Citrus Sinensis ID: 010305


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---
MATLAVNGGGGAAAATHTQAYLEGRAVKETRVLISELCRHFYTLGWVSGTGGSITIKVHDDSIPKPQQLILMSPSGVQKERMEPEDMYVLSGNGTTLSSPSPKPYPHKPPKCSDCAPLFMKAYEKRDAGAVIHSHGIESCLVTMINPMSKEFRITHMEMIKGIKGHGYYDELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPTRNFKLGLGSNGNVNTSAKAVTEGSDYGSGLFPRCIVLDIEGTTTPISFVSEVLFPYARDNVGKHLSVTYDTAETQDDIKLLRSQVEDDLKQGVAGAVPIPPGDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKVYIYSSGSRLAQRLIFGNSNYGDLRKYLSGFFDTAVGNKRETPSYVEITNSLGVDKPSEILFVTDVYQEATAAKAAGKELFVILDGWMQVHSH
ccccccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccEEEECcccccccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHcccccEEEEcccHHHHHHHHHcccccEEEEcccHHHHHcccccccccEEEcEEccccccHHHHHHHHHHHHHcccccEEEEccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHccccccccEEEccccHHHHHHHHHccccEEEEEccccccccc
***************THTQAYLEGRAVKETRVLISELCRHFYTLGWVSGTGGSITIKVHDDSIPKPQQLILMSPSGVQKERMEPEDMYVLSGNGTTLS**************SDCAPLFMKAYEKRDAGAVIHSHGIESCLVTMINPMSKEFRITHMEMIKGIKGHGYYDELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGP****************************SGLFPRCIVLDIEGTTTPISFVSEVLFPYARDNVGKHLSVTYDTAETQDDIKLLRSQVEDDLKQGVAGAVPIPPGDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKVYIYSSGSRLAQRLIFGNSNYGDLRKYLSGFFDTAVGNKRETPSYVEITNSLGVDKPSEILFVTDVYQEATAAKAAGKELFVILDGW******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATLAVNGGGGAAAATHTQAYLEGRAVKETRVLISELCRHFYTLGWVSGTGGSITIKVHDDSIPKPQQLILMSPSGVQKERMEPEDMYVLSGNGTTLSSPSPKPYPHKPPKCSDCAPLFMKAYEKRDAGAVIHSHGIESCLVTMINPMSKEFRITHMEMIKGIKGHGYYDELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPTRNFKLGLGSNGNVNTSAKAVTEGSDYGSGLFPRCIVLDIEGTTTPISFVSEVLFPYARDNVGKHLSVTYDTAETQDDIKLLRSQVEDDLKQGVAGAVPIPPGDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKVYIYSSGSRLAQRLIFGNSNYGDLRKYLSGFFDTAVGNKRETPSYVEITNSLGVDKPSEILFVTDVYQEATAAKAAGKELFVILDGWMQVHSH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 confidentE0CSI1
Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 confidentQ9FN41
Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 confidentQ2R483

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YNS, chain A
Confidence level:very confident
Coverage over the Query: 282-509
View the alignment between query and template
View the model in PyMOL
Template: 2IRP, chain A
Confidence level:very confident
Coverage over the Query: 26-241
View the alignment between query and template
View the model in PyMOL
Template: 1E4C, chain P
Confidence level:very confident
Coverage over the Query: 25-259
View the alignment between query and template
View the model in PyMOL