Citrus Sinensis ID: 010234

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----

MQLLDGSVVPLDHKSRNLILDALHEMSTGALRCLGFAYKDELPDFETYDGNEDHPAHTLLLNPSNYASMECGLTFVGLVGLRDPPRNEVHQAIEDCRAAGIRVMVITGDNKNTAEAICREIGVFECNEDISLKSLTGKEFMEMHDKKAHLRQSGGLLFSRAEPRHKQEIVRLLKEDGEVVAMTGDGVNDAPALKLADIGIAMGIAGTEVAKEASDMVLADDDFSTIVSAVGEGRSIYNNMKAFIRYMISSNIGEVASIFFTAALGIPEGLIPVQLLWVNLVTDGPPATALGFNPPDKDIMKKPPRRSDDSLISAWILFRYLVIGLYVGIATVGVFIIWYTHGSFLGINLIGDGHSLVTYSQLTNWGQCPSWGNFTVSPFTAGNQVFTFNDNPCDYFHGGKVKAMTLSLSVLVAIEMFNSLNALSEDGSLLTMPPWVNPWLLLAMSVSFGLHFLILYVPFLAQIFGIVPLSFNEWLLVLAIAFPVVLIDEVLKFVGRCTNGSQTSRRKSSKPKSE

cccccccEECccHHHHHHHHHHHHHHHHHHccEEEEEECccccccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccccccccccccECccHHccccHHHHHHHccccEEEEEcccccHHHHHHHHHHcccEEEEccccccccHHccccccccccccccHHHcccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc

*Q***GSVVPLDHKSRNLILDALHEMSTGALRCLGFAYKDELPDFETYDGNEDHPAHTLLLNPSNYASMECGLTFVGLVGLRDPPRNEVHQAIEDCRAAGIRVMVITGDNKNTAEAICREIGVFECNEDISLKSLTGKEFMEMHDKKAHLRQSGGLLFSRAEPRHKQEIVRLLKEDGEVVAMTGDGVNDAPALKLADIGIAMGIAGTEVAKEASDMVLADDDFSTIVSAVGEGRSIYNNMKAFIRYMISSNIGEVASIFFTAALGIPEGLIPVQLLWVNLVTDGPPATALGFNPPDK*************LISAWILFRYLVIGLYVGIATVGVFIIWYTHGSFLGINLIGDGHSLVTYSQLTNWGQCPSWGNFTVSPFTAGNQVFTFNDNPCDYFHGGKVKAMTLSLSVLVAIEMFNSLNALSEDGSLLTMPPWVNPWLLLAMSVSFGLHFLILYVPFLAQIFGIVPLSFNEWLLVLAIAFPVVLIDEVLKFVGRCT****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Calcium-transporting ATPase 1, endoplasmic reticulum-type	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the endoplasmic reticulum lumen. Also regulate manganese ion homeostasis by pumping it into endomembrane compartments. Can also transport zinc.	probable	P92939
Calcium-transporting ATPase 4, endoplasmic reticulum-type	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to an endomembrane compartment.	probable	Q9XES1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IXZ, chain A
Confidence level:very confident
Coverage over the Query: 3-349,365-505
View the alignment between query and template
View the model in PyMOL

Template: 3BA6, chain A
Confidence level:very confident
Coverage over the Query: 9-46,57-368,380-496
View the alignment between query and template
View the model in PyMOL