Citrus Sinensis ID: 010235
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 514 | ||||||
| 255578112 | 514 | Aspartic proteinase precursor, putative | 0.994 | 0.994 | 0.827 | 0.0 | |
| 21616051 | 514 | aspartic proteinase [Theobroma cacao] | 1.0 | 1.0 | 0.799 | 0.0 | |
| 224056377 | 494 | predicted protein [Populus trichocarpa] | 0.947 | 0.985 | 0.839 | 0.0 | |
| 261264941 | 513 | aspartic proteinase 1 [Castanea mollissi | 0.998 | 1.0 | 0.824 | 0.0 | |
| 359483345 | 514 | PREDICTED: aspartic proteinase isoform 2 | 0.945 | 0.945 | 0.808 | 0.0 | |
| 261264943 | 513 | aspartic proteinase 2 [Castanea mollissi | 0.998 | 1.0 | 0.821 | 0.0 | |
| 225460913 | 514 | PREDICTED: aspartic proteinase [Vitis vi | 1.0 | 1.0 | 0.766 | 0.0 | |
| 21616053 | 514 | aspartic proteinase [Theobroma cacao] | 1.0 | 1.0 | 0.749 | 0.0 | |
| 449466825 | 513 | PREDICTED: aspartic proteinase-like [Cuc | 0.998 | 1.0 | 0.739 | 0.0 | |
| 449454758 | 514 | PREDICTED: aspartic proteinase-like [Cuc | 0.976 | 0.976 | 0.748 | 0.0 |
| >gi|255578112|ref|XP_002529926.1| Aspartic proteinase precursor, putative [Ricinus communis] gi|223530603|gb|EEF32480.1| Aspartic proteinase precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 909 bits (2349), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 428/517 (82%), Positives = 472/517 (91%), Gaps = 6/517 (1%)
Query: 1 MGMVFKSITAGFFLCLLLFPVVFSTP---NGGLYRIGLKKRKFDLNNRVAARLDSKEGES 57
MG +FK F CL+L P+V +T N GL RIGLKKRKFD NNRVAA+ +SKEGE+
Sbjct: 1 MGTIFK---PALFFCLILLPLVCATASSSNDGLVRIGLKKRKFDQNNRVAAQFESKEGEA 57
Query: 58 FRTSIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVP 117
FR SI+KY +RGNLG++ D DIV+LKNYMDAQYFGEIGIGTPPQ FTVIFDTGSSNLWVP
Sbjct: 58 FRASIKKYHIRGNLGDAEDIDIVSLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVP 117
Query: 118 SSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQE 177
SSKCYFS+ACYFHSKY+SG+SSTYKKNGKSADIHYGTGAISGFFS+D+VK+G+LV+K+QE
Sbjct: 118 SSKCYFSVACYFHSKYKSGQSSTYKKNGKSADIHYGTGAISGFFSQDNVKVGELVIKNQE 177
Query: 178 FIEATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNAD 237
FIEATREPS+TFL+AKFDGILGLGFQEISVG AVPVWYNMVNQGLV EPVFSFWFNRNAD
Sbjct: 178 FIEATREPSITFLVAKFDGILGLGFQEISVGNAVPVWYNMVNQGLVKEPVFSFWFNRNAD 237
Query: 238 EEEGGEIVFGGMDPDHYKGEHTYVPVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSG 297
E+EGGEIVFGGMDP+HYKGEHTYVPVTQKGYWQFDMGDV+IDG+TTG C+ GCAAIADSG
Sbjct: 238 EDEGGEIVFGGMDPNHYKGEHTYVPVTQKGYWQFDMGDVLIDGKTTGICSSGCAAIADSG 297
Query: 298 TSLLAGPTTIITQVNHAIGATGIVSQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCT 357
TSLLAGPTTIIT+VNHAIGATG+VSQECKAVV+QYGE II MLLAKD+PQKICSQIGLCT
Sbjct: 298 TSLLAGPTTIITEVNHAIGATGVVSQECKAVVAQYGETIIAMLLAKDQPQKICSQIGLCT 357
Query: 358 FDGSRGVSMGIESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNE 417
FDGSRGVSMGIESVV E +GG HDAMCSTCEMAVVWMQNQLKQNQTQE ILNYVNE
Sbjct: 358 FDGSRGVSMGIESVVNEKIQEVAGGLHDAMCSTCEMAVVWMQNQLKQNQTQEHILNYVNE 417
Query: 418 LCDRLPSPMGESAVDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSAL 477
LC+RLPSPMGESAVDC LS++P VSFTIGG++FDL P+QY+LKVG+G+AAQCISGF+AL
Sbjct: 418 LCERLPSPMGESAVDCGSLSTMPNVSFTIGGRVFDLAPEQYVLKVGDGEAAQCISGFTAL 477
Query: 478 DVAPPRGPLWILGDVFMGPYHTVFDYSNMRVGFAEAA 514
DV PPRGPLWILGDVFMGP+HTVFDY N RVGFAE A
Sbjct: 478 DVPPPRGPLWILGDVFMGPFHTVFDYGNKRVGFAEVA 514
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|21616051|emb|CAC86003.1| aspartic proteinase [Theobroma cacao] | Back alignment and taxonomy information |
|---|
| >gi|224056377|ref|XP_002298827.1| predicted protein [Populus trichocarpa] gi|222846085|gb|EEE83632.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|261264941|gb|ACX55829.1| aspartic proteinase 1 [Castanea mollissima] | Back alignment and taxonomy information |
|---|
| >gi|359483345|ref|XP_003632941.1| PREDICTED: aspartic proteinase isoform 2 [Vitis vinifera] gi|359483347|ref|XP_002262915.2| PREDICTED: aspartic proteinase isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|261264943|gb|ACX55830.1| aspartic proteinase 2 [Castanea mollissima] | Back alignment and taxonomy information |
|---|
| >gi|225460913|ref|XP_002279049.1| PREDICTED: aspartic proteinase [Vitis vinifera] gi|297737462|emb|CBI26663.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|21616053|emb|CAC86004.1| aspartic proteinase [Theobroma cacao] | Back alignment and taxonomy information |
|---|
| >gi|449466825|ref|XP_004151126.1| PREDICTED: aspartic proteinase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449454758|ref|XP_004145121.1| PREDICTED: aspartic proteinase-like [Cucumis sativus] gi|449472326|ref|XP_004153558.1| PREDICTED: aspartic proteinase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 514 | ||||||
| UNIPROTKB|B9RXH6 | 511 | RCOM_0903730 "Aspartic protein | 0.994 | 1.0 | 0.725 | 2.3e-213 | |
| TAIR|locus:2008940 | 506 | APA1 "aspartic proteinase A1" | 0.933 | 0.948 | 0.745 | 4.1e-207 | |
| TAIR|locus:2018037 | 513 | AT1G62290 [Arabidopsis thalian | 0.994 | 0.996 | 0.675 | 5.8e-201 | |
| TAIR|locus:2137189 | 508 | AT4G04460 [Arabidopsis thalian | 0.933 | 0.944 | 0.672 | 2.2e-185 | |
| FB|FBgn0029093 | 392 | cathD "cathD" [Drosophila mela | 0.476 | 0.625 | 0.558 | 6e-97 | |
| UNIPROTKB|O93428 | 396 | ctsd "Cathepsin D" [Chionodrac | 0.566 | 0.734 | 0.480 | 3.3e-96 | |
| UNIPROTKB|Q05744 | 398 | CTSD "Cathepsin D" [Gallus gal | 0.566 | 0.731 | 0.469 | 5.4e-96 | |
| RGD|621511 | 407 | Ctsd "cathepsin D" [Rattus nor | 0.571 | 0.722 | 0.470 | 1.8e-95 | |
| MGI|MGI:88562 | 410 | Ctsd "cathepsin D" [Mus muscul | 0.564 | 0.707 | 0.458 | 9.9e-95 | |
| ZFIN|ZDB-GENE-010131-8 | 399 | ctsd "cathepsin D" [Danio reri | 0.564 | 0.726 | 0.472 | 2.1e-94 |
| UNIPROTKB|B9RXH6 RCOM_0903730 "Aspartic proteinase, putative" [Ricinus communis (taxid:3988)] | Back alignment and assigned GO terms |
|---|
Score = 2062 (730.9 bits), Expect = 2.3e-213, P = 2.3e-213
Identities = 373/514 (72%), Positives = 439/514 (85%)
Query: 1 MGMVFKSITAGXXXXXXXXXXXXSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRT 60
MG FK + S PN GL R+GLKK K D N+R+AARL+SK E+ R
Sbjct: 1 MGTNFKPLVLFLFLSSLLSSLVSSAPNDGLVRLGLKKMKLDENSRLAARLESKNAEALRA 60
Query: 61 SIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSK 120
S+RKY LRG +S D DIVALKNY+DAQY+GEIGIGTPPQ FTV+FDTGSSNLWVPSSK
Sbjct: 61 SVRKYGLRG---DSKDTDIVALKNYLDAQYYGEIGIGTPPQKFTVVFDTGSSNLWVPSSK 117
Query: 121 CYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIE 180
C FS+AC+FHS+Y+SG+SSTYKKNGKSA+IHYG+GAISGFFS D+V +G+LVVKDQEFIE
Sbjct: 118 CIFSVACFFHSRYKSGQSSTYKKNGKSAEIHYGSGAISGFFSSDNVVVGNLVVKDQEFIE 177
Query: 181 ATREPSLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEE 240
AT+EP +TF+ AKFDGILGLGFQEISVG AVPVWYNM+ QGL+ EPVFSFW NRN EE
Sbjct: 178 ATKEPGVTFVAAKFDGILGLGFQEISVGNAVPVWYNMIKQGLIKEPVFSFWLNRNTQGEE 237
Query: 241 GGEIVFGGMDPDHYKGEHTYVPVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSL 300
GGEIVFGG+D +HYKG+HTYVPVTQKGYWQF+MGDV+I + T +CAGGC+AIADSGTSL
Sbjct: 238 GGEIVFGGVDLNHYKGKHTYVPVTQKGYWQFEMGDVLIGHKPTEYCAGGCSAIADSGTSL 297
Query: 301 LAGPTTIITQVNHAIGATGIVSQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDG 360
LAGPTT++T +N AIGATG+ SQECK V++QYGE I+++L+A+ +P+KICSQIGLCTFDG
Sbjct: 298 LAGPTTVVTLINEAIGATGVASQECKTVIAQYGETIMDLLIAEAQPKKICSQIGLCTFDG 357
Query: 361 SRGVSMGIESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCD 420
+RGVSMGI+SVV +NN ++SG DAMCS CEM VVWMQNQL++NQTQ+RILNYVNELCD
Sbjct: 358 TRGVSMGIQSVVDDNNDKSSGIVRDAMCSACEMTVVWMQNQLRENQTQDRILNYVNELCD 417
Query: 421 RLPSPMGESAVDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVA 480
R+P+P+GES VDC +SS+P+VSFTIGGK+FDL+P +YILKVGEG AQCISGF ALDV
Sbjct: 418 RIPNPLGESIVDCGSISSMPVVSFTIGGKVFDLSPQEYILKVGEGAQAQCISGFMALDVP 477
Query: 481 PPRGPLWILGDVFMGPYHTVFDYSNMRVGFAEAA 514
PPRGPLWILGD+FMG YHTVFDY N+RVGFAEAA
Sbjct: 478 PPRGPLWILGDIFMGRYHTVFDYGNLRVGFAEAA 511
|
|
| TAIR|locus:2008940 APA1 "aspartic proteinase A1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018037 AT1G62290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2137189 AT4G04460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0029093 cathD "cathD" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O93428 ctsd "Cathepsin D" [Chionodraco hamatus (taxid:36188)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05744 CTSD "Cathepsin D" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|621511 Ctsd "cathepsin D" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88562 Ctsd "cathepsin D" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-010131-8 ctsd "cathepsin D" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 514 | |||
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 0.0 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 1e-115 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 1e-105 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 2e-99 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 5e-99 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 7e-92 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 2e-88 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 4e-85 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 4e-83 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 9e-79 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 7e-60 | |
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 3e-51 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 8e-45 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 2e-43 | |
| cd05470 | 109 | cd05470, pepsin_retropepsin_like, Cellular and ret | 3e-38 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 1e-34 | |
| cd06097 | 278 | cd06097, Aspergillopepsin_like, Aspergillopepsin_l | 3e-34 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 2e-32 | |
| cd05474 | 295 | cd05474, SAP_like, SAPs, pepsin-like proteinases s | 3e-28 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 1e-26 | |
| cd05473 | 364 | cd05473, beta_secretase_like, Beta-secretase, aspa | 9e-26 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 8e-24 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 1e-20 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 8e-20 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 1e-19 | |
| cd06096 | 326 | cd06096, Plasmepsin_5, Plasmepsins are a class of | 2e-17 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 3e-17 | |
| pfam05184 | 39 | pfam05184, SapB_1, Saposin-like type B, region 1 | 5e-14 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 4e-13 | |
| pfam03489 | 35 | pfam03489, SapB_2, Saposin-like type B, region 2 | 6e-12 | |
| cd05476 | 265 | cd05476, pepsin_A_like_plant, Chroloplast Nucleoid | 1e-09 | |
| smart00741 | 76 | smart00741, SapB, Saposin (B) Domains | 2e-08 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 1e-07 | |
| cd05472 | 299 | cd05472, cnd41_like, Chloroplast Nucleoids DNA-bin | 1e-06 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 2e-06 | |
| smart00741 | 76 | smart00741, SapB, Saposin (B) Domains | 1e-05 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 6e-05 | |
| PLN03146 | 431 | PLN03146, PLN03146, aspartyl protease family prote | 6e-05 | |
| cd05475 | 273 | cd05475, nucellin_like, Nucellins, plant aspartic | 0.002 |
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
Score = 528 bits (1362), Expect = 0.0
Identities = 202/243 (83%), Positives = 222/243 (91%)
Query: 80 VALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSS 139
VALKNY+DAQYFGEIGIGTPPQ FTVIFDTGSSNLWVPSSKCYFSIACYFHSKY+S +SS
Sbjct: 1 VALKNYLDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYKSSKSS 60
Query: 140 TYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILG 199
TYKKNG SA I YGTG+ISGFFS+D V +GDLVVK+Q FIEAT+EP LTFLLAKFDGILG
Sbjct: 61 TYKKNGTSASIQYGTGSISGFFSQDSVTVGDLVVKNQVFIEATKEPGLTFLLAKFDGILG 120
Query: 200 LGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHT 259
LGFQEISVGKAVPVWYNMV QGLV EPVFSFW NRN DEEEGGE+VFGG+DP H+KGEHT
Sbjct: 121 LGFQEISVGKAVPVWYNMVEQGLVKEPVFSFWLNRNPDEEEGGELVFGGVDPKHFKGEHT 180
Query: 260 YVPVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATG 319
YVPVT+KGYWQF+MGDV+I G++TGFCAGGCAAIADSGTSLLAGPTTI+TQ+N A+
Sbjct: 181 YVPVTRKGYWQFEMGDVLIGGKSTGFCAGGCAAIADSGTSLLAGPTTIVTQINSAVDCNS 240
Query: 320 IVS 322
+ S
Sbjct: 241 LSS 243
|
Phytepsin, a plant homolog of mammalian lysosomal pepsins, resides in grains, roots, stems, leaves and flowers. Phytepsin may participate in metabolic turnover and in protein processing events. In addition, it highly expressed in several plant tissues undergoing apoptosis. Phytepsin contains an internal region consisting of about 100 residues not present in animal or microbial pepsins. This region is thus called a plant specific insert. The insert is highly similar to saponins, which are lysosomal sphingolipid-activating proteins in mammalian cells. The saponin-like domain may have a role in the vacuolar targeting of phytepsin. Phytepsin, as its animal counterparts, possesses a topology typical of all aspartic proteases. They are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA). Length = 317 |
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133137 cd05470, pepsin_retropepsin_like, Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133161 cd06097, Aspergillopepsin_like, Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133140 cd05473, beta_secretase_like, Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133160 cd06096, Plasmepsin_5, Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|191220 pfam05184, SapB_1, Saposin-like type B, region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|112314 pfam03489, SapB_2, Saposin-like type B, region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133143 cd05476, pepsin_A_like_plant, Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >gnl|CDD|214797 smart00741, SapB, Saposin (B) Domains | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133139 cd05472, cnd41_like, Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|214797 smart00741, SapB, Saposin (B) Domains | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178691 PLN03146, PLN03146, aspartyl protease family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133142 cd05475, nucellin_like, Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 514 | |||
| PTZ00165 | 482 | aspartyl protease; Provisional | 100.0 | |
| cd05490 | 325 | Cathepsin_D2 Cathepsin_D2, pepsin family of protei | 100.0 | |
| cd06098 | 317 | phytepsin Phytepsin, a plant homolog of mammalian | 100.0 | |
| cd05487 | 326 | renin_like Renin stimulates production of angioten | 100.0 | |
| cd05486 | 316 | Cathespin_E Cathepsin E, non-lysosomal aspartic pr | 100.0 | |
| cd05485 | 329 | Cathepsin_D_like Cathepsin_D_like, pepsin family o | 100.0 | |
| cd05478 | 317 | pepsin_A Pepsin A, aspartic protease produced in g | 100.0 | |
| cd05488 | 320 | Proteinase_A_fungi Fungal Proteinase A , aspartic | 100.0 | |
| cd05477 | 318 | gastricsin Gastricsins, asparate proteases produce | 100.0 | |
| PTZ00147 | 453 | plasmepsin-1; Provisional | 100.0 | |
| PTZ00013 | 450 | plasmepsin 4 (PM4); Provisional | 100.0 | |
| PF00026 | 317 | Asp: Eukaryotic aspartyl protease The Prosite entr | 100.0 | |
| cd06097 | 278 | Aspergillopepsin_like Aspergillopepsin_like, aspar | 100.0 | |
| PLN03146 | 431 | aspartyl protease family protein; Provisional | 100.0 | |
| cd05473 | 364 | beta_secretase_like Beta-secretase, aspartic-acid | 100.0 | |
| KOG1339 | 398 | consensus Aspartyl protease [Posttranslational mod | 100.0 | |
| cd06096 | 326 | Plasmepsin_5 Plasmepsins are a class of aspartic p | 100.0 | |
| cd05474 | 295 | SAP_like SAPs, pepsin-like proteinases secreted fr | 100.0 | |
| cd05472 | 299 | cnd41_like Chloroplast Nucleoids DNA-binding Prote | 100.0 | |
| cd05471 | 283 | pepsin_like Pepsin-like aspartic proteases, biloba | 100.0 | |
| cd05476 | 265 | pepsin_A_like_plant Chroloplast Nucleoids DNA-bind | 100.0 | |
| cd05475 | 273 | nucellin_like Nucellins, plant aspartic proteases | 100.0 | |
| cd05489 | 362 | xylanase_inhibitor_I_like TAXI-I inhibits degradat | 100.0 | |
| cd05470 | 109 | pepsin_retropepsin_like Cellular and retroviral pe | 99.87 | |
| PF14543 | 164 | TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A | 99.86 | |
| PF14541 | 161 | TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D | 99.78 | |
| cd05483 | 96 | retropepsin_like_bacteria Bacterial aspartate prot | 97.99 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 97.3 | |
| PF05184 | 39 | SapB_1: Saposin-like type B, region 1; InterPro: I | 97.12 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 96.53 | |
| PF11925 | 370 | DUF3443: Protein of unknown function (DUF3443); In | 96.32 | |
| COG3577 | 215 | Predicted aspartyl protease [General function pred | 95.77 | |
| PF03489 | 35 | SapB_2: Saposin-like type B, region 2; InterPro: I | 95.6 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 95.32 | |
| cd05484 | 91 | retropepsin_like_LTR_2 Retropepsins_like_LTR, peps | 93.98 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 93.47 | |
| PF08284 | 135 | RVP_2: Retroviral aspartyl protease; InterPro: IPR | 92.41 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 92.15 | |
| cd06095 | 86 | RP_RTVL_H_like Retropepsin of the RTVL_H family of | 92.08 | |
| TIGR03698 | 107 | clan_AA_DTGF clan AA aspartic protease, AF_0612 fa | 86.65 | |
| PF13975 | 72 | gag-asp_proteas: gag-polyprotein putative aspartyl | 84.64 | |
| smart00741 | 76 | SapB Saposin (B) Domains. Present in multiple copi | 82.45 |
| >PTZ00165 aspartyl protease; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.8e-64 Score=525.85 Aligned_cols=324 Identities=40% Similarity=0.756 Sum_probs=287.1
Q ss_pred CccEEeceeccCceEEEEEEecCCCceEEEEeeCCCCceeeeCCCCCCCcccCCCCcccCCCCCccee--CCc---eEEE
Q 010235 76 DADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKK--NGK---SADI 150 (514)
Q Consensus 76 ~~~~~~l~n~~~~~Y~~~i~iGtP~Q~~~v~~DTGSs~~wv~~~~C~~~~~C~~~~~y~~~~SsT~~~--~~~---~~~~ 150 (514)
.....||.|+.|.+|+++|+||||||+|.|++||||+++||++..|. ...|..++.|+|++|+||+. .+. .+.+
T Consensus 107 ~~~~~~l~n~~d~~Y~~~I~IGTPpQ~f~Vv~DTGSS~lWVps~~C~-~~~C~~~~~yd~s~SSTy~~~~~~~~~~~~~i 185 (482)
T PTZ00165 107 QYLQQDLLNFHNSQYFGEIQVGTPPKSFVVVFDTGSSNLWIPSKECK-SGGCAPHRKFDPKKSSTYTKLKLGDESAETYI 185 (482)
T ss_pred cccceecccccCCeEEEEEEeCCCCceEEEEEeCCCCCEEEEchhcC-cccccccCCCCccccCCcEecCCCCccceEEE
Confidence 34679999999999999999999999999999999999999999997 56899999999999999998 555 6789
Q ss_pred EeccceEEEEEEEEEEEECceeecccEEEEEEeeCCcccccccceeeeeccccccc---CCCCCcHHHHHHHcCCCCCCE
Q 010235 151 HYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEIS---VGKAVPVWYNMVNQGLVNEPV 227 (514)
Q Consensus 151 ~Y~~G~~~G~~~~D~v~ig~~~~~~~~fg~~~~~~~~~~~~~~~~GilGLg~~~~s---~~~~~~~~~~l~~qg~i~~~~ 227 (514)
.|++|++.|.+++|+|++|+..+++|.||+++..++..|....+|||||||++..+ .....|++++|++||+|++++
T Consensus 186 ~YGsGs~~G~l~~DtV~ig~l~i~~q~FG~a~~~s~~~f~~~~~DGILGLg~~~~s~~s~~~~~p~~~~l~~qgli~~~~ 265 (482)
T PTZ00165 186 QYGTGECVLALGKDTVKIGGLKVKHQSIGLAIEESLHPFADLPFDGLVGLGFPDKDFKESKKALPIVDNIKKQNLLKRNI 265 (482)
T ss_pred EeCCCcEEEEEEEEEEEECCEEEccEEEEEEEeccccccccccccceeecCCCcccccccCCCCCHHHHHHHcCCcccce
Confidence 99999999999999999999999999999999876655667788999999998873 344688999999999999999
Q ss_pred EEEEecCCCCCCCCcEEEECccCCCCC--ccceeEEeccCccceEEEeceEEEcCeeeeeecCCceEEEcCCCCCcccCH
Q 010235 228 FSFWFNRNADEEEGGEIVFGGMDPDHY--KGEHTYVPVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPT 305 (514)
Q Consensus 228 FSl~l~~~~~~~~~G~L~fGg~d~~~~--~g~l~~~p~~~~~~w~v~l~~i~v~~~~~~~~~~~~~aiiDSGtt~~~lP~ 305 (514)
||+||.+..+ .+|+|+|||+|+.++ .|++.|+|+...++|.|.+++|+++++.+..+.....+++||||+++++|.
T Consensus 266 FS~yL~~~~~--~~G~l~fGGiD~~~~~~~g~i~~~Pv~~~~yW~i~l~~i~vgg~~~~~~~~~~~aIiDTGTSli~lP~ 343 (482)
T PTZ00165 266 FSFYMSKDLN--QPGSISFGSADPKYTLEGHKIWWFPVISTDYWEIEVVDILIDGKSLGFCDRKCKAAIDTGSSLITGPS 343 (482)
T ss_pred EEEEeccCCC--CCCEEEeCCcCHHHcCCCCceEEEEccccceEEEEeCeEEECCEEeeecCCceEEEEcCCCccEeCCH
Confidence 9999986532 379999999999776 578999999999999999999999998877666678999999999999999
Q ss_pred HHHHHHHHHhcCccccccchhhhhhhhhHHHHHHhhccCCccchhccCcccccCCCCCcccccccccccCCcCCCCCCCC
Q 010235 306 TIITQVNHAIGATGIVSQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASGGFHD 385 (514)
Q Consensus 306 ~~~~~l~~~l~~~~~~~~~c~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 385 (514)
+++++|.+++++.
T Consensus 344 ~~~~~i~~~i~~~------------------------------------------------------------------- 356 (482)
T PTZ00165 344 SVINPLLEKIPLE------------------------------------------------------------------- 356 (482)
T ss_pred HHHHHHHHHcCCc-------------------------------------------------------------------
Confidence 9999999988653
Q ss_pred cccchhHHHHHHHHHhhhhhhhHHHHHHhhhhhcccCCCCCCCeeecCCCCCCCCcEEEEECCE-----EEEeCccccee
Q 010235 386 AMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPIVSFTIGGK-----IFDLTPDQYIL 460 (514)
Q Consensus 386 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~C~~~~~~P~i~f~~gg~-----~~~i~~~~y~~ 460 (514)
.+|+.+..+|+|+|+|+|. +|.++|++|++
T Consensus 357 ---------------------------------------------~~C~~~~~lP~itf~f~g~~g~~v~~~l~p~dYi~ 391 (482)
T PTZ00165 357 ---------------------------------------------EDCSNKDSLPRISFVLEDVNGRKIKFDMDPEDYVI 391 (482)
T ss_pred ---------------------------------------------ccccccccCCceEEEECCCCCceEEEEEchHHeee
Confidence 2677777899999999864 89999999999
Q ss_pred eec--CCCCceeeeeeEecccCCCCCCeeeeChhhhcCeEEEEECCCCeEEEEEcC
Q 010235 461 KVG--EGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVFDYSNMRVGFAEAA 514 (514)
Q Consensus 461 ~~~--~~~~~~C~~~i~~~~~~~~~~~~~iLG~~fl~~~y~vfD~~~~riGfa~a~ 514 (514)
+.. ..+.+.|+++|+..+.+.+.++.||||++|||++|+|||.+|+|||||+++
T Consensus 392 ~~~~~~~~~~~C~~g~~~~d~~~~~g~~~ILGd~Flr~yy~VFD~~n~rIGfA~a~ 447 (482)
T PTZ00165 392 EEGDSEEQEHQCVIGIIPMDVPAPRGPLFVLGNNFIRKYYSIFDRDHMMVGLVPAK 447 (482)
T ss_pred ecccCCCCCCeEEEEEEECCCCCCCCceEEEchhhheeEEEEEeCCCCEEEEEeec
Confidence 742 334568999999887665566889999999999999999999999999974
|
|
| >cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >PTZ00147 plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >PTZ00013 plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 | Back alignment and domain information |
|---|
| >cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >PLN03146 aspartyl protease family protein; Provisional | Back alignment and domain information |
|---|
| >cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >KOG1339 consensus Aspartyl protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase | Back alignment and domain information |
|---|
| >cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation | Back alignment and domain information |
|---|
| >cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall | Back alignment and domain information |
|---|
| >cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF14543 TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A 3VLB_A 3VLA_A 3AUP_D 1T6G_A 1T6E_X 2B42_A | Back alignment and domain information |
|---|
| >PF14541 TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D 3HD8_A 1T6G_A 1T6E_X 2B42_A 3VLB_A 3VLA_A | Back alignment and domain information |
|---|
| >cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >PF05184 SapB_1: Saposin-like type B, region 1; InterPro: IPR007856 Synonym(s):cerebroside sulphate activator, CSAct Saposin B is a small non-enzymatic glycoprotein required for the breakdown of cerebroside sulphates (sulphatides) in lysosomes | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
| >PF11925 DUF3443: Protein of unknown function (DUF3443); InterPro: IPR021847 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >COG3577 Predicted aspartyl protease [General function prediction only] | Back alignment and domain information |
|---|
| >PF03489 SapB_2: Saposin-like type B, region 2; InterPro: IPR008138 Saposins are small lysosomal proteins that serve as activators of various lysosomal lipid-degrading enzymes [] | Back alignment and domain information |
|---|
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements | Back alignment and domain information |
|---|
| >TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family | Back alignment and domain information |
|---|
| >PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease | Back alignment and domain information |
|---|
| >smart00741 SapB Saposin (B) Domains | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 514 | ||||
| 1qdm_A | 478 | Crystal Structure Of Prophytepsin, A Zymogen Of A B | 0.0 | ||
| 1b5f_A | 239 | Native Cardosin A From Cynara Cardunculus L. Length | 4e-93 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 6e-64 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 1e-12 | ||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 2e-63 | ||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 3e-17 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 3e-63 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 1e-12 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 4e-63 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 1e-12 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 4e-63 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 1e-12 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 4e-63 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 1e-12 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 5e-63 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 1e-12 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 3e-62 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 1e-12 | ||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 1e-60 | ||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 4e-10 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 2e-60 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 4e-10 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 2e-60 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 4e-10 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 2e-58 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 1e-14 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 9e-58 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 6e-12 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 1e-56 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 2e-14 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 1e-56 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 9e-15 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 6e-56 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 3e-16 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 6e-56 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 5e-16 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 6e-56 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 5e-16 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 7e-56 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 4e-16 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 8e-56 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 4e-16 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 8e-56 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 5e-16 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 9e-56 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 6e-16 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 1e-54 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 2e-11 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 3e-54 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 2e-11 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 3e-54 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 2e-11 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 2e-49 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 5e-13 | ||
| 3oad_C | 166 | Design And Optimization Of New Piperidines As Renin | 4e-45 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 2e-38 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 4e-06 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 1e-36 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 4e-04 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 4e-35 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 3e-05 | ||
| 1ls5_A | 328 | Crystal Structure Of Plasmepsin Iv From P. Falcipar | 2e-34 | ||
| 1ls5_A | 328 | Crystal Structure Of Plasmepsin Iv From P. Falcipar | 2e-04 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 2e-34 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 5e-05 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 7e-34 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 2e-24 | ||
| 2bju_A | 453 | Plasmepsin Ii Complexed With A Highly Active Achira | 3e-33 | ||
| 2bju_A | 453 | Plasmepsin Ii Complexed With A Highly Active Achira | 2e-06 | ||
| 1pfz_A | 380 | Proplasmepsin Ii From Plasmodium Falciparum Length | 5e-33 | ||
| 1pfz_A | 380 | Proplasmepsin Ii From Plasmodium Falciparum Length | 2e-06 | ||
| 1m43_A | 331 | Crystal Structure Of Pmii In Complex With Pepstatin | 6e-33 | ||
| 1m43_A | 331 | Crystal Structure Of Pmii In Complex With Pepstatin | 3e-06 | ||
| 1lf3_A | 331 | Crystal Structure Of Plasmepsin Ii From P Falciparu | 7e-33 | ||
| 1lf3_A | 331 | Crystal Structure Of Plasmepsin Ii From P Falciparu | 3e-06 | ||
| 3f9q_A | 329 | Re-Refinement Of Uncomplexed Plasmepsin Ii From Pla | 1e-32 | ||
| 3f9q_A | 329 | Re-Refinement Of Uncomplexed Plasmepsin Ii From Pla | 3e-06 | ||
| 1sme_A | 329 | Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From P | 1e-32 | ||
| 1sme_A | 329 | Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From P | 3e-06 | ||
| 1b5f_B | 87 | Native Cardosin A From Cynara Cardunculus L. Length | 3e-31 | ||
| 1lyw_A | 97 | Cathepsin D At Ph 7.5 Length = 97 | 2e-30 | ||
| 1uh7_A | 325 | Crystal Structure Of Rhizopuspepsin At Ph 4.6 Lengt | 2e-28 | ||
| 3apr_E | 325 | Binding Of A Reduced Peptide Inhibitor To The Aspar | 2e-28 | ||
| 3rfi_A | 108 | Crystal Structure Of The Saposin-Like Domain Of Pla | 2e-27 | ||
| 3fns_A | 332 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 7e-24 | ||
| 3fns_A | 332 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 5e-06 | ||
| 3qvc_A | 451 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 8e-24 | ||
| 3qvc_A | 451 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 3e-06 | ||
| 2rmp_A | 361 | Rmp-Pepstatin A Complex Length = 361 | 5e-23 | ||
| 2ewy_A | 383 | Crystal Structure Of Human Bace2 In Complex With A | 1e-19 | ||
| 1mpp_A | 361 | X-Ray Analyses Of Aspartic Proteinases. V. Structur | 3e-19 | ||
| 3liz_A | 334 | Crystal Structure Of Bla G 2 Complexed With Fab 4c3 | 8e-19 | ||
| 3liz_A | 334 | Crystal Structure Of Bla G 2 Complexed With Fab 4c3 | 2e-05 | ||
| 1yg9_A | 330 | The Structure Of Mutant (N93q) Of Bla G 2 Length = | 9e-19 | ||
| 1yg9_A | 330 | The Structure Of Mutant (N93q) Of Bla G 2 Length = | 2e-05 | ||
| 2qzx_A | 342 | Secreted Aspartic Proteinase (Sap) 5 From Candida A | 3e-18 | ||
| 1wkr_A | 340 | Crystal Structure Of Aspartic Proteinase From Irpex | 6e-18 | ||
| 1j71_A | 334 | Structure Of The Extracellular Aspartic Proteinase | 1e-16 | ||
| 3fv3_A | 339 | Secreted Aspartic Protease 1 From Candida Parapsilo | 2e-16 | ||
| 2h6s_A | 340 | Secreted Aspartic Proteinase (sap) 3 From Candida A | 6e-15 | ||
| 1zap_A | 342 | Secreted Aspartic Protease From C. Albicans Length | 2e-14 | ||
| 1eag_A | 342 | Secreted Aspartic Proteinase (Sap2) From Candida Al | 2e-14 | ||
| 2qzw_A | 341 | Secreted Aspartic Proteinase (Sap) 1 From Candida A | 4e-14 | ||
| 1tqf_A | 405 | Crystal Structure Of Human Beta Secretase Complexed | 6e-14 | ||
| 3exo_A | 413 | Crystal Structure Of Bace1 Bound To Inhibitor Lengt | 6e-14 | ||
| 2qzl_A | 411 | Crystal Structure Of Human Beta Secretase Complexed | 7e-14 | ||
| 3tpj_A | 433 | Apo Structure Of Bace1 Length = 433 | 7e-14 | ||
| 3qi1_A | 408 | Design And Synthesis Of Hydroxyethylamine (Hea) Bac | 8e-14 | ||
| 2zjj_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 2e-13 | ||
| 3dm6_A | 406 | Beta-Secretase 1 Complexed With Statine-Based Inhib | 3e-13 | ||
| 2zjn_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-13 | ||
| 2zji_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-13 | ||
| 3l58_A | 414 | Structure Of Bace Bound To Sch589432 Length = 414 | 3e-13 | ||
| 3ixk_A | 405 | Potent Beta-Secretase 1 Inhibitor Length = 405 | 3e-13 | ||
| 2zjh_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-13 | ||
| 3vv6_A | 416 | Crystal Structure Of Beta Secetase In Complex With | 3e-13 | ||
| 2hm1_A | 406 | Crystal Structure Of Human Beta-Secretase (Bace) In | 3e-13 | ||
| 4ewo_A | 386 | Design And Synthesis Of Potent Hydroxyethylamine (H | 3e-13 | ||
| 3kmx_A | 395 | Structure Of Bace Bound To Sch346572 Length = 395 | 3e-13 | ||
| 2zhr_A | 411 | Crystal Structure Of Bace1 In Complex With Om99-2 A | 3e-13 | ||
| 3hvg_A | 411 | Structure Of Bace (Beta Secretase) In Complex With | 3e-13 | ||
| 1w50_A | 411 | Apo Structure Of Bace (beta Secretase) Length = 411 | 3e-13 | ||
| 3tpr_A | 433 | Crystal Structure Of Bace1 Complexed With An Inhibi | 3e-13 | ||
| 2va5_A | 455 | X-Ray Crystal Structure Of Beta Secretase Complexed | 3e-13 | ||
| 2hiz_A | 455 | Crystal Structure Of Human Beta-Secretase (Bace) In | 4e-13 | ||
| 3r1g_B | 402 | Structure Basis Of Allosteric Inhibition Of Bace1 B | 4e-13 | ||
| 2of0_A | 402 | X-Ray Crystal Structure Of Beta Secretase Complexed | 4e-13 | ||
| 1ym4_A | 408 | Crystal Structure Of Human Beta Secretase Complexed | 4e-13 | ||
| 3udh_A | 404 | Crystal Structure Of Bace With Compound 1 Length = | 4e-13 | ||
| 2zjk_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 4e-13 | ||
| 1ym2_A | 402 | Crystal Structure Of Human Beta Secretase Complexed | 4e-13 | ||
| 2qu2_A | 415 | Bace1 With Compound 1 Length = 415 | 4e-13 | ||
| 3ckp_A | 412 | Crystal Structure Of Bace-1 In Complex With Inhibit | 4e-13 | ||
| 3lpi_A | 455 | Structure Of Bace Bound To Sch745132 Length = 455 | 4e-13 | ||
| 2wjo_A | 412 | Human Bace (Beta Secretase) In Complex With Cyclohe | 4e-13 | ||
| 2qk5_A | 395 | Structure Of Bace1 Bound To Sch626485 Length = 395 | 4e-13 | ||
| 1fkn_A | 391 | Structure Of Beta-Secretase Complexed With Inhibito | 4e-13 | ||
| 4b1d_A | 388 | New Aminoimidazoles As Bace-1 Inhibitors: From Rati | 4e-13 | ||
| 4dpf_A | 391 | Bace-1 In Complex With A Hea-Macrocyclic Type Inhib | 4e-13 | ||
| 2fdp_A | 388 | Crystal Structure Of Beta-Secretase Complexed With | 4e-13 | ||
| 3u6a_A | 390 | Rational Design And Synthesis Of Aminopiperazinones | 4e-13 | ||
| 1sgz_A | 389 | Crystal Structure Of Unbound Beta-Secretase Catalyt | 4e-13 | ||
| 3cib_A | 390 | Structure Of Bace Bound To Sch727596 Length = 390 | 4e-13 | ||
| 3bra_A | 409 | Bace-1 Complexed With Compound 1 Length = 409 | 5e-13 | ||
| 2vie_A | 392 | Human Bace-1 In Complex With N-((1s,2r)-1-Benzyl-2- | 7e-13 | ||
| 2q15_A | 385 | Structure Of Bace Complexed To Compound 3a Length = | 8e-13 | ||
| 2q11_A | 388 | Structure Of Bace Complexed To Compound 1 Length = | 9e-13 | ||
| 3oad_B | 176 | Design And Optimization Of New Piperidines As Renin | 1e-12 | ||
| 1gkt_A | 329 | Neutron Laue Diffraction Structure Of Endothiapepsi | 5e-12 | ||
| 1gvt_A | 329 | Endothiapepsin Complex With Cp-80,794 Length = 329 | 5e-12 | ||
| 1epr_E | 330 | Endothia Aspartic Proteinase (Endothiapepsin) Compl | 1e-11 | ||
| 1er8_E | 330 | The Active Site Of Aspartic Proteinases Length = 33 | 1e-11 | ||
| 1ppl_E | 323 | Crystallographic Analysis Of Transition-State Mimic | 3e-11 | ||
| 1izd_A | 323 | Crystal Structure Of Aspergillus Oryzae Aspartic Pr | 4e-11 | ||
| 1ibq_A | 325 | Aspergillopepsin From Aspergillus Phoenicis Length | 2e-10 | ||
| 3c9x_A | 329 | Crystal Structure Of Trichoderma Reesei Aspartic Pr | 2e-09 | ||
| 4b1c_A | 375 | New Aminoimidazoles As Bace-1 Inhibitors: From Rati | 4e-09 |
| >pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley Vacuolar Aspartic Proteinase. Length = 478 | Back alignment and structure |
|
| >pdb|1B5F|A Chain A, Native Cardosin A From Cynara Cardunculus L. Length = 239 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A Length = 328 | Back alignment and structure |
| >pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A Length = 328 | Back alignment and structure |
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|2BJU|A Chain A, Plasmepsin Ii Complexed With A Highly Active Achiral Inhibitor Length = 453 | Back alignment and structure |
| >pdb|2BJU|A Chain A, Plasmepsin Ii Complexed With A Highly Active Achiral Inhibitor Length = 453 | Back alignment and structure |
| >pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium Falciparum Length = 380 | Back alignment and structure |
| >pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium Falciparum Length = 380 | Back alignment and structure |
| >pdb|1M43|A Chain A, Crystal Structure Of Pmii In Complex With Pepstatin A To 2.4 A Length = 331 | Back alignment and structure |
| >pdb|1M43|A Chain A, Crystal Structure Of Pmii In Complex With Pepstatin A To 2.4 A Length = 331 | Back alignment and structure |
| >pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin Ii From P Falciparum In Complex With Inhibitor Eh58 Length = 331 | Back alignment and structure |
| >pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin Ii From P Falciparum In Complex With Inhibitor Eh58 Length = 331 | Back alignment and structure |
| >pdb|3F9Q|A Chain A, Re-Refinement Of Uncomplexed Plasmepsin Ii From Plasmodium Falciparum Length = 329 | Back alignment and structure |
| >pdb|3F9Q|A Chain A, Re-Refinement Of Uncomplexed Plasmepsin Ii From Plasmodium Falciparum Length = 329 | Back alignment and structure |
| >pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From Plasmodium Falciparum, In Complex With Pepstatin A Length = 329 | Back alignment and structure |
| >pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From Plasmodium Falciparum, In Complex With Pepstatin A Length = 329 | Back alignment and structure |
| >pdb|1B5F|B Chain B, Native Cardosin A From Cynara Cardunculus L. Length = 87 | Back alignment and structure |
| >pdb|1LYW|A Chain A, Cathepsin D At Ph 7.5 Length = 97 | Back alignment and structure |
| >pdb|1UH7|A Chain A, Crystal Structure Of Rhizopuspepsin At Ph 4.6 Length = 325 | Back alignment and structure |
| >pdb|3APR|E Chain E, Binding Of A Reduced Peptide Inhibitor To The Aspartic Proteinase From Rhizopus Chinensis. Implications For A Mechanism Of Action Length = 325 | Back alignment and structure |
| >pdb|3RFI|A Chain A, Crystal Structure Of The Saposin-Like Domain Of Plant Aspartic Protease From Solanum Tuberosum Length = 108 | Back alignment and structure |
| >pdb|3FNS|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) From Plasmodium Falciparum Length = 332 | Back alignment and structure |
| >pdb|3FNS|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) From Plasmodium Falciparum Length = 332 | Back alignment and structure |
| >pdb|3QVC|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) Zymogen From Plasmodium Falciparum Length = 451 | Back alignment and structure |
| >pdb|3QVC|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) Zymogen From Plasmodium Falciparum Length = 451 | Back alignment and structure |
| >pdb|2RMP|A Chain A, Rmp-Pepstatin A Complex Length = 361 | Back alignment and structure |
| >pdb|2EWY|A Chain A, Crystal Structure Of Human Bace2 In Complex With A Hydroxyethylenamine Transition-State Inhibitor Length = 383 | Back alignment and structure |
| >pdb|1MPP|A Chain A, X-Ray Analyses Of Aspartic Proteinases. V. Structure And Refinement At 2.0 Angstroms Resolution Of The Aspartic Proteinase From Mucor Pusillus Length = 361 | Back alignment and structure |
| >pdb|3LIZ|A Chain A, Crystal Structure Of Bla G 2 Complexed With Fab 4c3 Length = 334 | Back alignment and structure |
| >pdb|3LIZ|A Chain A, Crystal Structure Of Bla G 2 Complexed With Fab 4c3 Length = 334 | Back alignment and structure |
| >pdb|1YG9|A Chain A, The Structure Of Mutant (N93q) Of Bla G 2 Length = 330 | Back alignment and structure |
| >pdb|1YG9|A Chain A, The Structure Of Mutant (N93q) Of Bla G 2 Length = 330 | Back alignment and structure |
| >pdb|2QZX|A Chain A, Secreted Aspartic Proteinase (Sap) 5 From Candida Albicans Length = 342 | Back alignment and structure |
| >pdb|1WKR|A Chain A, Crystal Structure Of Aspartic Proteinase From Irpex Lacteus Length = 340 | Back alignment and structure |
| >pdb|1J71|A Chain A, Structure Of The Extracellular Aspartic Proteinase From Candida Tropicalis Yeast Length = 334 | Back alignment and structure |
| >pdb|3FV3|A Chain A, Secreted Aspartic Protease 1 From Candida Parapsilosis In Complex With Pepstatin A Length = 339 | Back alignment and structure |
| >pdb|2H6S|A Chain A, Secreted Aspartic Proteinase (sap) 3 From Candida Albicans Length = 340 | Back alignment and structure |
| >pdb|1ZAP|A Chain A, Secreted Aspartic Protease From C. Albicans Length = 342 | Back alignment and structure |
| >pdb|1EAG|A Chain A, Secreted Aspartic Proteinase (Sap2) From Candida Albicans Complexed With A70450 Length = 342 | Back alignment and structure |
| >pdb|2QZW|A Chain A, Secreted Aspartic Proteinase (Sap) 1 From Candida Albicans Length = 341 | Back alignment and structure |
| >pdb|1TQF|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Inhibitor Length = 405 | Back alignment and structure |
| >pdb|3EXO|A Chain A, Crystal Structure Of Bace1 Bound To Inhibitor Length = 413 | Back alignment and structure |
| >pdb|2QZL|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Ixs Length = 411 | Back alignment and structure |
| >pdb|3TPJ|A Chain A, Apo Structure Of Bace1 Length = 433 | Back alignment and structure |
| >pdb|3QI1|A Chain A, Design And Synthesis Of Hydroxyethylamine (Hea) Bace-1 Inhibitors: Prime Side Chromane-Containing Inhibitors Length = 408 | Back alignment and structure |
| >pdb|2ZJJ|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With 4-(4-Fluoro-Benzyl)-Piperazine-2-Carboxylic Acid (2-Mercapto-Ethyl)- Amide Length = 405 | Back alignment and structure |
| >pdb|3DM6|A Chain A, Beta-Secretase 1 Complexed With Statine-Based Inhibitor Length = 406 | Back alignment and structure |
| >pdb|2ZJN|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-[1-(5-Chloro-2-Isopropoxy-3-Methoxy-Benzyl)- Piperidin-4-Yl]-2-(2-Methyl-4-Sulfamoyl-Phenoxy)- Acetamide Length = 405 | Back alignment and structure |
| >pdb|2ZJI|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-[1-(2, 6-Dimethoxy-Benzyl)-Piperidin-4-Yl]-4-Mercapto- Butyramide Length = 405 | Back alignment and structure |
| >pdb|3L58|A Chain A, Structure Of Bace Bound To Sch589432 Length = 414 | Back alignment and structure |
| >pdb|3IXK|A Chain A, Potent Beta-Secretase 1 Inhibitor Length = 405 | Back alignment and structure |
| >pdb|2ZJH|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-(1-Benzyl-Piperidin-4-Yl)-4-Mercapto-Butyramide Length = 405 | Back alignment and structure |
| >pdb|3VV6|A Chain A, Crystal Structure Of Beta Secetase In Complex With 2-Amino-3-Methyl-6- ((1s, 2r)-2-Phenylcyclopropyl)pyrimidin-4(3h)-One Length = 416 | Back alignment and structure |
| >pdb|2HM1|A Chain A, Crystal Structure Of Human Beta-Secretase (Bace) In The Presence Of An Inhibitor (2) Length = 406 | Back alignment and structure |
| >pdb|4EWO|A Chain A, Design And Synthesis Of Potent Hydroxyethylamine (Hea) Bace-1 Inhibitors Length = 386 | Back alignment and structure |
| >pdb|3KMX|A Chain A, Structure Of Bace Bound To Sch346572 Length = 395 | Back alignment and structure |
| >pdb|2ZHR|A Chain A, Crystal Structure Of Bace1 In Complex With Om99-2 At Ph 5.0 Length = 411 | Back alignment and structure |
| >pdb|3HVG|A Chain A, Structure Of Bace (Beta Secretase) In Complex With Ev0 Length = 411 | Back alignment and structure |
| >pdb|1W50|A Chain A, Apo Structure Of Bace (beta Secretase) Length = 411 | Back alignment and structure |
| >pdb|3TPR|A Chain A, Crystal Structure Of Bace1 Complexed With An Inhibitor Length = 433 | Back alignment and structure |
| >pdb|2VA5|A Chain A, X-Ray Crystal Structure Of Beta Secretase Complexed With Compound 8c Length = 455 | Back alignment and structure |
| >pdb|2HIZ|A Chain A, Crystal Structure Of Human Beta-Secretase (Bace) In The Presence Of An Inhibitor Length = 455 | Back alignment and structure |
| >pdb|3R1G|B Chain B, Structure Basis Of Allosteric Inhibition Of Bace1 By An Exosite- Binding Antibody Length = 402 | Back alignment and structure |
| >pdb|2OF0|A Chain A, X-Ray Crystal Structure Of Beta Secretase Complexed With Compound 5 Length = 402 | Back alignment and structure |
| >pdb|1YM4|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Nvp-Amk640 Length = 408 | Back alignment and structure |
| >pdb|3UDH|A Chain A, Crystal Structure Of Bace With Compound 1 Length = 404 | Back alignment and structure |
| >pdb|2ZJK|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With 4-(4-Fluoro-Benzyl)-Piperazine-2-Carboxylic Acid(3-Mercapto-Propyl)-Amide Length = 405 | Back alignment and structure |
| >pdb|1YM2|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Nvp-Aur200 Length = 402 | Back alignment and structure |
| >pdb|2QU2|A Chain A, Bace1 With Compound 1 Length = 415 | Back alignment and structure |
| >pdb|3CKP|A Chain A, Crystal Structure Of Bace-1 In Complex With Inhibitor Length = 412 | Back alignment and structure |
| >pdb|3LPI|A Chain A, Structure Of Bace Bound To Sch745132 Length = 455 | Back alignment and structure |
| >pdb|2WJO|A Chain A, Human Bace (Beta Secretase) In Complex With Cyclohexanecarboxylic Acid (2-(2-Am Ino-6-Phenoxy-4h- Quinazolin-3-Yl)-2-Cyclohexyl-Ethyl)-Amide Length = 412 | Back alignment and structure |
| >pdb|2QK5|A Chain A, Structure Of Bace1 Bound To Sch626485 Length = 395 | Back alignment and structure |
| >pdb|1FKN|A Chain A, Structure Of Beta-Secretase Complexed With Inhibitor Length = 391 | Back alignment and structure |
| >pdb|4B1D|A Chain A, New Aminoimidazoles As Bace-1 Inhibitors: From Rational Design To Ab-Lowering In Brain Length = 388 | Back alignment and structure |
| >pdb|4DPF|A Chain A, Bace-1 In Complex With A Hea-Macrocyclic Type Inhibitor Length = 391 | Back alignment and structure |
| >pdb|2FDP|A Chain A, Crystal Structure Of Beta-Secretase Complexed With An Amino- Ethylene Inhibitor Length = 388 | Back alignment and structure |
| >pdb|3U6A|A Chain A, Rational Design And Synthesis Of Aminopiperazinones As Beta Secretase (Bace) Inhibitors Length = 390 | Back alignment and structure |
| >pdb|1SGZ|A Chain A, Crystal Structure Of Unbound Beta-Secretase Catalytic Domain. Length = 389 | Back alignment and structure |
| >pdb|3CIB|A Chain A, Structure Of Bace Bound To Sch727596 Length = 390 | Back alignment and structure |
| >pdb|3BRA|A Chain A, Bace-1 Complexed With Compound 1 Length = 409 | Back alignment and structure |
| >pdb|2VIE|A Chain A, Human Bace-1 In Complex With N-((1s,2r)-1-Benzyl-2-Hydroxy- 3-((1,1, 5-Trimethylhexyl)amino)propyl)-3-(Ethylamino)-5-(2- Oxopyrrolidin-1-Yl)benzamide Length = 392 | Back alignment and structure |
| >pdb|2Q15|A Chain A, Structure Of Bace Complexed To Compound 3a Length = 385 | Back alignment and structure |
| >pdb|2Q11|A Chain A, Structure Of Bace Complexed To Compound 1 Length = 388 | Back alignment and structure |
| >pdb|3OAD|B Chain B, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 176 | Back alignment and structure |
| >pdb|1GKT|A Chain A, Neutron Laue Diffraction Structure Of Endothiapepsin Complexed With Transition State Analogue Inhibitor H261 Length = 329 | Back alignment and structure |
| >pdb|1GVT|A Chain A, Endothiapepsin Complex With Cp-80,794 Length = 329 | Back alignment and structure |
| >pdb|1EPR|E Chain E, Endothia Aspartic Proteinase (Endothiapepsin) Complexed With Pd-135, 040 Length = 330 | Back alignment and structure |
| >pdb|1ER8|E Chain E, The Active Site Of Aspartic Proteinases Length = 330 | Back alignment and structure |
| >pdb|1PPL|E Chain E, Crystallographic Analysis Of Transition-State Mimics Bound To Penicillopepsin: Phosphorus-Containing Peptide Analogues Length = 323 | Back alignment and structure |
| >pdb|1IZD|A Chain A, Crystal Structure Of Aspergillus Oryzae Aspartic Proteinase Length = 323 | Back alignment and structure |
| >pdb|1IBQ|A Chain A, Aspergillopepsin From Aspergillus Phoenicis Length = 325 | Back alignment and structure |
| >pdb|3C9X|A Chain A, Crystal Structure Of Trichoderma Reesei Aspartic Proteinase Length = 329 | Back alignment and structure |
| >pdb|4B1C|A Chain A, New Aminoimidazoles As Bace-1 Inhibitors: From Rational Design To Ab-Lowering In Brain Length = 375 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 514 | |||
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 0.0 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 1e-146 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 1e-141 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 2e-35 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 1e-139 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 1e-34 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 1e-138 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 3e-28 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 1e-138 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 1e-34 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 1e-138 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 3e-36 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 1e-135 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 5e-33 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 1e-135 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 3e-33 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 1e-135 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 5e-36 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 1e-134 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 8e-36 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 1e-132 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 2e-29 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 1e-131 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 4e-32 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 1e-131 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 2e-24 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 1e-124 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 2e-23 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 1e-123 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 2e-28 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 1e-123 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 9e-26 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 1e-118 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 4e-24 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 1e-115 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 4e-24 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 1e-114 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 5e-24 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 1e-112 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 2e-23 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 1e-112 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 1e-29 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 1e-108 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 3e-23 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 1e-108 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 1e-18 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 1e-106 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 2e-25 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 1e-105 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 5e-25 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 1e-101 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 1e-23 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 1e-100 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 2e-25 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 2e-96 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 1e-23 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 9e-79 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 8e-38 | |
| 3rfi_A | 108 | Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuber | 1e-47 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 1e-46 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 3e-40 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 2e-25 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 1e-08 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 1e-15 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 6e-11 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 2e-14 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 6e-11 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 3e-14 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 5e-11 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 1e-11 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 2e-08 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 3e-11 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 5e-06 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 1e-10 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 3e-05 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 8e-10 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 8e-05 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 1e-04 |
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 | Back alignment and structure |
|---|
Score = 639 bits (1649), Expect = 0.0
Identities = 348/483 (72%), Positives = 407/483 (84%), Gaps = 6/483 (1%)
Query: 32 RIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADIVALKNYMDAQYF 91
RI LKKR D N+RVA L E + S L + DIVALKNYM+AQYF
Sbjct: 2 RIALKKRPIDRNSRVATGLSGGEEQ------PLLSGANPLRSEEEGDIVALKNYMNAQYF 55
Query: 92 GEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIH 151
GEIG+GTPPQ FTVIFDTGSSNLWVPS+KCYFSIACY HS+Y++G SSTYKKNGK A I
Sbjct: 56 GEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKNGKPAAIQ 115
Query: 152 YGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLGFQEISVGKAV 211
YGTG+I+G+FSED V +GDLVVKDQEFIEAT+EP +TFL+AKFDGILGLGF+EISVGKAV
Sbjct: 116 YGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLGFKEISVGKAV 175
Query: 212 PVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHTYVPVTQKGYWQF 271
PVWY M+ QGLV++PVFSFW NR+ DE EGGEI+FGGMDP HY GEHTYVPVTQKGYWQF
Sbjct: 176 PVWYKMIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYVGEHTYVPVTQKGYWQF 235
Query: 272 DMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATGIVSQECKAVVSQ 331
DMGDV++ G++TGFCAGGCAAIADSGTSLLAGPT IIT++N IGA G+VSQECK +VSQ
Sbjct: 236 DMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQECKTIVSQ 295
Query: 332 YGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASGGFHDAMCSTC 391
YG++I+++LLA+ +P+KICSQ+GLCTFDG+RGVS GI SVV + +++G D MCS C
Sbjct: 296 YGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRADPMCSAC 355
Query: 392 EMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPIVSFTIGGKIF 451
EMAVVWMQNQL QN+TQ+ IL+YVN+LC+RLPSPMGESAVDC L S+P + FTIGGK F
Sbjct: 356 EMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCGSLGSMPDIEFTIGGKKF 415
Query: 452 DLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVFDYSNMRVGFA 511
L P++YILKVGEG AAQCISGF+A+D+ PPRGPLWILGDVFMGPYHTVFDY +R+GFA
Sbjct: 416 ALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRIGFA 475
Query: 512 EAA 514
+AA
Sbjct: 476 KAA 478
|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 239 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >3rfi_A Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuberosum} Length = 108 | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Length = 97 | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 87 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A Length = 80 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A Length = 80 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A Length = 83 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A Length = 83 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A Length = 91 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A Length = 91 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* Length = 83 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* Length = 83 | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Length = 381 | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Length = 381 | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 Length = 78 | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 Length = 78 | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Length = 413 | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Length = 413 | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 Length = 81 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A Length = 99 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 514 | |||
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 100.0 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 100.0 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 100.0 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 100.0 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 100.0 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 100.0 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 100.0 | |
| 4aa9_A | 320 | Chymosin; hydrolase, aspartic peptidase, rennet; H | 100.0 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 100.0 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 100.0 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 100.0 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 100.0 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 100.0 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 100.0 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 100.0 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 100.0 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 100.0 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 100.0 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 100.0 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 100.0 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 100.0 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 100.0 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 100.0 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 100.0 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 100.0 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 100.0 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 100.0 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 100.0 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 100.0 | |
| 3vf3_A | 402 | Beta-secretase 1; structure-based drug design, hyd | 100.0 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 100.0 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 100.0 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 100.0 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 100.0 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 100.0 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 99.89 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 99.83 | |
| 3rfi_A | 108 | Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuber | 99.54 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 96.37 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 96.25 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 95.92 | |
| 1l9l_A | 74 | Granulysin; saposin fold, membrane-lytic, antimicr | 95.01 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 94.9 | |
| 1of9_A | 77 | Pore-forming peptide ameobapore A; toxin, saplip, | 94.55 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 94.07 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 94.02 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 93.91 | |
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 93.86 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 92.66 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 92.53 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 92.27 | |
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 91.76 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 91.74 | |
| 1of9_A | 77 | Pore-forming peptide ameobapore A; toxin, saplip, | 91.49 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 91.39 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 89.26 | |
| 3s8i_A | 148 | Protein DDI1 homolog 1; protease, structural genom | 89.14 | |
| 3s8i_A | 148 | Protein DDI1 homolog 1; protease, structural genom | 88.09 | |
| 1l9l_A | 74 | Granulysin; saposin fold, membrane-lytic, antimicr | 88.02 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 87.97 |
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-85 Score=696.38 Aligned_cols=478 Identities=73% Similarity=1.277 Sum_probs=399.2
Q ss_pred EEEeccccCCchhhhhhhccccccccchhhccccccccCCCCCCCCccEEeceeccCceEEEEEEecCCCceEEEEeeCC
Q 010235 31 YRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTG 110 (514)
Q Consensus 31 ~~ipl~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~n~~~~~Y~~~i~iGtP~Q~~~v~~DTG 110 (514)
+||||+|+++.++.+.+.+......+.+. +++. ...++.....+||.|+.+.+|+++|+||||||+|.|+||||
T Consensus 1 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~---~~~~---~~~~~~~~~~~~l~n~~~~~Y~~~i~IGTP~Q~~~v~~DTG 74 (478)
T 1qdm_A 1 VRIALKKRPIDRNSRVATGLSGGEEQPLL---SGAN---PLRSEEEGDIVALKNYMNAQYFGEIGVGTPPQKFTVIFDTG 74 (478)
T ss_dssp CEEEEEECCCCHHHHHHHHTC----------------------CCSSCSGGGCCGGGCCEEEEEEETTTTEEEEEEEETT
T ss_pred CeeeeeeccchHHHHHhcchhhhhHHHHH---hhcc---cccCcCCCceEEeEeccCCEEEEEEEECCCCeEEEEEEcCC
Confidence 48999999999888877664322111011 1111 11222345679999999999999999999999999999999
Q ss_pred CCceeeeCCCCCCCcccCCCCcccCCCCCcceeCCceEEEEeccceEEEEEEEEEEEECceeecccEEEEEEeeCCcccc
Q 010235 111 SSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFL 190 (514)
Q Consensus 111 Ss~~wv~~~~C~~~~~C~~~~~y~~~~SsT~~~~~~~~~~~Y~~G~~~G~~~~D~v~ig~~~~~~~~fg~~~~~~~~~~~ 190 (514)
|+++||+|..|..+..|..++.|+|++|+||+..++.|.+.|++|++.|.+++|+|+|++..++++.||++....+..|.
T Consensus 75 Ss~lWV~~~~C~~~~~C~~~~~y~~~~SsT~~~~~~~~~i~Yg~Gs~~G~~~~Dtv~ig~~~v~~~~Fg~a~~~~~~~f~ 154 (478)
T 1qdm_A 75 SSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKNGKPAAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGITFL 154 (478)
T ss_dssp CCCCEEEBTTCCSCGGGGGSCCBCGGGCTTCBCCCCEEEEEETTEEEEEEEEEEEEEETTEEEEEEEEEEEEECCBSHHH
T ss_pred CcceEEecCCCCCCccccCCCCCCcccCCCeeeCCcEEEEEcCCCCeEEEEEEEEEEECCeEECCEEEEEEEecCCcccc
Confidence 99999999999655689999999999999999999999999999999999999999999999999999999987665555
Q ss_pred cccceeeeecccccccCCCCCcHHHHHHHcCCCCCCEEEEEecCCCCCCCCcEEEECccCCCCCccceeEEeccCccceE
Q 010235 191 LAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHTYVPVTQKGYWQ 270 (514)
Q Consensus 191 ~~~~~GilGLg~~~~s~~~~~~~~~~l~~qg~i~~~~FSl~l~~~~~~~~~G~L~fGg~d~~~~~g~l~~~p~~~~~~w~ 270 (514)
...++||||||++..+.....|++++|++||+|++++||+||++..+....|.|+|||+|+++|.|++.|+|+...++|.
T Consensus 155 ~~~~dGIlGLg~~~~s~~~~~p~~~~l~~qg~i~~~~FS~~L~~~~~~~~~G~l~fGg~d~~~~~G~l~~~pv~~~~~w~ 234 (478)
T 1qdm_A 155 VAKFDGILGLGFKEISVGKAVPVWYKMIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYVGEHTYVPVTQKGYWQ 234 (478)
T ss_dssp HCSSSEEEECSCGGGCGGGCCCHHHHHTTTTCCSSSEEEEECCCC-----CEEEEETCCCTTSEEEEEEEEEEEEETTEE
T ss_pred cccccceecccccccccCCCCcHHHHHHHCCCCCCCEEEEEeecCCCCCCCeEEEeCCcCHhhcCCCceEEeccCCCeEE
Confidence 66789999999998887677889999999999999999999988643334899999999999999999999999889999
Q ss_pred EEeceEEEcCeeeeeecCCceEEEcCCCCCcccCHHHHHHHHHHhcCccccccchhhhhhhhhHHHHHHhhccCCccchh
Q 010235 271 FDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATGIVSQECKAVVSQYGEEIINMLLAKDEPQKIC 350 (514)
Q Consensus 271 v~l~~i~v~~~~~~~~~~~~~aiiDSGtt~~~lP~~~~~~l~~~l~~~~~~~~~c~~~~~~y~~~~~~~~~~~~~~~~~~ 350 (514)
|.+++|.|++..+.++.....++|||||+++++|.+++++|.+++++.+.+..+|+.++++|++++++.+.++..|.++|
T Consensus 235 v~l~~i~v~g~~~~~~~~~~~aiiDTGTs~~~lP~~~~~~i~~~i~a~~~~s~~Ck~~v~~yg~~ii~~l~~~~~p~~vC 314 (478)
T 1qdm_A 235 FDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQECKTIVSQYGQQILDLLLAETQPKKIC 314 (478)
T ss_dssp EEECCEEETTEECSTTTTCEEEEECSSCCSEEECHHHHHHHHHHHTCCCBCCHHHHHHHHHTHHHHHHHHHTTCCHHHHH
T ss_pred EEEeEEEECCEEEeecCCCceEEEcCCCCceeCCHHHHHHHHHHhCccccccccccchhhhhhhHHHHhhhhccChhhhh
Confidence 99999999998876666778999999999999999999999999999988899999999999999999999999999999
Q ss_pred ccCcccccCCCCCcccccccccccCCcCCCCCCCCcccchhHHHHHHHHHhhhhhhhHHHHHHhhhhhcccCCCCCCCee
Q 010235 351 SQIGLCTFDGSRGVSMGIESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESA 430 (514)
Q Consensus 351 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~ 430 (514)
.+.++|..++.+.+++++++++++.++.+++..++.+|++|||++.|++++|++|.|+++|+++++++|+.++...|.|.
T Consensus 315 ~~iglC~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~C~~Ce~~v~~~~~~l~~n~t~~~I~~~~~~~C~~~~~~~g~~~ 394 (478)
T 1qdm_A 315 SQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRADPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESA 394 (478)
T ss_dssp HHTTCC---------------------------CHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHTTCBCCSSSCCE
T ss_pred ccccccccCccccccccccccccccccccccccccccchHHHHHHHHHHHHHhccccHHHHHHHHHHHhhccCCCCCeEE
Confidence 99999999999999999999999999888999999999999999999999999999999999999999999999999999
Q ss_pred ecCCCCCCCCcEEEEECCEEEEeCcccceeeecCCCCceeeeeeEecccCCCCCCeeeeChhhhcCeEEEEECCCCeEEE
Q 010235 431 VDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVFDYSNMRVGF 510 (514)
Q Consensus 431 ~~C~~~~~~P~i~f~~gg~~~~i~~~~y~~~~~~~~~~~C~~~i~~~~~~~~~~~~~iLG~~fl~~~y~vfD~~~~riGf 510 (514)
++|+.+..+|+|+|+|+|+.|+|+|++|+++..++....|+++|++++++++.++.||||++|||++|+|||++|+||||
T Consensus 395 v~C~~~~~lP~i~f~~gg~~~~l~p~~yi~~~~~~~~~~C~~~~~~~~~~~~~~~~~ILGd~fl~~~y~vfD~~~~rIGf 474 (478)
T 1qdm_A 395 VDCGSLGSMPDIEFTIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRIGF 474 (478)
T ss_dssp ECGGGGTTCCCEEEEETTEEEEECHHHHEEECSCGGGCCEEESEEECCCCTTSCSEEEECHHHHTTEEEEEETTTTEEEE
T ss_pred eecccccccccEEEEECCEEEEEChHHhEEEccCCCCCeEEEEEEeccCCCCCCCcEEECHHHhccEEEEEECCCCEEEE
Confidence 99998889999999999999999999999986654456899999988776566789999999999999999999999999
Q ss_pred EEcC
Q 010235 511 AEAA 514 (514)
Q Consensus 511 a~a~ 514 (514)
|+++
T Consensus 475 A~a~ 478 (478)
T 1qdm_A 475 AKAA 478 (478)
T ss_dssp EEEC
T ss_pred EeCC
Confidence 9986
|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* | Back alignment and structure |
|---|
| >4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... | Back alignment and structure |
|---|
| >3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >3rfi_A Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuberosum} | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* | Back alignment and structure |
|---|
| >1l9l_A Granulysin; saposin fold, membrane-lytic, antimicrobial protein; HET: MPO; 0.92A {Homo sapiens} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A | Back alignment and structure |
|---|
| >1of9_A Pore-forming peptide ameobapore A; toxin, saplip, amoebapore A; NMR {Entamoeba histolytica} SCOP: a.64.1.4 | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A | Back alignment and structure |
|---|
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A | Back alignment and structure |
|---|
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A | Back alignment and structure |
|---|
| >1of9_A Pore-forming peptide ameobapore A; toxin, saplip, amoebapore A; NMR {Entamoeba histolytica} SCOP: a.64.1.4 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* | Back alignment and structure |
|---|
| >3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1l9l_A Granulysin; saposin fold, membrane-lytic, antimicrobial protein; HET: MPO; 0.92A {Homo sapiens} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 514 | ||||
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 6e-76 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 1e-26 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 1e-71 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 3e-25 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 1e-70 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 6e-22 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 3e-70 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 9e-23 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 1e-69 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 2e-24 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 4e-68 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 5e-24 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 1e-67 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 3e-14 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 4e-67 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 4e-22 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 3e-66 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 2e-24 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 3e-63 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 2e-18 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 1e-61 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 1e-20 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 1e-60 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 9e-25 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 8e-60 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 3e-14 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 3e-59 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 2e-22 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 9e-56 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 1e-17 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 2e-55 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 9e-14 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 2e-55 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 4e-14 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 4e-55 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 3e-18 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 5e-55 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 5e-15 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 7e-47 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 2e-17 | |
| d1qdma1 | 104 | a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Horde | 3e-43 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 5e-40 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 5e-17 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 7e-36 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 5e-17 | |
| d2gtga1 | 78 | a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) | 5e-14 | |
| d2gtga1 | 78 | a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) | 3e-10 | |
| d1nkla_ | 78 | a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [Tax | 7e-14 | |
| d1nkla_ | 78 | a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [Tax | 6e-07 | |
| d1of9a_ | 77 | a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica | 9e-14 | |
| d1of9a_ | 77 | a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica | 1e-04 | |
| d1n69a_ | 78 | a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [Tax | 7e-08 | |
| d1n69a_ | 78 | a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [Tax | 1e-05 | |
| d1l9la_ | 74 | a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Hom | 6e-07 | |
| d1l9la_ | 74 | a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Hom | 1e-05 |
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Acid proteases superfamily: Acid proteases family: Pepsin-like domain: Plant acid proteinase, phytepsin species: Barley (Hordeum vulgare) [TaxId: 4513]
Score = 240 bits (613), Expect = 6e-76
Identities = 195/243 (80%), Positives = 221/243 (90%)
Query: 76 DADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRS 135
+ DIVALKNYM+AQYFGEIG+GTPPQ FTVIFDTGSSNLWVPS+KCYFSIACY HS+Y++
Sbjct: 3 EGDIVALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKA 62
Query: 136 GRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFD 195
G SSTYKKNGK A I YGTG+I+G+FSED V +GDLVVKDQEFIEAT+EP +TFL+AKFD
Sbjct: 63 GASSTYKKNGKPAAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGITFLVAKFD 122
Query: 196 GILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYK 255
GILGLGF+EISVGKAVPVWY M+ QGLV++PVFSFW NR+ DE EGGEI+FGGMDP HY
Sbjct: 123 GILGLGFKEISVGKAVPVWYKMIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYV 182
Query: 256 GEHTYVPVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAI 315
GEHTYVPVTQKGYWQFDMGDV++ G++TGFCAGGCAAIADSGTSLLAGPT IIT++N I
Sbjct: 183 GEHTYVPVTQKGYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKI 242
Query: 316 GAT 318
GA
Sbjct: 243 GAA 245
|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} Length = 77 | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} Length = 77 | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 514 | |||
| d3psga_ | 370 | Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| g1htr.1 | 372 | Pepsin(ogen) {Human (Homo sapiens), progastricsin | 100.0 | |
| d1dpja_ | 329 | Acid protease {Baker's yeast (Saccharomyces cerevi | 100.0 | |
| d1smra_ | 335 | Chymosin (synonym: renin) {Mouse (Mus musculus) [T | 100.0 | |
| d2apra_ | 325 | Acid protease {Bread mold (Rhizopus chinensis) [Ta | 100.0 | |
| d1hrna_ | 337 | Chymosin (synonym: renin) {Human (Homo sapiens) [T | 100.0 | |
| d1am5a_ | 324 | Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: | 100.0 | |
| d1miqa_ | 373 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 100.0 | |
| d1qdma2 | 337 | Plant acid proteinase, phytepsin {Barley (Hordeum | 100.0 | |
| d1oewa_ | 330 | Endothiapepsin {Chestnut blight fungus (Endothia p | 100.0 | |
| g1lya.1 | 338 | Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| g1b5f.1 | 326 | Plant acid proteinase, phytepsin {Cynara carduncul | 100.0 | |
| d1mppa_ | 357 | Pepsin {Mucor pusillus [TaxId: 4840]} | 100.0 | |
| d1j71a_ | 334 | Acid protease {Yeast (Candida tropicalis) [TaxId: | 100.0 | |
| d2bjua1 | 329 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 100.0 | |
| d1eaga_ | 342 | Acid protease {Yeast (Candida albicans) [TaxId: 54 | 100.0 | |
| d3cmsa_ | 323 | Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId | 100.0 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 100.0 | |
| d1wkra_ | 340 | Acid protease {Irpex lacteus (Polyporus tulipifera | 100.0 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 100.0 | |
| d2qp8a1 | 387 | beta-secretase (memapsin) {Human (Homo sapiens) [T | 100.0 | |
| d1t6ex_ | 381 | Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu | 100.0 | |
| d1qdma1 | 104 | (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4 | 99.11 | |
| d2gtga1 | 78 | Saposin C {Human (Homo sapiens) [TaxId: 9606]} | 94.83 | |
| d1nkla_ | 78 | NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | 92.87 | |
| d1n69a_ | 78 | Saposin B {Human (Homo sapiens) [TaxId: 9606]} | 92.37 | |
| d1of9a_ | 77 | Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | 92.28 | |
| d1nkla_ | 78 | NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | 92.08 | |
| d1l9la_ | 74 | Granulysin, NKG5 protein {Human (Homo sapiens) [Ta | 91.07 | |
| d1of9a_ | 77 | Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | 90.97 | |
| d2gtga1 | 78 | Saposin C {Human (Homo sapiens) [TaxId: 9606]} | 88.51 | |
| d1n69a_ | 78 | Saposin B {Human (Homo sapiens) [TaxId: 9606]} | 84.93 | |
| d1l9la_ | 74 | Granulysin, NKG5 protein {Human (Homo sapiens) [Ta | 80.48 |
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Acid proteases superfamily: Acid proteases family: Pepsin-like domain: Pepsin(ogen) species: Pig (Sus scrofa) [TaxId: 9823]
Probab=100.00 E-value=4.3e-64 Score=515.55 Aligned_cols=370 Identities=42% Similarity=0.757 Sum_probs=315.9
Q ss_pred eEEEeccccCCchhhhhhhccccccccchhhccccccccCCCCCCCCccEEeceeccCceEEEEEEecCCCceEEEEeeC
Q 010235 30 LYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKYSLRGNLGESGDADIVALKNYMDAQYFGEIGIGTPPQNFTVIFDT 109 (514)
Q Consensus 30 ~~~ipl~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~n~~~~~Y~~~i~iGtP~Q~~~v~~DT 109 (514)
++||||+|+++.++...+.+...+ +++.+.++................||.|+.|.+|+++|+||||||+|.|++||
T Consensus 1 ~v~ipl~k~~~~r~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~l~n~~d~~Y~~~i~iGtP~Q~~~vi~DT 77 (370)
T d3psga_ 1 LVKVPLVRKKSLRQNLIKDGKLKD---FLKTHKHNPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDT 77 (370)
T ss_dssp CEEEEEEECCCHHHHHHHTTCHHH---HHHHCCCCGGGGTCTTSCCSSCCCTTGGGTTCCEEEEEEETTTTEEEEEEEET
T ss_pred CEEEecccCccHHHHHHHcCcHHH---HHHhcccchhhhhcccccCcccccccccccCCEEEEEEEEcCCCeEEEEEEeC
Confidence 589999999887776666554433 34332222211111122334556899999999999999999999999999999
Q ss_pred CCCceeeeCCCCCCCcccCCCCcccCCCCCcceeCCceEEEEeccceEEEEEEEEEEEECceeecccEEEEEEeeCCccc
Q 010235 110 GSSNLWVPSSKCYFSIACYFHSKYRSGRSSTYKKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTF 189 (514)
Q Consensus 110 GSs~~wv~~~~C~~~~~C~~~~~y~~~~SsT~~~~~~~~~~~Y~~G~~~G~~~~D~v~ig~~~~~~~~fg~~~~~~~~~~ 189 (514)
||+++||+|..|. ...|..++.|+|++|+||+..++.|.+.|++|++.|.++.|++.+++..+.++.|+++....+..+
T Consensus 78 GSs~~Wv~~~~C~-~~~~~~~~~yd~~~Sst~~~~~~~~~~~Yg~Gs~~G~~~~d~~~~~~~~~~~~~f~~~~~~~~~~~ 156 (370)
T d3psga_ 78 GSSNLWVPSVYCS-SLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFL 156 (370)
T ss_dssp TCCCEEEEBTTCC-SGGGTTSCCBCGGGCTTCEEEEEEEEEESSSCEEEEEEEEEEEEETTEEEEEEEEEEECSCCCGGG
T ss_pred CCCCeEEECccCC-CcccccccccCCCcccccccCCCcEEEEeCCceEEEEEEEEEEeeeceeeeeeEEEEEeeccCcee
Confidence 9999999999997 445677889999999999999999999999999999999999999999999999999988776555
Q ss_pred ccccceeeeecccccccCCCCCcHHHHHHHcCCCCCCEEEEEecCCCCCCCCcEEEECccCCCCCccceeEEeccCccce
Q 010235 190 LLAKFDGILGLGFQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHTYVPVTQKGYW 269 (514)
Q Consensus 190 ~~~~~~GilGLg~~~~s~~~~~~~~~~l~~qg~i~~~~FSl~l~~~~~~~~~G~L~fGg~d~~~~~g~l~~~p~~~~~~w 269 (514)
.....+||+|||++..+.....+++++|+++|.|+.++||+|+.+..+ .+|.|+|||+|+.++.++++|+|+...++|
T Consensus 157 ~~~~~~Gi~gl~~~~~~~~~~~~~~~~l~~~~~i~~~~fs~~l~~~~~--~~g~l~~Gg~d~~~~~~~l~~~p~~~~~~w 234 (370)
T d3psga_ 157 YYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDD--SGSVVLLGGIDSSYYTGSLNWVPVSVEGYW 234 (370)
T ss_dssp GGCSCSEEEECSCGGGCGGGCCCHHHHHHHTTCSSSSEEEEEEC-------CEEEEETCCCGGGBSSCCEEEECSEETTE
T ss_pred cccccccccccccCcccccCCCchhhhhhhhcccccceeEEEeecCCC--CCceEecCCcCchhcccceeEEeecccceE
Confidence 666789999999998887788899999999999999999999987643 279999999999999999999999999999
Q ss_pred EEEeceEEEcCeeeeeecCCceEEEcCCCCCcccCHHHHHHHHHHhcCccccccchhhhhhhhhHHHHHHhhccCCccch
Q 010235 270 QFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATGIVSQECKAVVSQYGEEIINMLLAKDEPQKI 349 (514)
Q Consensus 270 ~v~l~~i~v~~~~~~~~~~~~~aiiDSGtt~~~lP~~~~~~l~~~l~~~~~~~~~c~~~~~~y~~~~~~~~~~~~~~~~~ 349 (514)
.+.++++.+++..+. ......++|||||+++++|++++++|.+++++..
T Consensus 235 ~v~~~~i~v~g~~~~-~~~~~~aiiDSGTs~~~lp~~~~~~i~~~l~~~~------------------------------ 283 (370)
T d3psga_ 235 QITLDSITMDGETIA-CSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASE------------------------------ 283 (370)
T ss_dssp EEEECEEESSSSEEE-CTTCEEEEECTTCCSEEEEHHHHHHHHHHTTCEE------------------------------
T ss_pred EEEEeeEEeCCeEEe-cCCCccEEEecCCceEeCCHHHHHHHHHHhCCee------------------------------
Confidence 999999999998875 3567899999999999999999999999997651
Q ss_pred hccCcccccCCCCCcccccccccccCCcCCCCCCCCcccchhHHHHHHHHHhhhhhhhHHHHHHhhhhhcccCCCCCCCe
Q 010235 350 CSQIGLCTFDGSRGVSMGIESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGES 429 (514)
Q Consensus 350 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~ 429 (514)
...+.|
T Consensus 284 --------------------------------------------------------------------------~~~~~~ 289 (370)
T d3psga_ 284 --------------------------------------------------------------------------NSDGEM 289 (370)
T ss_dssp --------------------------------------------------------------------------CTTCCE
T ss_pred --------------------------------------------------------------------------ecCCcE
Confidence 124668
Q ss_pred eecCCCCCCCCcEEEEECCEEEEeCcccceeeecCCCCceeeeeeEecccCCCCCCeeeeChhhhcCeEEEEECCCCeEE
Q 010235 430 AVDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVFDYSNMRVG 509 (514)
Q Consensus 430 ~~~C~~~~~~P~i~f~~gg~~~~i~~~~y~~~~~~~~~~~C~~~i~~~~~~~~~~~~~iLG~~fl~~~y~vfD~~~~riG 509 (514)
.++|.....+|+|+|+|+|+++.|+|++|+++.+ ..|...|..++.+.+.++.||||++|||++|+|||++++|||
T Consensus 290 ~~~C~~~~~~P~l~f~f~g~~~~l~~~~yi~~~~----~~c~~~~~~~~~~~~~~~~~ILG~~flr~~y~vfD~~~~~IG 365 (370)
T d3psga_ 290 VISCSSIDSLPDIVFTIDGVQYPLSPSAYILQDD----DSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVG 365 (370)
T ss_dssp ECCGGGGGGCCCEEEEETTEEEEECHHHHEEECS----SCEEESEEEECCCTTSCCEEEECHHHHTTEEEEEETTTTEEE
T ss_pred EEeccccCCCceEEEEECCEEEEEChHHeEEEcC----CeEEEEEEEcccCCCCCCcEEECHHhhcCEEEEEECCCCEEE
Confidence 8899887789999999999999999999998743 469999988877767778999999999999999999999999
Q ss_pred EEEcC
Q 010235 510 FAEAA 514 (514)
Q Consensus 510 fa~a~ 514 (514)
|||+|
T Consensus 366 fAp~a 370 (370)
T d3psga_ 366 LAPVA 370 (370)
T ss_dssp EEEBC
T ss_pred EEecC
Confidence 99986
|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|