Citrus Sinensis ID: 010305
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 513 | ||||||
| 255574694 | 527 | catalytic, putative [Ricinus communis] g | 0.959 | 0.933 | 0.818 | 0.0 | |
| 356544052 | 522 | PREDICTED: probable bifunctional methylt | 0.970 | 0.954 | 0.802 | 0.0 | |
| 356549714 | 522 | PREDICTED: probable bifunctional methylt | 0.970 | 0.954 | 0.792 | 0.0 | |
| 388513301 | 523 | unknown [Medicago truncatula] | 0.968 | 0.950 | 0.798 | 0.0 | |
| 224128103 | 504 | predicted protein [Populus trichocarpa] | 0.933 | 0.950 | 0.808 | 0.0 | |
| 449446923 | 512 | PREDICTED: probable bifunctional methylt | 0.947 | 0.949 | 0.768 | 0.0 | |
| 356517132 | 518 | PREDICTED: probable bifunctional methylt | 0.949 | 0.940 | 0.806 | 0.0 | |
| 356517134 | 509 | PREDICTED: probable bifunctional methylt | 0.931 | 0.939 | 0.802 | 0.0 | |
| 225461486 | 544 | PREDICTED: probable bifunctional methylt | 0.961 | 0.906 | 0.778 | 0.0 | |
| 378405187 | 517 | RecName: Full=Probable bifunctional meth | 0.961 | 0.953 | 0.778 | 0.0 |
| >gi|255574694|ref|XP_002528256.1| catalytic, putative [Ricinus communis] gi|296439679|sp|B9SQI7.1|MTBC_RICCO RecName: Full=Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1; Includes: RecName: Full=Methylthioribulose-1-phosphate dehydratase; Short=MTRu-1-P dehydratase; Includes: RecName: Full=Enolase-phosphatase E1; AltName: Full=2,3-diketo-5-methylthio-1-phosphopentane phosphatase gi|223532342|gb|EEF34141.1| catalytic, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 818 bits (2114), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 406/496 (81%), Positives = 444/496 (89%), Gaps = 4/496 (0%)
Query: 7 NGGGGAAAATHTQAYLEGRAVKETRVLISELCRHFYTLGWVSGTGGSITIKVHDDSIPKP 66
NGG A +QAYLE +AVKETRVLIS+LCR FY LGWVSGTGGSITIKVHDDSIPKP
Sbjct: 12 NGGVKVA----SQAYLESKAVKETRVLISDLCRQFYNLGWVSGTGGSITIKVHDDSIPKP 67
Query: 67 QQLILMSPSGVQKERMEPEDMYVLSGNGTTLSSPSPKPYPHKPPKCSDCAPLFMKAYEKR 126
QLILMSPSGVQKERMEPEDMYVL+ NG+ LSSPSPKPYPHKPPKCSDC PLF+KAYE
Sbjct: 68 NQLILMSPSGVQKERMEPEDMYVLAANGSILSSPSPKPYPHKPPKCSDCGPLFLKAYEMC 127
Query: 127 DAGAVIHSHGIESCLVTMINPMSKEFRITHMEMIKGIKGHGYYDELVVPIIENTAYENEL 186
+AGAVIHSHG+ESCLVTMINP+SKEF+ITHMEMIKGIKGHGYYDELVVPIIENTAYENEL
Sbjct: 128 NAGAVIHSHGMESCLVTMINPLSKEFKITHMEMIKGIKGHGYYDELVVPIIENTAYENEL 187
Query: 187 TDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWST 246
TDSLAKAI+ YPK TAVLVRNHGIY+WGDSWI+AKTQAECYHYLFDAAIKLHQLGLDWST
Sbjct: 188 TDSLAKAIEEYPKTTAVLVRNHGIYIWGDSWISAKTQAECYHYLFDAAIKLHQLGLDWST 247
Query: 247 PNHGPTRNFKLGLGSNGNVNTSAKAVTEGSDYGSGLFPRCIVLDIEGTTTPISFVSEVLF 306
PNHG +N K +GSN ++NTS KA + S++G P CIVLDIEGTTTPI+FV++VLF
Sbjct: 248 PNHGLIQNVKALIGSNRDINTSVKAGLKDSNHGMQSLPGCIVLDIEGTTTPITFVADVLF 307
Query: 307 PYARDNVGKHLSVTYDTAETQDDIKLLRSQVEDDLKQGVAGAVPIPPGDAGKEEVIAALV 366
PYARDNVG+HL TY+TAETQDDIKLLR+QVEDDL +GV AV IPP DAGKEEVIAALV
Sbjct: 308 PYARDNVGRHLYATYETAETQDDIKLLRTQVEDDLARGVNEAVSIPPDDAGKEEVIAALV 367
Query: 367 ANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKVYIYSS 426
ANV+AMIKADRKITALKQLQGHIWRTGF++NELEG V+DDVPEALEKWH+LG KVYIYSS
Sbjct: 368 ANVEAMIKADRKITALKQLQGHIWRTGFQNNELEGVVYDDVPEALEKWHALGIKVYIYSS 427
Query: 427 GSRLAQRLIFGNSNYGDLRKYLSGFFDTAVGNKRETPSYVEITNSLGVDKPSEILFVTDV 486
GSRLAQRLIFG +NYGDLRKYLSGFFDT VGNKRET SY+EI+ S+GVD+PSEILFVTDV
Sbjct: 428 GSRLAQRLIFGKTNYGDLRKYLSGFFDTTVGNKRETRSYIEISESVGVDRPSEILFVTDV 487
Query: 487 YQEATAAKAAGKELFV 502
QEA AAK AG E +
Sbjct: 488 VQEAVAAKGAGLEAVI 503
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356544052|ref|XP_003540469.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356549714|ref|XP_003543236.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388513301|gb|AFK44712.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224128103|ref|XP_002329082.1| predicted protein [Populus trichocarpa] gi|296439678|sp|B9N1F9.1|MTBC_POPTR RecName: Full=Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1; Includes: RecName: Full=Methylthioribulose-1-phosphate dehydratase; Short=MTRu-1-P dehydratase; Includes: RecName: Full=Enolase-phosphatase E1; AltName: Full=2,3-diketo-5-methylthio-1-phosphopentane phosphatase gi|222869751|gb|EEF06882.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449446923|ref|XP_004141220.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356517132|ref|XP_003527244.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356517134|ref|XP_003527245.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225461486|ref|XP_002285049.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|378405187|sp|E0CSI1.2|MTBC1_VITVI RecName: Full=Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1; Includes: RecName: Full=Methylthioribulose-1-phosphate dehydratase; Short=MTRu-1-P dehydratase; Includes: RecName: Full=Enolase-phosphatase E1; AltName: Full=2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 513 | ||||||
| TAIR|locus:2154664 | 507 | AT5G53850 [Arabidopsis thalian | 0.918 | 0.928 | 0.729 | 2e-191 | |
| UNIPROTKB|E1C489 | 261 | ENOPH1 "Uncharacterized protei | 0.423 | 0.831 | 0.5 | 5.1e-51 | |
| UNIPROTKB|Q0VCJ2 | 242 | APIP "Methylthioribulose-1-pho | 0.389 | 0.826 | 0.506 | 5.1e-51 | |
| UNIPROTKB|Q96GX9 | 242 | APIP "Methylthioribulose-1-pho | 0.403 | 0.855 | 0.502 | 8.3e-51 | |
| UNIPROTKB|J3KN82 | 259 | APIP "Methylthioribulose-1-pho | 0.389 | 0.772 | 0.506 | 1.1e-50 | |
| UNIPROTKB|F1PT95 | 242 | APIP "Uncharacterized protein" | 0.426 | 0.904 | 0.481 | 1.3e-50 | |
| UNIPROTKB|C1C4M8 | 239 | apip "Methylthioribulose-1-pho | 0.389 | 0.836 | 0.515 | 1.7e-50 | |
| UNIPROTKB|C1BYA3 | 257 | apip "Methylthioribulose-1-pho | 0.405 | 0.809 | 0.502 | 4.6e-50 | |
| UNIPROTKB|F1NNC9 | 242 | APIP "Methylthioribulose-1-pho | 0.389 | 0.826 | 0.511 | 9.5e-50 | |
| UNIPROTKB|Q0VD27 | 261 | ENOPH1 "Enolase-phosphatase E1 | 0.419 | 0.823 | 0.472 | 9.5e-50 |
| TAIR|locus:2154664 AT5G53850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1855 (658.1 bits), Expect = 2.0e-191, P = 2.0e-191
Identities = 353/484 (72%), Positives = 411/484 (84%)
Query: 19 QAYLEGRAVKETRVLISELCRHFYTLGWVSGTGGSITIKVHDDSIPKPQQLILMSPSGVQ 78
QAYLEG+ VKET L++ELCRHFYT GWVSGTGGSIT+KVHD SIPKP+QLI+MSPSGVQ
Sbjct: 13 QAYLEGKEVKETSSLVTELCRHFYTQGWVSGTGGSITMKVHDASIPKPEQLIVMSPSGVQ 72
Query: 79 KERMEPEDMYVLSGNGTTLXXXXXXXXXXXXXXCSDCAPLFMKAYEKRDAGAVIHSHGIE 138
KERM+PEDMY+LS NG+ + C+DCAPLFMKAYE R+AGAVIHSHG+E
Sbjct: 73 KERMQPEDMYILSANGSIISTPSPKPYPNKPPKCTDCAPLFMKAYEMRNAGAVIHSHGME 132
Query: 139 SCLVTMINPMSKEFRITHMEMIKGIKGHGYYDELVVPIIENTAYENELTDSLAKAIDAYP 198
SCLVTM+NP +KEFRITHMEMIKGI+GHGYYDELVVPIIENTAYENELTDSL KAI+AYP
Sbjct: 133 SCLVTMLNPQAKEFRITHMEMIKGIQGHGYYDELVVPIIENTAYENELTDSLTKAIEAYP 192
Query: 199 KATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPTRNFKLG 258
KATAVLVRNHG+Y+WGDSWI+AKTQAECYHYLFDAAIKLHQLGLD +TP+HGP R
Sbjct: 193 KATAVLVRNHGVYIWGDSWIHAKTQAECYHYLFDAAIKLHQLGLDAATPDHGPIRR---- 248
Query: 259 LGSNGNVNTSAKAVTEGSDYGSGLFPRCIVLDIEGTTTPISFVSEVLFPYARDNVGKHLS 318
+++ K S Y R IVLDIEGTTTPI+FV++VLFPYAR+NVGKHL+
Sbjct: 249 -----TIHSQIK----DSQYEREWPRRWIVLDIEGTTTPITFVTDVLFPYARENVGKHLN 299
Query: 319 VTYDTAETQDDIKLLRSQVEDDLKQGVAGAVPIPPGDAGKEEVIAALVANVDAMIKADRK 378
+TY TAETQ+DIKLLR+QVE+DL++GV GAVPIP D GKE+VIAA+V+NV+AMI+ADRK
Sbjct: 300 LTYHTAETQEDIKLLRAQVEEDLREGVTGAVPIPHADEGKEKVIAAMVSNVEAMIRADRK 359
Query: 379 ITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKVYIYSSGSRLAQRLIFGN 438
ITALK+LQGHIWRTGFE +EL+ VF+DV +ALEKWHS G KVYIYSSGSRLAQ+L+FGN
Sbjct: 360 ITALKELQGHIWRTGFECDELKAIVFEDVADALEKWHSSGIKVYIYSSGSRLAQKLLFGN 419
Query: 439 SNYGDLRKYLSGFFDTAVGNKRETPSYVEITNSLGVDKPSEILFVTDVYQEATAAKAAGK 498
++YGDLRKY+SGFFDT +GNK+E+ SY EI +LGVD P+EI+FVTDVYQEA AAKAAG
Sbjct: 420 TDYGDLRKYISGFFDTTIGNKKESRSYKEIKETLGVDDPAEIMFVTDVYQEAVAAKAAGL 479
Query: 499 ELFV 502
E +
Sbjct: 480 EAII 483
|
|
| UNIPROTKB|E1C489 ENOPH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VCJ2 APIP "Methylthioribulose-1-phosphate dehydratase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96GX9 APIP "Methylthioribulose-1-phosphate dehydratase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KN82 APIP "Methylthioribulose-1-phosphate dehydratase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PT95 APIP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C1C4M8 apip "Methylthioribulose-1-phosphate dehydratase" [Rana catesbeiana (taxid:8400)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C1BYA3 apip "Methylthioribulose-1-phosphate dehydratase" [Esox lucius (taxid:8010)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NNC9 APIP "Methylthioribulose-1-phosphate dehydratase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VD27 ENOPH1 "Enolase-phosphatase E1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_1070035 | hypothetical protein (504 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| estExt_Genewise1_v1.C_LG_VIII2401 | • | • | • | • | 0.973 | ||||||
| estExt_Genewise1_v1.C_LG_VIII0915 | • | • | • | • | 0.973 | ||||||
| estExt_fgenesh4_pm.C_LG_VI0635 | • | • | • | • | • | 0.812 | |||||
| eugene3.79220002 | • | • | 0.426 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 513 | |||
| TIGR03328 | 193 | TIGR03328, salvage_mtnB, methylthioribulose-1-phos | 3e-82 | |
| TIGR01691 | 220 | TIGR01691, enolase-ppase, 2,3-diketo-5-methylthio- | 4e-61 | |
| COG4229 | 229 | COG4229, COG4229, Predicted enolase-phosphatase [E | 1e-60 | |
| smart01007 | 185 | smart01007, Aldolase_II, Class II Aldolase and Add | 2e-37 | |
| pfam00596 | 181 | pfam00596, Aldolase_II, Class II Aldolase and Addu | 1e-34 | |
| COG0235 | 219 | COG0235, AraD, Ribulose-5-phosphate 4-epimerase an | 1e-31 | |
| PRK06754 | 208 | PRK06754, mtnB, methylthioribulose-1-phosphate deh | 5e-29 | |
| cd00398 | 209 | cd00398, Aldolase_II, Class II Aldolase and Adduci | 1e-20 | |
| pfam13419 | 176 | pfam13419, HAD_2, Haloacid dehalogenase-like hydro | 5e-17 | |
| PRK09220 | 204 | PRK09220, PRK09220, methylthioribulose-1-phosphate | 1e-15 | |
| TIGR01549 | 162 | TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase sup | 3e-15 | |
| PRK06833 | 214 | PRK06833, PRK06833, L-fuculose phosphate aldolase; | 6e-08 | |
| pfam00702 | 187 | pfam00702, Hydrolase, haloacid dehalogenase-like h | 8e-07 | |
| PRK08130 | 213 | PRK08130, PRK08130, putative aldolase; Validated | 2e-06 | |
| PRK06755 | 209 | PRK06755, PRK06755, hypothetical protein; Validate | 7e-06 | |
| COG0546 | 220 | COG0546, Gph, Predicted phosphatases [General func | 2e-05 | |
| TIGR01086 | 214 | TIGR01086, fucA, L-fuculose phosphate aldolase | 3e-05 | |
| PRK08087 | 215 | PRK08087, PRK08087, L-fuculose phosphate aldolase; | 5e-05 | |
| PRK06557 | 221 | PRK06557, PRK06557, L-ribulose-5-phosphate 4-epime | 5e-04 |
| >gnl|CDD|234168 TIGR03328, salvage_mtnB, methylthioribulose-1-phosphate dehydratase | Back alignment and domain information |
|---|
Score = 253 bits (648), Expect = 3e-82
Identities = 71/209 (33%), Positives = 107/209 (51%), Gaps = 18/209 (8%)
Query: 34 ISELCRHFYTLGWVSGTGGSITIKVHDDSIPKPQQLILMSPSGVQKERMEPEDMYVLSGN 93
+ E R Y GWV GTGG++ S + IL++PSGV K R+ PED V+
Sbjct: 1 LIEAGRDLYKRGWVPGTGGNL-------SARLDEDEILITPSGVDKGRLTPEDFLVVDLQ 53
Query: 94 GTTLSSPSPKPYPHKPPKCSDCAPLFMKAYEKR-DAGAVIHSHGIESCLVTMINPMSKEF 152
G +S P S L + Y AGAV+H+H +E+ +++ + P + F
Sbjct: 54 GKPVSGG-------LKP--SAETLLHTQLYRLTPGAGAVLHTHSVEATVLSRLYPSNGAF 104
Query: 153 RITHMEMIKGIKG-HGYYDELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIY 211
+ EM+K + G + D+L +PI ENT L DS+A ++AYP VL+R HG+Y
Sbjct: 105 ELEGYEMLKALPGITTHEDKLTIPIFENTQDIARLADSVAPYLEAYPDVPGVLIRGHGLY 164
Query: 212 VWGDSWINAKTQAECYHYLFDAAIKLHQL 240
WG W AK E +LF+ +++ +L
Sbjct: 165 AWGRDWEEAKRHLEALEFLFECELEMLKL 193
|
Members of this family are the methylthioribulose-1-phosphate dehydratase of the methionine salvage pathway. This pathway allows methylthioadenosine, left over from polyamine biosynthesis, to be recycled to methionine [Amino acid biosynthesis, Aspartate family]. Length = 193 |
| >gnl|CDD|233533 TIGR01691, enolase-ppase, 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|226682 COG4229, COG4229, Predicted enolase-phosphatase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|214970 smart01007, Aldolase_II, Class II Aldolase and Adducin N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|216015 pfam00596, Aldolase_II, Class II Aldolase and Adducin N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223313 COG0235, AraD, Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|180679 PRK06754, mtnB, methylthioribulose-1-phosphate dehydratase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238232 cd00398, Aldolase_II, Class II Aldolase and Adducin head (N-terminal) domain | Back alignment and domain information |
|---|
| >gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|236415 PRK09220, PRK09220, methylthioribulose-1-phosphate dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233463 TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >gnl|CDD|180717 PRK06833, PRK06833, L-fuculose phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|181241 PRK08130, PRK08130, putative aldolase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|102532 PRK06755, PRK06755, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|188107 TIGR01086, fucA, L-fuculose phosphate aldolase | Back alignment and domain information |
|---|
| >gnl|CDD|181226 PRK08087, PRK08087, L-fuculose phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235829 PRK06557, PRK06557, L-ribulose-5-phosphate 4-epimerase; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 513 | |||
| PRK06833 | 214 | L-fuculose phosphate aldolase; Provisional | 100.0 | |
| PRK08087 | 215 | L-fuculose phosphate aldolase; Provisional | 100.0 | |
| PRK05874 | 217 | L-fuculose-phosphate aldolase; Validated | 100.0 | |
| PRK08193 | 231 | araD L-ribulose-5-phosphate 4-epimerase; Reviewed | 100.0 | |
| PRK12348 | 228 | sgaE L-ribulose-5-phosphate 4-epimerase; Reviewed | 100.0 | |
| TIGR00760 | 231 | araD L-ribulose-5-phosphate 4-epimerase. The homol | 100.0 | |
| PRK13213 | 231 | araD L-ribulose-5-phosphate 4-epimerase; Reviewed | 100.0 | |
| cd00398 | 209 | Aldolase_II Class II Aldolase and Adducin head (N- | 100.0 | |
| PRK07490 | 245 | hypothetical protein; Provisional | 100.0 | |
| PRK05834 | 194 | hypothetical protein; Provisional | 100.0 | |
| PRK08130 | 213 | putative aldolase; Validated | 100.0 | |
| PRK12347 | 231 | sgbE L-ribulose-5-phosphate 4-epimerase; Reviewed | 100.0 | |
| PRK06557 | 221 | L-ribulose-5-phosphate 4-epimerase; Validated | 100.0 | |
| PRK06754 | 208 | mtnB methylthioribulose-1-phosphate dehydratase; R | 100.0 | |
| PRK13145 | 234 | araD L-ribulose-5-phosphate 4-epimerase; Provision | 100.0 | |
| PRK06755 | 209 | hypothetical protein; Validated | 100.0 | |
| PRK06486 | 262 | hypothetical protein; Provisional | 100.0 | |
| TIGR01086 | 214 | fucA L-fuculose phosphate aldolase. Members of thi | 100.0 | |
| PRK09220 | 204 | methylthioribulose-1-phosphate dehydratase; Provis | 100.0 | |
| PRK07090 | 260 | class II aldolase/adducin domain protein; Provisio | 100.0 | |
| PRK06208 | 274 | hypothetical protein; Provisional | 100.0 | |
| PRK07044 | 252 | aldolase II superfamily protein; Provisional | 100.0 | |
| PRK06661 | 231 | hypothetical protein; Provisional | 100.0 | |
| PRK06357 | 216 | hypothetical protein; Provisional | 100.0 | |
| PRK08333 | 184 | L-fuculose phosphate aldolase; Provisional | 100.0 | |
| TIGR03328 | 193 | salvage_mtnB methylthioribulose-1-phosphate dehydr | 100.0 | |
| PRK08660 | 181 | L-fuculose phosphate aldolase; Provisional | 100.0 | |
| COG0235 | 219 | AraD Ribulose-5-phosphate 4-epimerase and related | 100.0 | |
| TIGR02624 | 270 | rhamnu_1P_ald rhamnulose-1-phosphate aldolase. Mem | 100.0 | |
| PRK03634 | 274 | rhamnulose-1-phosphate aldolase; Provisional | 100.0 | |
| PF00596 | 184 | Aldolase_II: Class II Aldolase and Adducin N-termi | 100.0 | |
| KOG2631 | 238 | consensus Class II aldolase/adducin N-terminal dom | 100.0 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 99.98 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 99.94 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 99.94 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 99.94 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 99.94 | |
| COG4229 | 229 | Predicted enolase-phosphatase [Energy production a | 99.94 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 99.94 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 99.94 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 99.93 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 99.93 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 99.93 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 99.93 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 99.93 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 99.92 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 99.92 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 99.92 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 99.92 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 99.92 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 99.92 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 99.92 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 99.92 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 99.91 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.91 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 99.91 | |
| PLN02940 | 382 | riboflavin kinase | 99.9 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 99.9 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 99.9 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 99.9 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 99.89 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 99.89 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 99.89 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 99.89 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 99.89 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 99.88 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 99.88 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 99.88 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 99.87 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 99.87 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 99.87 | |
| KOG2630 | 254 | consensus Enolase-phosphatase E-1 [Amino acid tran | 99.87 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 99.86 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 99.86 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 99.86 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.85 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 99.82 | |
| PLN02811 | 220 | hydrolase | 99.82 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 99.81 | |
| PRK06769 | 173 | hypothetical protein; Validated | 99.81 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 99.81 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 99.81 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 99.8 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 99.8 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 99.8 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 99.79 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 99.78 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 99.77 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 99.77 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.76 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.75 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 99.74 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 99.73 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 99.73 | |
| COG3347 | 404 | Uncharacterized conserved protein [Function unknow | 99.73 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.72 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 99.64 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 99.64 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 99.64 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 99.62 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.62 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 99.61 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.61 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 99.61 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 99.58 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 99.57 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 99.56 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.56 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 99.55 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 99.55 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 99.51 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.49 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.48 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 99.47 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 99.45 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.44 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 99.42 | |
| KOG3699 | 598 | consensus Cytoskeletal protein Adducin [Signal tra | 99.41 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.39 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 99.38 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 99.38 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 99.38 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 99.36 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.34 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 99.33 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 99.32 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 99.25 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 99.24 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 99.19 | |
| PRK08238 | 479 | hypothetical protein; Validated | 99.18 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 99.17 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 99.16 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 99.15 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 99.11 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 99.01 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 98.99 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 98.96 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 98.92 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 98.9 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 98.86 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 98.78 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 98.78 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 98.77 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 98.74 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.71 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 98.68 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 98.6 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 98.57 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 98.56 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 98.55 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 98.54 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 98.5 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.45 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 98.39 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 98.38 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 98.37 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 98.35 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 98.32 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 98.3 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.25 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 98.19 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 98.14 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 98.06 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 98.06 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 98.02 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 97.93 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 97.89 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 97.89 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 97.86 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 97.85 | |
| PF05761 | 448 | 5_nucleotid: 5' nucleotidase family; InterPro: IPR | 97.83 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 97.8 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 97.7 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 97.64 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 97.54 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 97.46 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 97.45 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 97.41 | |
| KOG3699 | 598 | consensus Cytoskeletal protein Adducin [Signal tra | 97.41 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 97.38 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 97.19 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 97.18 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 97.18 | |
| PLN02887 | 580 | hydrolase family protein | 97.16 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 97.12 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 97.06 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 97.05 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 96.98 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 96.95 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 96.88 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 96.84 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 96.83 | |
| COG5663 | 194 | Uncharacterized conserved protein [Function unknow | 96.71 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 96.67 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 96.66 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 96.45 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 96.39 | |
| KOG2470 | 510 | consensus Similar to IMP-GMP specific 5'-nucleotid | 96.27 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 96.26 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 96.2 | |
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 96.14 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 96.11 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 96.11 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 96.1 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 96.06 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 96.04 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 96.0 | |
| PLN02423 | 245 | phosphomannomutase | 95.92 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 95.78 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 95.62 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 95.52 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 95.42 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 95.22 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 95.22 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 95.22 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 95.07 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 95.03 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 94.91 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 94.81 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 94.75 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 94.72 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 94.66 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 94.4 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 94.37 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 94.31 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 94.05 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 94.04 | |
| KOG2961 | 190 | consensus Predicted hydrolase (HAD superfamily) [G | 93.75 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 92.71 | |
| COG5610 | 635 | Predicted hydrolase (HAD superfamily) [General fun | 92.51 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 92.01 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 91.79 | |
| PF05822 | 246 | UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter | 91.52 | |
| PLN02580 | 384 | trehalose-phosphatase | 91.47 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 90.87 | |
| PLN03017 | 366 | trehalose-phosphatase | 90.83 | |
| KOG2469 | 424 | consensus IMP-GMP specific 5'-nucleotidase [Nucleo | 90.73 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 90.51 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 90.37 | |
| PLN02151 | 354 | trehalose-phosphatase | 90.29 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 90.2 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 89.63 | |
| PLN02499 | 498 | glycerol-3-phosphate acyltransferase | 89.28 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 88.88 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 87.77 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 87.58 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 87.18 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 87.1 | |
| KOG3189 | 252 | consensus Phosphomannomutase [Lipid transport and | 87.03 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 86.93 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 86.67 | |
| TIGR01658 | 274 | EYA-cons_domain eyes absent protein conserved doma | 86.66 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 86.43 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 86.43 | |
| PF06189 | 264 | 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 | 86.04 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 84.1 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 83.94 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 82.12 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 81.3 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 81.22 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 80.64 |
| >PRK06833 L-fuculose phosphate aldolase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-44 Score=342.25 Aligned_cols=201 Identities=22% Similarity=0.320 Sum_probs=175.3
Q ss_pred HHHHHHHHHHHHHHHHHcCCccccCCceeEEeCCCCCCCCccEEEEeccCCCCCCCCCCCEEEEeCCCCeecCCCCCCCC
Q 010305 27 VKETRVLISELCRHFYTLGWVSGTGGSITIKVHDDSIPKPQQLILMSPSGVQKERMEPEDMYVLSGNGTTLSSPSPKPYP 106 (513)
Q Consensus 27 ~~~~r~~l~~~~r~l~~~gl~~~~~GNiSvR~~~~~~~~~~~~~litpsG~~~~~l~~~div~vd~~g~~~~g~~~~p~~ 106 (513)
++++|++|+++||+++++||+.+++||||+|++++ +.|||||||.++++++++||++||++|++++|. .+|
T Consensus 3 ~~~~r~~i~~~~~~l~~~gl~~g~~GniS~r~~~~------~~~~ItpsG~~~~~l~~~div~vd~~g~~i~g~-~~p-- 73 (214)
T PRK06833 3 LQKEREEIVAYGKKLISSGLTKGTGGNISIFNREQ------GLMAITPSGIDYFEIKPEDIVIMDLDGKVVEGE-RKP-- 73 (214)
T ss_pred hHHHHHHHHHHHHHHHHcCCCCCCCceEEEEeCCC------CEEEEcCCCCChhhCCHHHEEEEcCCCCCcCCC-CCC--
Confidence 45689999999999999999999999999999763 489999999999999999999999999999985 345
Q ss_pred CCCCCCCCchHHHHHHHHhc-CccEEEecCChHHHHHHhhcCCCcccccchHHHHhhhcCCcccccceeeeecCC-CCch
Q 010305 107 HKPPKCSDCAPLFMKAYEKR-DAGAVIHSHGIESCLVTMINPMSKEFRITHMEMIKGIKGHGYYDELVVPIIENT-AYEN 184 (513)
Q Consensus 107 ~~p~~~S~E~~lH~~iy~~~-d~~aVvH~H~~~~~a~s~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~vpv~~~~-~~~~ 184 (513)
|+|+.||+.||+.| |++||||+||||++++|+.+. ++|...+... .+++ .||+.+|. +++.
T Consensus 74 ------s~E~~lH~~iy~~rpdv~aVvH~H~~~a~a~s~~~~---~lp~~~~~~~-~~~~-------~i~~~~y~~~gs~ 136 (214)
T PRK06833 74 ------SSELDMHLIFYRNREDINAIVHTHSPYATTLACLGW---ELPAVHYLIA-VAGP-------NVRCAEYATFGTK 136 (214)
T ss_pred ------CccHHHHHHHHHhCCCCCEEEEeCcHHHHHHHHcCC---CCCcchhHHH-HHCC-------CeeeccCCCCChH
Confidence 89999999999999 999999999999999999875 3443333222 1222 38998885 6899
Q ss_pred HHHHHHHHHHhhCCCceEEEEcCCcceeecCCHHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCCccccccc
Q 010305 185 ELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPTRNFKL 257 (513)
Q Consensus 185 ~la~~v~~~l~~~~~~~~vll~nHG~~~~G~sl~~A~~~~~~lE~~a~~~~~a~~~g~~~~~~~~~~~~~~~~ 257 (513)
++++.++++|++ .++|||+|||+++||+|+++||.+++.+|++|++++.++++|.+.+ .++++++++++
T Consensus 137 ~la~~v~~~l~~---~~~vll~nHGv~~~G~~~~eA~~~~e~lE~~a~~~~~a~~~G~~~~-l~~~~~~~~~~ 205 (214)
T PRK06833 137 ELAENAFEAMED---RRAVLLANHGLLAGANNLKNAFNIAEEIEFCAEIYYQTKSIGEPKL-LPEDEMENMAE 205 (214)
T ss_pred HHHHHHHHHhCc---CCEEEECCCCCEEEeCCHHHHHHHHHHHHHHHHHHHHHHhcCCCCC-CCHHHHHHHHH
Confidence 999999999986 6999999999999999999999999999999999999999998865 46657777644
|
|
| >PRK08087 L-fuculose phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK05874 L-fuculose-phosphate aldolase; Validated | Back alignment and domain information |
|---|
| >PRK08193 araD L-ribulose-5-phosphate 4-epimerase; Reviewed | Back alignment and domain information |
|---|
| >PRK12348 sgaE L-ribulose-5-phosphate 4-epimerase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00760 araD L-ribulose-5-phosphate 4-epimerase | Back alignment and domain information |
|---|
| >PRK13213 araD L-ribulose-5-phosphate 4-epimerase; Reviewed | Back alignment and domain information |
|---|
| >cd00398 Aldolase_II Class II Aldolase and Adducin head (N-terminal) domain | Back alignment and domain information |
|---|
| >PRK07490 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08130 putative aldolase; Validated | Back alignment and domain information |
|---|
| >PRK12347 sgbE L-ribulose-5-phosphate 4-epimerase; Reviewed | Back alignment and domain information |
|---|
| >PRK06557 L-ribulose-5-phosphate 4-epimerase; Validated | Back alignment and domain information |
|---|
| >PRK06754 mtnB methylthioribulose-1-phosphate dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PRK13145 araD L-ribulose-5-phosphate 4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK06755 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06486 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01086 fucA L-fuculose phosphate aldolase | Back alignment and domain information |
|---|
| >PRK09220 methylthioribulose-1-phosphate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07090 class II aldolase/adducin domain protein; Provisional | Back alignment and domain information |
|---|
| >PRK06208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07044 aldolase II superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PRK06661 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06357 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08333 L-fuculose phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03328 salvage_mtnB methylthioribulose-1-phosphate dehydratase | Back alignment and domain information |
|---|
| >PRK08660 L-fuculose phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >COG0235 AraD Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02624 rhamnu_1P_ald rhamnulose-1-phosphate aldolase | Back alignment and domain information |
|---|
| >PRK03634 rhamnulose-1-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PF00596 Aldolase_II: Class II Aldolase and Adducin N-terminal domain; InterPro: IPR001303 This entry represents the alpha/beta/alpha domain found in class II aldolases and adducin, usually at the N terminus | Back alignment and domain information |
|---|
| >KOG2631 consensus Class II aldolase/adducin N-terminal domain protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG4229 Predicted enolase-phosphatase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >COG3347 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >KOG3699 consensus Cytoskeletal protein Adducin [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3699 consensus Cytoskeletal protein Adducin [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >COG5663 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >KOG2469 consensus IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PLN02499 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01658 EYA-cons_domain eyes absent protein conserved domain | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 513 | ||||
| 1yns_A | 261 | Crystal Structure Of Human Enolase-Phosphatase E1 A | 4e-51 | ||
| 1zs9_A | 261 | Crystal Structure Of Human Enolase-Phosphatase E1 L | 9e-50 | ||
| 2g80_A | 253 | Crystal Structure Of Utr4 Protein (Unknown Transcri | 5e-22 | ||
| 2irp_A | 208 | Crystal Structure Of The L-fuculose-1-phosphate Ald | 3e-10 | ||
| 1e46_P | 215 | L-Fuculose 1-Phosphate Aldolase From Escherichia Co | 5e-04 | ||
| 1e47_P | 215 | L-Fuculose 1-Phosphate Aldolase From Escherichia Co | 8e-04 | ||
| 1e48_P | 215 | L-Fuculose 1-Phosphate Aldolase From Escherichia Co | 8e-04 |
| >pdb|1YNS|A Chain A, Crystal Structure Of Human Enolase-Phosphatase E1 And Its Complex With A Substrate Analog Length = 261 | Back alignment and structure |
|
| >pdb|1ZS9|A Chain A, Crystal Structure Of Human Enolase-Phosphatase E1 Length = 261 | Back alignment and structure |
| >pdb|2G80|A Chain A, Crystal Structure Of Utr4 Protein (Unknown Transcript 4 Protein) (Yel038w) From Saccharomyces Cerevisiae At 2.28 A Resolution Length = 253 | Back alignment and structure |
| >pdb|2IRP|A Chain A, Crystal Structure Of The L-fuculose-1-phosphate Aldolase (aq_1979) From Aquifex Aeolicus Vf5 Length = 208 | Back alignment and structure |
| >pdb|1E46|P Chain P, L-Fuculose 1-Phosphate Aldolase From Escherichia Coli Mutant E73s Length = 215 | Back alignment and structure |
| >pdb|1E47|P Chain P, L-Fuculose 1-Phosphate Aldolase From Escherichia Coli Mutant E73q Length = 215 | Back alignment and structure |
| >pdb|1E48|P Chain P, L-Fuculose 1-Phosphate Aldolase From Escherichia Coli Mutant E73qY113FY209F Length = 215 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 513 | |||
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 3e-74 | |
| 2irp_A | 208 | Putative aldolase class 2 protein AQ_1979; aldehyd | 1e-67 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 5e-58 | |
| 2fk5_A | 200 | Fuculose-1-phosphate aldolase; class II aldolase, | 2e-26 | |
| 1k0w_A | 231 | L-ribulose 5 phosphate 4-epimerase; aldolase, isom | 4e-24 | |
| 1e4c_P | 215 | L-fuculose 1-phosphate aldolase; aldolase (class I | 9e-21 | |
| 2opi_A | 212 | L-fuculose-1-phosphate aldolase; L-fuculose-1-phos | 1e-20 | |
| 1pvt_A | 238 | Sugar-phosphate aldolase; structural genomics, PSI | 3e-19 | |
| 2v9l_A | 274 | Rhamnulose-1-phosphate aldolase; entropy index, me | 1e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 2z7b_A | 270 | MLR6791 protein; class II aldolase superfamily, ly | 1e-08 | |
| 3m4r_A | 222 | Uncharacterized protein; short chain dehydrogenase | 3e-05 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 1e-04 | |
| 3ocr_A | 273 | Class II aldolase/adducin domain protein; PSI-2, m | 1e-04 |
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Length = 261 | Back alignment and structure |
|---|
Score = 234 bits (598), Expect = 3e-74
Identities = 100/215 (46%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
Query: 285 RCIVLDIEGTTTPISFVSEVLFPYARDNVGKHLSVTYDTAETQDDIKLLRSQVEDDLKQG 344
I+LDIEGTTTPI+FV ++LFPY +NV ++L ++ E Q D+ LLR Q E+D
Sbjct: 11 TVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLD 70
Query: 345 VAGAVPIPPGDAG--KEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGE 402
A +P G+ +++I A+V NV + DRK TALKQLQGH+WR F + ++ E
Sbjct: 71 GAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAE 130
Query: 403 VFDDVPEALEKWHSLGTKVYIYSSGSRLAQRLIFGNSNYGDLRKYLSGFFDTAVGNKRET 462
F DV A+ KW G KVYIYSSGS AQ+L+FG+S GD+ + + G FDT +G+K E+
Sbjct: 131 FFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVES 190
Query: 463 PSYVEITNSLGVDKPSEILFVTDVYQEATAAKAAG 497
SY +I +S+G + ILF+TDV +EA+AA+ A
Sbjct: 191 ESYRKIADSIGCS-TNNILFLTDVTREASAAEEAD 224
|
| >2irp_A Putative aldolase class 2 protein AQ_1979; aldehyde, enzymatic mechanism; 2.40A {Aquifex aeolicus} Length = 208 | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Length = 253 | Back alignment and structure |
|---|
| >2fk5_A Fuculose-1-phosphate aldolase; class II aldolase, metal binding, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2flf_A Length = 200 | Back alignment and structure |
|---|
| >1k0w_A L-ribulose 5 phosphate 4-epimerase; aldolase, isomerase; 2.10A {Escherichia coli} SCOP: c.74.1.1 PDB: 1jdi_A Length = 231 | Back alignment and structure |
|---|
| >1e4c_P L-fuculose 1-phosphate aldolase; aldolase (class II), bacterial L-fucose metabolism; 1.66A {Escherichia coli} SCOP: c.74.1.1 PDB: 1fua_A 2fua_A 3fua_A 4fua_A* 1dzv_P 1e4b_P 1e47_P* 1e48_P* 1dzz_P 1e46_P 1dzu_P 1dzy_P 1dzx_P 1dzw_P 1e49_P 1e4a_P Length = 215 | Back alignment and structure |
|---|
| >2opi_A L-fuculose-1-phosphate aldolase; L-fuculose-1-phosphate aldolas structural genomics, PSI-2, protein structure initiative; 2.50A {Bacteroides thetaiotaomicron} Length = 212 | Back alignment and structure |
|---|
| >1pvt_A Sugar-phosphate aldolase; structural genomics, PSI, protein initiative, midwest center for structural genomics, MCSG; 2.50A {Thermotoga maritima} SCOP: c.74.1.1 Length = 238 | Back alignment and structure |
|---|
| >2v9l_A Rhamnulose-1-phosphate aldolase; entropy index, metal-binding, oligomerization, zinc, lyase, class II, cytoplasm; HET: PGO; 1.23A {Escherichia coli} PDB: 2uyv_A* 1ojr_A 2v9g_A* 1gt7_A* 2v9n_A* 2uyu_A* 2v9m_A* 2v9o_A 2v9e_A 2v9f_A 2v9i_A 2v29_A 2v2a_A* 2v2b_A Length = 274 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2z7b_A MLR6791 protein; class II aldolase superfamily, lyase; 1.90A {Mesorhizobium loti} Length = 270 | Back alignment and structure |
|---|
| >3m4r_A Uncharacterized protein; short chain dehydrogenase, class II aldolase, adducin head D carbohydrate metabolism, structural genomics; 2.00A {Thermoplasma acidophilum} Length = 222 | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 | Back alignment and structure |
|---|
| >3ocr_A Class II aldolase/adducin domain protein; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG, lyase; 1.95A {Pseudomonas syringae PV} Length = 273 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 513 | |||
| 1e4c_P | 215 | L-fuculose 1-phosphate aldolase; aldolase (class I | 100.0 | |
| 2irp_A | 208 | Putative aldolase class 2 protein AQ_1979; aldehyd | 100.0 | |
| 3ocr_A | 273 | Class II aldolase/adducin domain protein; PSI-2, m | 100.0 | |
| 2opi_A | 212 | L-fuculose-1-phosphate aldolase; L-fuculose-1-phos | 100.0 | |
| 1k0w_A | 231 | L-ribulose 5 phosphate 4-epimerase; aldolase, isom | 100.0 | |
| 2fk5_A | 200 | Fuculose-1-phosphate aldolase; class II aldolase, | 100.0 | |
| 2v9l_A | 274 | Rhamnulose-1-phosphate aldolase; entropy index, me | 100.0 | |
| 1pvt_A | 238 | Sugar-phosphate aldolase; structural genomics, PSI | 100.0 | |
| 2z7b_A | 270 | MLR6791 protein; class II aldolase superfamily, ly | 100.0 | |
| 3m4r_A | 222 | Uncharacterized protein; short chain dehydrogenase | 100.0 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 99.97 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.95 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 99.94 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 99.94 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 99.93 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 99.92 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 99.92 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 99.91 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.91 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 99.9 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.9 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 99.9 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.89 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.89 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 99.89 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 99.89 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.89 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 99.89 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.89 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 99.89 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 99.88 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.88 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.88 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.88 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 99.88 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 99.88 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 99.88 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 99.88 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.88 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 99.88 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.88 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.87 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.87 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.87 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 99.87 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 99.87 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.87 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 99.87 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 99.87 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.87 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 99.86 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 99.86 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 99.86 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 99.86 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 99.86 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.86 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 99.86 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.86 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 99.86 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 99.85 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 99.85 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 99.85 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.85 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 99.85 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 99.84 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 99.84 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.84 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 99.84 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 99.84 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.83 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 99.83 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 99.82 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 99.82 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 99.82 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 99.81 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 99.8 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.8 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 99.79 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 99.78 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.78 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 99.77 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.77 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 99.76 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.75 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.74 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.73 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.73 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 99.73 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.71 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.71 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 99.71 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 99.7 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 99.67 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.66 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.66 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.65 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 99.63 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.62 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.62 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.62 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.61 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.61 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.6 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 99.6 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.59 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 99.59 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.59 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 99.58 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.58 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.57 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.54 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.53 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 99.51 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 99.51 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 99.5 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 99.5 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 99.24 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.49 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.49 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 99.48 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 99.45 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.43 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 99.43 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 99.27 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 99.23 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 99.14 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 99.13 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 99.06 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 99.02 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 99.01 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 99.0 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 98.99 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 98.98 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 98.95 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 98.88 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 98.86 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 98.86 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 98.84 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 98.83 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 98.79 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 98.75 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.7 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 98.68 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 98.6 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 98.55 | |
| 2jc9_A | 555 | Cytosolic purine 5'-nucleotidase; cytosolic 5-prim | 98.54 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 98.47 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 98.32 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 98.23 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 98.14 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 98.02 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 97.87 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 97.82 | |
| 4g63_A | 470 | Cytosolic IMP-GMP specific 5'-nucleotidase; struct | 97.79 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 97.54 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 97.49 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 97.32 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 97.07 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 97.05 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 97.05 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 97.04 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 97.04 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 96.87 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 96.2 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 96.01 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 95.86 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 95.57 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 95.3 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 95.09 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 95.06 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 94.78 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 94.58 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 94.18 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 92.84 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 92.18 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 92.17 | |
| 3geb_A | 274 | EYES absent homolog 2; hydrolase, activator, alter | 89.55 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 87.34 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 80.92 |
| >1e4c_P L-fuculose 1-phosphate aldolase; aldolase (class II), bacterial L-fucose metabolism; 1.66A {Escherichia coli} SCOP: c.74.1.1 PDB: 1fua_A 2fua_A 3fua_A 4fua_A* 1dzv_P 1e4b_P 1e47_P* 1e48_P* 1dzz_P 1e46_P 1dzu_P 1dzy_P 1dzx_P 1dzw_P 1e49_P 1e4a_P | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-44 Score=341.64 Aligned_cols=204 Identities=22% Similarity=0.320 Sum_probs=178.7
Q ss_pred ccHHHHHHHHHHHHHHHHHcCCccccCCceeEEeCCCCCCCCccEEEEeccCCCCCCCCCCCEEEEeCCCCeecCCCCCC
Q 010305 25 RAVKETRVLISELCRHFYTLGWVSGTGGSITIKVHDDSIPKPQQLILMSPSGVQKERMEPEDMYVLSGNGTTLSSPSPKP 104 (513)
Q Consensus 25 ~~~~~~r~~l~~~~r~l~~~gl~~~~~GNiSvR~~~~~~~~~~~~~litpsG~~~~~l~~~div~vd~~g~~~~g~~~~p 104 (513)
|+.+++|++|++++|+++++||+.+++||||+|+++ .|||||||+++++++++||++||++|++++|. +|
T Consensus 1 m~~~~~r~~l~~~~r~l~~~gl~~~~~GNiS~R~~~--------~~lItpsG~~~~~l~~~dlv~vd~~G~~~~g~--~p 70 (215)
T 1e4c_P 1 MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQD--------GMLITPTGIPYEKLTESHIVFIDGNGKHEEGK--LP 70 (215)
T ss_dssp CCHHHHHHHHHHHHHHHHHTTSCCTTCCEEEEEETT--------EEEECCTTCCGGGCCGGGCEEECTTCCBCTTC--CC
T ss_pred CCHHHHHHHHHHHHHHHHHCcCCCCCCCeEEEEeCC--------cEEEeCCCCCcccCCHHHEEEEcCCCCCCCCC--CC
Confidence 567789999999999999999999999999999987 79999999999999999999999999999875 35
Q ss_pred CCCCCCCCCCchHHHHHHHHhc-CccEEEecCChHHHHHHhhcCCCcccccchHHHHhhhcCCcccccceeeeecCC-CC
Q 010305 105 YPHKPPKCSDCAPLFMKAYEKR-DAGAVIHSHGIESCLVTMINPMSKEFRITHMEMIKGIKGHGYYDELVVPIIENT-AY 182 (513)
Q Consensus 105 ~~~~p~~~S~E~~lH~~iy~~~-d~~aVvH~H~~~~~a~s~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~vpv~~~~-~~ 182 (513)
|+|+.+|+.||+.| |++||+|+||+|+++||+.+.. ++..++ +...++|. .||+++|. ++
T Consensus 71 --------Sse~~lH~~iy~~rpdv~aVvHtHs~~~~a~s~~~~~---l~~~~~-~~~~~~~~------~ip~~~y~~~g 132 (215)
T 1e4c_P 71 --------QSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRS---IPAIHY-MIAAAGGN------SIPCAPYATFG 132 (215)
T ss_dssp --------CTTHHHHHHHHHHCTTCCEEEEECCHHHHHHHHHTCC---BCSSSG-GGGGGTSS------CBCEECCCCTT
T ss_pred --------ChHHHHHHHHHHhCCCCCEEEEcCcHHHHHHHHhCCC---CCcccH-HHHHhCCC------CcceeeCCCCC
Confidence 89999999999999 9999999999999999999753 433332 33334321 49999995 68
Q ss_pred chHHHHHHHHHHhhCCCceEEEEcCCcceeecCCHHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCCccccccccc
Q 010305 183 ENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPTRNFKLGL 259 (513)
Q Consensus 183 ~~~la~~v~~~l~~~~~~~~vll~nHG~~~~G~sl~~A~~~~~~lE~~a~~~~~a~~~g~~~~~~~~~~~~~~~~~~ 259 (513)
+.++++.+++++++ .++|||+|||+++||+|+.+|+.+++.+|++|++++.++++|.+....++++++++.+..
T Consensus 133 ~~~la~~i~~~l~~---~~avll~nHG~~~~G~~~~eA~~~~~~lE~~a~~~~~a~~~g~~~~~l~~~~~~~~~~~~ 206 (215)
T 1e4c_P 133 TRELSEHVALALKN---RKATLLQHHGLIACEVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIAVVLEKF 206 (215)
T ss_dssp CHHHHHHHHHHTSS---CSEEEETTTEEEEEESSHHHHHHHHHHHHHHHHHHHHHHTTCSSCCCCCHHHHHHHHHHC
T ss_pred cHHHHHHHHHHhcc---CCEEEEcCCCcEEEeCCHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCHHHHHHHHHHH
Confidence 89999999999986 699999999999999999999999999999999999999999875566777888776544
|
| >2irp_A Putative aldolase class 2 protein AQ_1979; aldehyde, enzymatic mechanism; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ocr_A Class II aldolase/adducin domain protein; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG, lyase; 1.95A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2opi_A L-fuculose-1-phosphate aldolase; L-fuculose-1-phosphate aldolas structural genomics, PSI-2, protein structure initiative; 2.50A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1k0w_A L-ribulose 5 phosphate 4-epimerase; aldolase, isomerase; 2.10A {Escherichia coli} SCOP: c.74.1.1 PDB: 1jdi_A | Back alignment and structure |
|---|
| >2fk5_A Fuculose-1-phosphate aldolase; class II aldolase, metal binding, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2flf_A | Back alignment and structure |
|---|
| >2v9l_A Rhamnulose-1-phosphate aldolase; entropy index, metal-binding, oligomerization, zinc, lyase, class II, cytoplasm; HET: PGO; 1.23A {Escherichia coli} PDB: 2uyv_A* 1ojr_A 2v9g_A* 1gt7_A* 2v9n_A* 2uyu_A* 2v9m_A* 2v9o_A 2v9e_A 2v9f_A 2v9i_A 2v29_A 2v2a_A* 2v2b_A | Back alignment and structure |
|---|
| >1pvt_A Sugar-phosphate aldolase; structural genomics, PSI, protein initiative, midwest center for structural genomics, MCSG; 2.50A {Thermotoga maritima} SCOP: c.74.1.1 | Back alignment and structure |
|---|
| >2z7b_A MLR6791 protein; class II aldolase superfamily, lyase; 1.90A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3m4r_A Uncharacterized protein; short chain dehydrogenase, class II aldolase, adducin head D carbohydrate metabolism, structural genomics; 2.00A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 513 | ||||
| d1zs9a1 | 253 | c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien | 3e-28 | |
| d1pvta_ | 232 | c.74.1.1 (A:) Putative sugar-phosphate aldolase {T | 3e-25 | |
| d1k0wa_ | 223 | c.74.1.1 (A:) L-ribulose-5-phosphate 4-epimerase { | 2e-24 | |
| d2g80a1 | 225 | c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast | 2e-18 | |
| d1ojra_ | 274 | c.74.1.1 (A:) L-rhamnulose-1-phosphate aldolase {E | 4e-18 | |
| d1e4cp_ | 206 | c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Esc | 1e-17 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 0.004 |
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Enolase-phosphatase E1 domain: E-1 enzyme species: Human(Homo sapiens) [TaxId: 9606]
Score = 110 bits (275), Expect = 3e-28
Identities = 100/215 (46%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
Query: 285 RCIVLDIEGTTTPISFVSEVLFPYARDNVGKHLSVTYDTAETQDDIKLLRSQVEDDLKQG 344
I+LDIEGTTTPI+FV ++LFPY +NV ++L ++ E Q D+ LLR Q E+D
Sbjct: 8 TVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLD 67
Query: 345 VAGAVPIPPGDAGKE--EVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGE 402
A +P G+ + ++I A+V NV + DRK TALKQLQGH+WR F + ++ E
Sbjct: 68 GAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAE 127
Query: 403 VFDDVPEALEKWHSLGTKVYIYSSGSRLAQRLIFGNSNYGDLRKYLSGFFDTAVGNKRET 462
F DV A+ KW G KVYIYSSGS AQ+L+FG+S GD+ + + G FDT +G+K E+
Sbjct: 128 FFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVES 187
Query: 463 PSYVEITNSLGVDKPSEILFVTDVYQEATAAKAAG 497
SY +I +S+G + ILF+TDV +EA+AA+ A
Sbjct: 188 ESYRKIADSIGCS-TNNILFLTDVTREASAAEEAD 221
|
| >d1pvta_ c.74.1.1 (A:) Putative sugar-phosphate aldolase {Thermotoga maritima [TaxId: 2336]} Length = 232 | Back information, alignment and structure |
|---|
| >d1k0wa_ c.74.1.1 (A:) L-ribulose-5-phosphate 4-epimerase {Escherichia coli [TaxId: 562]} Length = 223 | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 225 | Back information, alignment and structure |
|---|
| >d1ojra_ c.74.1.1 (A:) L-rhamnulose-1-phosphate aldolase {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1e4cp_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 513 | |||
| d1e4cp_ | 206 | L-fuculose-1-phosphate aldolase {Escherichia coli | 100.0 | |
| d1ojra_ | 274 | L-rhamnulose-1-phosphate aldolase {Escherichia col | 100.0 | |
| d1pvta_ | 232 | Putative sugar-phosphate aldolase {Thermotoga mari | 100.0 | |
| d1k0wa_ | 223 | L-ribulose-5-phosphate 4-epimerase {Escherichia co | 100.0 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 99.94 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 99.94 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 99.93 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 99.93 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 99.93 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 99.92 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 99.91 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 99.91 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 99.91 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 99.91 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 99.91 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 99.91 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 99.9 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 99.89 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 99.88 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 99.88 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 99.86 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 99.85 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 99.81 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 99.79 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 99.79 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 99.76 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 99.69 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.67 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 99.63 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 99.6 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 99.6 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 99.51 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.48 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.44 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.43 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 99.29 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 98.89 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 98.87 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 98.81 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 98.72 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 98.56 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 98.41 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 98.38 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 98.25 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 98.16 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 98.11 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 98.0 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.87 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 97.76 | |
| d2bdea1 | 458 | Cytosolic IMP-GMP specific 5'-nucleotidase {Legion | 97.74 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 97.71 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 97.63 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 97.62 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 97.61 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 96.94 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 96.82 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 96.8 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 96.46 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 95.15 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 94.83 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 94.19 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 90.62 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 81.96 |
| >d1e4cp_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: AraD/HMP-PK domain-like superfamily: AraD/HMP-PK domain-like family: AraD-like aldolase/epimerase domain: L-fuculose-1-phosphate aldolase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=5.3e-43 Score=329.81 Aligned_cols=200 Identities=21% Similarity=0.301 Sum_probs=176.3
Q ss_pred ccHHHHHHHHHHHHHHHHHcCCccccCCceeEEeCCCCCCCCccEEEEeccCCCCCCCCCCCEEEEeCCCCeecCCCCCC
Q 010305 25 RAVKETRVLISELCRHFYTLGWVSGTGGSITIKVHDDSIPKPQQLILMSPSGVQKERMEPEDMYVLSGNGTTLSSPSPKP 104 (513)
Q Consensus 25 ~~~~~~r~~l~~~~r~l~~~gl~~~~~GNiSvR~~~~~~~~~~~~~litpsG~~~~~l~~~div~vd~~g~~~~g~~~~p 104 (513)
|+.+++|++|+++||.|+++||+.+++||||+|+++ .|||||||+++++++++|++.||++|++++|. +|
T Consensus 1 m~~~~l~~~l~~~~r~l~~~Gl~~g~~GniS~R~~d--------~~lIt~sG~~~~~l~~~dlv~v~~~g~~~~g~--~p 70 (206)
T d1e4cp_ 1 MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQD--------GMLITPTGIPYEKLTESHIVFIDGNGKHEEGK--LP 70 (206)
T ss_dssp CCHHHHHHHHHHHHHHHHHTTSCCTTCCEEEEEETT--------EEEECCTTCCGGGCCGGGCEEECTTCCBCTTC--CC
T ss_pred CCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEeCC--------cEEEeCCCCChhhCCHHhcccccccccccccc--cc
Confidence 577899999999999999999999999999999976 79999999999999999999999999998874 45
Q ss_pred CCCCCCCCCCchHHHHHHHHhc-CccEEEecCChHHHHHHhhcCCCcccccchHHHHhhhcCCcccccceeeeecCC-CC
Q 010305 105 YPHKPPKCSDCAPLFMKAYEKR-DAGAVIHSHGIESCLVTMINPMSKEFRITHMEMIKGIKGHGYYDELVVPIIENT-AY 182 (513)
Q Consensus 105 ~~~~p~~~S~E~~lH~~iy~~~-d~~aVvH~H~~~~~a~s~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~vpv~~~~-~~ 182 (513)
|+|+.+|..||+.| |++||+|+||+|++++|+.... ++....+....+++ .+|+++|. |+
T Consensus 71 --------s~e~~~H~~iy~~rpdv~avvH~H~~~~~a~s~~~~~---~~~~~~~~~~~~~~-------~~~~~~y~~~g 132 (206)
T d1e4cp_ 71 --------QSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRS---IPAIHYMIAAAGGN-------SIPCAPYATFG 132 (206)
T ss_dssp --------CTTHHHHHHHHHHCTTCCEEEEECCHHHHHHHHHTCC---BCSSSGGGGGGTSS-------CBCEECCCCTT
T ss_pred --------chhHHHHHHHHHhccCcceEEEecCcceeeehhhcCC---CCchhHHHHHHcCC-------ceeecCCcCCc
Confidence 89999999999999 9999999999999999999753 32222222222222 48888885 68
Q ss_pred chHHHHHHHHHHhhCCCceEEEEcCCcceeecCCHHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCCccccc
Q 010305 183 ENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPTRNF 255 (513)
Q Consensus 183 ~~~la~~v~~~l~~~~~~~~vll~nHG~~~~G~sl~~A~~~~~~lE~~a~~~~~a~~~g~~~~~~~~~~~~~~ 255 (513)
+.++++.+++++++ .+++||+|||+++||+|+.+||.+++.+|++|++++.++++|.+.+.+++++++++
T Consensus 133 ~~~~~~~~~~~l~~---~~~~ll~nHG~~~~G~s~~eA~~~~~~lE~~a~~~l~a~~~G~~~~~l~~ee~~~~ 202 (206)
T d1e4cp_ 133 TRELSEHVALALKN---RKATLLQHHGLIACEVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIAVV 202 (206)
T ss_dssp CHHHHHHHHHHTSS---CSEEEETTTEEEEEESSHHHHHHHHHHHHHHHHHHHHHHTTCSSCCCCCHHHHHHH
T ss_pred chhHHHHHHHHHhc---CCceeecCcccEEEcCCHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCHHHHHHH
Confidence 99999999999987 69999999999999999999999999999999999999999999888888787776
|
| >d1ojra_ c.74.1.1 (A:) L-rhamnulose-1-phosphate aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pvta_ c.74.1.1 (A:) Putative sugar-phosphate aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1k0wa_ c.74.1.1 (A:) L-ribulose-5-phosphate 4-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|