS  442 (515)
Q Consensus       364 r~~R~~~~~~~~~~l~if~~iPv~~i~~l~~l~~l~~~~~~l~~~~~-~~~~~~~i~~~lP~l~l~~~~~llp~i~~~ls  442 (515)
                      |..|++.++++.++++++|++|||+++.++|++++.+.+||++.+.+ .|+++++++|+||++++++++.++|+++++++
T Consensus       409 r~~k~~~~ni~~il~II~w~~pVa~v~~i~Nl~~l~~~~p~l~~il~~~~~l~~iltglLptv~~~~l~~ivP~fir~Ls  488 (827)
T COG5594         409 RLFKRISANILFILLIILWAFPVAFVGTISNLNTLSSLWPFLKFILKDPPFLAGILTGLLPTVALSLLMSIVPYFIRWLS  488 (827)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhHhhhhHHHHHHHhccHHHHHHHHhhhhHHHHHHHHHHhHHHHHHHH
Confidence            99999999999999999999999999999999999999999999865 56899999999999999999999999999999


Q ss_pred             HhcCCCchhHHHHHHHHHHHHHHhhHHHHHHhhhhhHHHHHHHHHcChhHHHHHHHHhCCCCccchhhheecC
Q 010210          443 KTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQ  515 (515)
Q Consensus       443 ~~eg~~t~S~~~~s~~~k~f~f~~~n~flv~~l~~~~~~~l~~~~~~p~~i~~~l~~~lp~~s~fFi~yii~q  515 (515)
                      .+||..|+|+.|+.++.|||.|+|+|+|+|.+++|+..+.+.+++++|.+++.+||+++|++|+||++||++|
T Consensus       489 ~~qG~~S~se~E~~~~~k~~~f~fv~~FlV~Tl~s~fss~v~~~~ke~~s~~~llA~~lpk~SnFfi~~iilq  561 (827)
T COG5594         489 YMQGLVSYSEEEIYVQNKYFAFLFVNLFLVVTLASSFSSIVWSLLKEPTSIMTLLANNLPKASNFFISYIILQ  561 (827)
T ss_pred             HhcCccchHHHHHHHHhhhhhheeeeehheeeehhHHHHHHHHHhcChHhHHHHHHhccHHHHHHHHHHHHHh
Confidence            9999999999999999999999999999999999999899999999999999999999999999999999987

>KOG1134 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>PF02714 DUF221: Domain of unknown function DUF221; InterPro: IPR003864 This domain is found in a family of hypothetical transmembrane proteins none of which have any known function, the aligned region is at 538 residues at maximum length Back     alignment and domain information
>PF13967 RSN1_TM: Late exocytosis, associated with Golgi transport Back     alignment and domain information
>PF14703 DUF4463: Domain of unknown function (DUF4463) Back     alignment and domain information
>PF04547 Anoctamin: Calcium-activated chloride channel; InterPro: IPR007632 This family contains the anoctamin/TMEM16 proteins which are thought to be calcium-dependent chloride channel [] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG2513 consensus Protein required for meiotic chromosome segregation [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2514 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 64.5 bits (156), Expect = 5e-11
 Identities = 87/520 (16%), Positives = 172/520 (33%), Gaps = 108/520 (20%)

Query: 3   FDSFLTSLGTSFIIFV--VLMCLFAWLSSK-------P-GNTVVY--YPNRILKGLDPWE 50
           F + L+        FV  VL   + +L S        P   T +Y    +R+      + 
Sbjct: 68  FWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFA 127

Query: 51  GGSRTR-NPFTWIKEAMSS--SEQDVI--NMSG-----------LDTAV--YFVFMSTVL 92
             + +R  P+  +++A+      ++V+   + G           L   V     F     
Sbjct: 128 KYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDF----- 182

Query: 93  GIFALS-G--------IILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLS------- 136
            IF L+          + +L  LL     + + ++   +   +   +   +L        
Sbjct: 183 KIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKP 242

Query: 137 -------MGNITAKSSRLW-AF------LVATYWVSFVTYFLLWRGYKHVS-ELRADALM 181
                  + N+  ++++ W AF      L+ T +   VT FL      H+S +  +  L 
Sbjct: 243 YENCLLVLLNV--QNAKAWNAFNLSCKILLTTRFKQ-VTDFLSAATTTHISLDHHSMTLT 299

Query: 182 SPEVRPQQFA-VLVRDLPDLPKGQSRKE--QVDSYFKA---IYPDTFYRSMVVTNNKEAN 235
             EV+       L     DLP+ +      +  S           T+     V  +K   
Sbjct: 300 PDEVK-SLLLKYLDCRPQDLPR-EVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTT 357

Query: 236 KI---YEELE-GYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNE 291
            I      LE    +K+    +V+        P      I T  L L+    D I+    
Sbjct: 358 IIESSLNVLEPAEYRKMFDRLSVF--------PPSAH--IPTILLSLIWF--DVIKSDVM 405

Query: 292 KI-KEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESR 350
            +  ++      E++   KE  +    ++   +V   +    LH  +VD + +    +S 
Sbjct: 406 VVVNKLHKYSLVEKQ--PKESTISIPSIYLELKVKLENEYA-LHRSIVDHYNIPKTFDSD 462

Query: 351 ELIWNNLNIKFFQRQIRQYVVY--VIVALTIMFYMIPIGLISALTTLDN-LKKILPFLKP 407
           +LI   L+  F+      ++ +    +       +  +  +     L+  ++        
Sbjct: 463 DLIPPYLDQYFY-----SHIGHHLKNIEHPERMTLFRMVFLD-FRFLEQKIRHDSTAWNA 516

Query: 408 VINITALKTVLEAYLPQIALI--VFLALLPKLLLFLSKTE 445
             +I      L+ Y P I      +  L+  +L FL K E
Sbjct: 517 SGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKIE 556
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query515
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 97.54
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 97.54
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 97.52
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.49
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 97.41
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 97.41
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 97.39
3p5t_L90 Cleavage and polyadenylation specificity factor S; 97.36
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 97.36
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 97.33
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 97.33
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 97.31
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 97.28
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 97.27
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 97.26
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 97.26
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 97.24
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.2
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 97.19
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.17
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 97.17
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 97.17
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 97.17
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 97.16
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 97.14
2cph_A107 RNA binding motif protein 19; RNA recognition moti 97.12
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 97.12
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 97.11
2div_A99 TRNA selenocysteine associated protein; structural 97.11
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 97.09
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 97.08
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 97.05
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 97.04
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 97.03
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 97.01
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 97.01
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 97.0
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 97.0
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 97.0
2cqd_A116 RNA-binding region containing protein 1; RNA recog 97.0
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 96.99
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 96.97
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 96.97
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 96.97
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 96.97
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 96.92
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 96.92
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 96.9
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 96.9
2kt5_A124 RNA and export factor-binding protein 2; chaperone 96.9
2la6_A99 RNA-binding protein FUS; structural genomics, nort 96.89
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 96.89
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 96.87
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 96.86
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 96.85
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 96.85
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 96.85
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 96.84
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 96.83
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 96.82
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 96.79
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 96.79
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 96.78
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 96.78
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 96.76
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 96.75
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 96.75
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 96.75
2cpj_A99 Non-POU domain-containing octamer-binding protein; 96.72
2f3j_A177 RNA and export factor binding protein 2; RRM domai 96.72
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 96.71
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 96.7
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 96.69
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 96.69
1x4e_A85 RNA binding motif, single-stranded interacting pro 96.69
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 96.68
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 96.68
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 96.68
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 96.67
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 96.67
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.66
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 96.65
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 96.65
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.65
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 96.64
2dnl_A114 Cytoplasmic polyadenylation element binding protei 96.64
2dis_A109 Unnamed protein product; structural genomics, RRM 96.62
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 96.62
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 96.61
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 96.61
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 96.58
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 96.58
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 96.56
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 96.54
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 96.54
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 96.53
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 96.51
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 96.5
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 96.49
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 96.48
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 96.48
1x5o_A114 RNA binding motif, single-stranded interacting pro 96.48
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 96.48
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 96.48
3n9u_C156 Cleavage and polyadenylation specificity factor S; 96.47
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 96.45
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 96.43
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 96.43
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 96.42
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 96.38
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 96.36
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 96.35
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 96.35
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 96.33
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 96.28
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 96.28
2krb_A81 Eukaryotic translation initiation factor 3 subunit 96.27
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 96.24
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 96.24
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 96.23
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 96.22
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 96.2
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.19
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 96.17
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 96.16
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 96.16
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 96.14
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 96.1
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 96.05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 96.04
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 96.02
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 96.02
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 96.02
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 96.02
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 95.99
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.99
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 95.96
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 95.88
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 95.86
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 95.84
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 95.84
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 95.82
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 95.78
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 95.75
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 95.73
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 95.72
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 95.7
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 95.68
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 95.66
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 95.63
3q2s_C229 Cleavage and polyadenylation specificity factor S; 95.58
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 95.55
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 95.5
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 95.46
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 95.41
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 95.31
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 95.28
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 95.23
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 95.22
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 95.1
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 95.06
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 94.91
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 94.89
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 94.8
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 94.7
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 94.7
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 94.66
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 94.62
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 94.6
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 94.11
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 93.62
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 93.6
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 93.6
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 93.6
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 93.59
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 93.55
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 93.22
2dit_A112 HIV TAT specific factor 1 variant; structural geno 93.0
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 92.89
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 92.79
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 92.78
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 92.61
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 92.6
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 92.51
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 92.32
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 92.04
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 92.03
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 91.59
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 91.38
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 90.98
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 90.92
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 90.27
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 89.81
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 89.03
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 85.25
1x5p_A97 Negative elongation factor E; structure genomics, 83.62
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 83.5
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 81.1
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 80.27
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=97.54  E-value=0.00074  Score=53.44  Aligned_cols=82  Identities=12%  Similarity=0.146  Sum_probs=61.6

Q ss_pred             CccceEEEecCCCCCCCCChHHHHHHHHHHhCCCCcceEEEecCchHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCC
Q 010210          187 PQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPEG  266 (515)
Q Consensus       187 ~~~~TVlV~~IP~~~~~~~~~~~l~~~f~~~~p~~v~~v~i~~d~~~l~~l~~~~~~~~~~Le~~~~~~~~~k~~~~~~~  266 (515)
                      +..+||.|.|||.+++    +++|+++|+++  |.|.++.+.+|..                                  
T Consensus         3 ~~~~~l~v~nlp~~~t----~~~l~~~f~~~--G~v~~v~i~~~~~----------------------------------   42 (95)
T 2dnz_A            3 SGSSGLYVGSLHFNIT----EDMLRGIFEPF--GKIDNIVLMKDSD----------------------------------   42 (95)
T ss_dssp             SCCCEEEEESCCTTCC----HHHHHHHHTTT--SCEEEEEEECCSS----------------------------------
T ss_pred             CCCcEEEEeCCCCCCC----HHHHHHHHHhc--CCEeEEEEeecCC----------------------------------
Confidence            5678999999999887    78899999986  5677776653311                                  


Q ss_pred             CCCccccCCCCCCCccccHHHHHHHHHHhHHHHHHHHHhhhhcccCCceEEEEeCCHHHHHHHHHHhccCC--CCceeee
Q 010210          267 TRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQL--VDTWTVS  344 (515)
Q Consensus       267 ~rp~~r~~~~~~~g~kvd~i~~~~~~i~~l~~~I~~~r~~~~~~~~~~~aFVtF~~~~~a~~a~q~~~~~~--~~~~~v~  344 (515)
                                                                ..+..+.|||+|++..+|..|.+.++...  ...++|+
T Consensus        43 ------------------------------------------~~~~~g~afV~f~~~~~a~~A~~~l~g~~~~g~~l~V~   80 (95)
T 2dnz_A           43 ------------------------------------------TGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVG   80 (95)
T ss_dssp             ------------------------------------------SCCCCSEEEEEESCHHHHHHHHHHHTTCCSSSSCCEEE
T ss_pred             ------------------------------------------CCceeeEEEEEECCHHHHHHHHHHhCCCeeCCcEEEEE
Confidence                                                      01346899999999999999999776543  3457777


Q ss_pred             eCCCCC
Q 010210          345 DAPESR  350 (515)
Q Consensus       345 ~AP~P~  350 (515)
                      .|.++.
T Consensus        81 ~a~~~~   86 (95)
T 2dnz_A           81 HVTERL   86 (95)
T ss_dssp             ESSCCC
T ss_pred             Eccccc
Confidence            775544
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query515
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 97.85
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.77
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.77
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 97.75
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 97.73
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 97.71
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 97.63
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 97.63
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.61
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.58
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.55
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.54
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.51
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 97.5
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.49
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.48
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.47
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 97.47
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 97.41
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 97.36
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 97.32
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 97.32
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 97.32
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.31
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 97.3
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.3
d2cpja186 Non-POU domain-containing octamer-binding protein, 97.3
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 97.26
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 97.22
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 97.2
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 97.19
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.17
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 97.12
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 97.1
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 97.08
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.07
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 97.06
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 97.05
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 97.03
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 97.03
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.02
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 97.01
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 96.95
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 96.95
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 96.91
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 96.9
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 96.88
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 96.87
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 96.84
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 96.81
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.8
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 96.78
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 96.76
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 96.75
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 96.69
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 96.66
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 96.65
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 96.64
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 96.61
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 96.56
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 96.54
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 96.53
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 96.5
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 96.46
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 96.31
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 96.23
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 96.21
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 96.2
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 96.08
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 95.85
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 95.81
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 95.72
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 95.7
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 95.29
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 95.13
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 94.64
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 94.4
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 93.5
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 93.0
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 92.19
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 91.7
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 91.7
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 88.12
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 87.33
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Sex-lethal protein
species: Drosophila melanogaster [TaxId: 7227]

Probab=97.85  E-value=2.8e-05  Score=58.44  Aligned_cols=78  Identities=23%  Similarity=0.262  Sum_probs=59.1

Q ss_pred             ccceEEEecCCCCCCCCChHHHHHHHHHHhCCCCcceEEEecCchHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCCC
Q 010210          188 QQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPEGT  267 (515)
Q Consensus       188 ~~~TVlV~~IP~~~~~~~~~~~l~~~f~~~~p~~v~~v~i~~d~~~l~~l~~~~~~~~~~Le~~~~~~~~~k~~~~~~~~  267 (515)
                      ++.||.|.|||.+++    +++|+++|+++  |.|.++.+++|..                                   
T Consensus         1 s~t~l~V~nLp~~~t----~~~l~~~F~~~--G~v~~~~i~~~~~-----------------------------------   39 (82)
T d1b7fa1           1 SNTNLIVNYLPQDMT----DRELYALFRAI--GPINTCRIMRDYK-----------------------------------   39 (82)
T ss_dssp             CCSEEEEECCCTTCC----HHHHHHHHHTT--SCEEEEECCEETT-----------------------------------
T ss_pred             CCCEEEEeCCCCCCC----HHHHHHHHHHh--CCcceeeeeeecc-----------------------------------
Confidence            467899999999987    78999999987  5687776653211                                   


Q ss_pred             CCccccCCCCCCCccccHHHHHHHHHHhHHHHHHHHHhhhhcccCCceEEEEeCCHHHHHHHHHHhccCC--CCceeeee
Q 010210          268 RPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQL--VDTWTVSD  345 (515)
Q Consensus       268 rp~~r~~~~~~~g~kvd~i~~~~~~i~~l~~~I~~~r~~~~~~~~~~~aFVtF~~~~~a~~a~q~~~~~~--~~~~~v~~  345 (515)
                                                               ..++.|.|||+|.+..+|..|.+.++...  ...++|+.
T Consensus        40 -----------------------------------------~g~~~g~afV~f~~~~~A~~ai~~lng~~~~g~~l~v~~   78 (82)
T d1b7fa1          40 -----------------------------------------TGYSYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSY   78 (82)
T ss_dssp             -----------------------------------------TTEECSEEEEEESSHHHHHHHHHHHTTCEETTEECEEEE
T ss_pred             -----------------------------------------cCCccccceEEECCHHHHHHHHHHhCCCEECCEEEEEEE
Confidence                                                     11345799999999999999999876543  34567777


Q ss_pred             CC
Q 010210          346 AP  347 (515)
Q Consensus       346 AP  347 (515)
                      |.
T Consensus        79 a~   80 (82)
T d1b7fa1          79 AR   80 (82)
T ss_dssp             CC
T ss_pred             cC
Confidence            74
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure