Citrus Sinensis ID: 010322

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---

MKGVQSQLGQQIRVACKPNRNERNLQQSRRGVVRCEVAVDPSSASALEQLKASAPDRYTKERSSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVADVETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELDKCLSKMGDDISKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTLDETLENMHALNRMFGLETDTSLFEQKVRAKIEQNQK

cccccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHccccccccccccEEEEEEEccccccHHHHHHcccccccHHHHHHHHHccccccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHcccccccccccHHHHHcccccEEEEcccccccccccccccccccHHHHccccEEEEEEcccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcc

ccccEccccccEEEccccccccHHHEEccccEEEEccccccccHHHHHHHHHcHHcHHHHccccEEEEEEccccccEEEEEEEcccHHHHHHHHHHHHccccccEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHccccHHHHHccHEEEccHHHHHHHHHHHHccccHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccEEEEEEccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHccccEEEEccHHHHHHHHHcccEEEEcccccccEEcHHHHHHcHHHHHHccccEEEEEEEccccccHcHcccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcc

MKGVQSQLGQQIRVackpnrnernlqqsrrgvvrcevavdpssaSALEQLKasapdrytkeRSSIVVIGLSvhtapvemreklaipeaewpraigelcnlnHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMsktsgipvaeLCEHRFLLYNKDATQHLFEVSAgldslvlgeGQILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEMLSCAADADVVftstaseaplflkdhvqdlppveaavgglrlfidisvprnvgscvadvetarvynvdDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELDKCLSKmgddiskktRRAVDDLSRGIMNKLlhgpmqhlrcdgsdsrtlDETLENMHALNRmfgletdtsLFEQKVRAKIEQNQK

mkgvqsqlgqqirvackpnrnernlqqsrrgvvRCEVAVdpssasaleqlkasapdrytkerSSIVVIGlsvhtapvemREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVadvetarvynvddlkevvaANKEDRLRKAMEAQAIITeeskqfaawrdsletvptikklraYAERIRVAELDkclskmgddiskktrravdDLSRGIMNKllhgpmqhlrcdGSDSRTLDETLENMHALNRMFGLETDTSLFEQKVRAKIEQNQK

MKGVQSQLGQQIRVACKPNRNERNLQQSRRGVVRCEVAVDPSSASALEQLKASAPDRYTKERSSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAqvkqvvkvgqgvvgFGRNISGLFKHAISVGKRVRTETNIaagavsvssaavELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVADVETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELDKCLSKMGDDISKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTLDETLENMHALNRMFGLETDTSLFEQKVRAKIEQNQK

***************************************************************SIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVADVETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELDKCLSKM*****************GIMNKLLH*************************LNRMFGL********************

***********************************************************KERSSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLP***AAVGGLRLFIDISVPRNVGSCVADVETARVYNVDDLKEVVA*********AMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELD***************RAVDDLSRGIMNKLLHGPMQHL*************LENMHALNRMFGL********************

**********QIRVACKPNRNERNLQQSRRGVVRCEVAVDPSSASALEQLKASAPDRYTKERSSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVADVETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELDKCLSKMGDDISKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTLDETLENMHALNRMFGLETDTSLFEQKVR********

***VQSQLGQQIRVACKPNRNERNLQQSRRGVVRCEVAVD*SSASAL*QLKASAPDRYTKERSSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVADVETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELDKCLSKMGDDISKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTLDETLENMHALNRMFGLETDTSLFEQKVRA*******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		513	2.2.26 [Sep-21-2011]
P93111		552	Glutamyl-tRNA reductase 1	N/A	no	0.968	0.900	0.835	0.0
P42804		543	Glutamyl-tRNA reductase 1	yes	no	0.980	0.926	0.808	0.0
P49294		530	Glutamyl-tRNA reductase 2	no	no	0.949	0.918	0.798	0.0
P49295		542	Glutamyl-tRNA reductase 2	N/A	no	0.910	0.861	0.765	0.0
Q42843		527	Glutamyl-tRNA reductase 1	N/A	no	0.941	0.916	0.718	0.0
Q96563		465	Glutamyl-tRNA reductase 2	N/A	no	0.902	0.995	0.731	0.0
O65796		535	Glutamyl-tRNA reductase 3	N/A	no	0.906	0.869	0.708	0.0
P0C587		537	Glutamyl-tRNA reductase,	yes	no	0.906	0.865	0.734	0.0
A2Z928		537	Glutamyl-tRNA reductase,	N/A	no	0.906	0.865	0.734	0.0
Q117I4		431	Glutamyl-tRNA reductase O	yes	no	0.826	0.983	0.465	1e-102

>sp\|P93111\|HEM11_CUCSA Glutamyl-tRNA reductase 1, chloroplastic OS=Cucumis sativus GN=HEMA1 PE=2 SV=1	Back alignment and function desciption

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/516 (83%), Positives = 460/516 (89%), Gaps = 19/516 (3%)

Query: 16  CKPNRNERNLQQSRRGV-----VRCEVA----------VDP---SSASALEQLKASAPDR 57
           CK  R  R L Q R GV      +CE+A          +DP   S+ SALEQLK SA DR
Sbjct: 38  CKSIRTRRILFQ-RTGVSSFTPFKCELASSDVLVQNDEIDPPKSSNLSALEQLKTSAVDR 96

Query: 58  YTKERSSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEI 117
           YTKERSSIVVIGLS+HT PVEMREKLAIPEAEWPRAIGELC LNHIEEAAVLSTCNRMEI
Sbjct: 97  YTKERSSIVVIGLSIHTTPVEMREKLAIPEAEWPRAIGELCGLNHIEEAAVLSTCNRMEI 156

Query: 118 YVVALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEG 177
           YVVALSQHRGVKEVTEWMSKTSGIPV+E+C+HRFLLYN DATQH+FEVSAGLDSLVLGEG
Sbjct: 157 YVVALSQHRGVKEVTEWMSKTSGIPVSEICQHRFLLYNNDATQHIFEVSAGLDSLVLGEG 216

Query: 178 QILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALM 237
           QILAQVKQVVKVGQGV GFGRNISGLFKHAI+VGKRVRTETNIAAGAVSVSSAAVELALM
Sbjct: 217 QILAQVKQVVKVGQGVAGFGRNISGLFKHAITVGKRVRTETNIAAGAVSVSSAAVELALM 276

Query: 238 KLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIY 297
           KLPE SHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERV AI EE+  VEIIY
Sbjct: 277 KLPEPSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVTAIREEMKDVEIIY 336

Query: 298 KPLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSC 357
           KPL+EMLSC A+ADV+FTSTASE+ LF K+ V+DLPPV   VGGLRLFIDISVPRNVG+C
Sbjct: 337 KPLTEMLSCTAEADVIFTSTASESLLFTKEQVKDLPPVGHDVGGLRLFIDISVPRNVGAC 396

Query: 358 VADVETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKL 417
           + ++E  RVYNVDDLKEVVAANKEDRLRKAMEAQ+IITEESKQF AWRDSLETVPTIKKL
Sbjct: 397 INNLEDVRVYNVDDLKEVVAANKEDRLRKAMEAQSIITEESKQFEAWRDSLETVPTIKKL 456

Query: 418 RAYAERIRVAELDKCLSKMGDDISKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTL 477
           RAYAERIR AEL+KCLSKMGDDI KKTRRAVDDLSRGI+NKLLHGPMQHLRCDGSDSRTL
Sbjct: 457 RAYAERIRTAELEKCLSKMGDDIPKKTRRAVDDLSRGIVNKLLHGPMQHLRCDGSDSRTL 516

Query: 478 DETLENMHALNRMFGLETDTSLFEQKVRAKIEQNQK 513
            ETLENMHALNRMF LET+ ++ EQK+RAK+EQNQK
Sbjct: 517 SETLENMHALNRMFSLETEIAVLEQKIRAKVEQNQK 552

Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Cucumis sativus (taxid: 3659)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 7EC: 0

>sp\|P42804\|HEM11_ARATH Glutamyl-tRNA reductase 1, chloroplastic OS=Arabidopsis thaliana GN=HEMA1 PE=1 SV=2	Back alignment and function description

>sp\|P49294\|HEM12_ARATH Glutamyl-tRNA reductase 2, chloroplastic OS=Arabidopsis thaliana GN=HEMA2 PE=2 SV=2	Back alignment and function description

>sp\|P49295\|HEM12_CUCSA Glutamyl-tRNA reductase 2, chloroplastic OS=Cucumis sativus GN=HEMA2 PE=2 SV=1	Back alignment and function description

>sp\|Q42843\|HEM11_HORVU Glutamyl-tRNA reductase 1, chloroplastic OS=Hordeum vulgare GN=HEMA1 PE=1 SV=1	Back alignment and function description

>sp\|Q96563\|HEM12_HORVU Glutamyl-tRNA reductase 2 (Fragment) OS=Hordeum vulgare GN=HEMA2 PE=2 SV=1	Back alignment and function description

>sp\|O65796\|HEM13_HORVU Glutamyl-tRNA reductase 3, chloroplastic OS=Hordeum vulgare GN=HEMA3 PE=2 SV=1	Back alignment and function description

>sp\|P0C587\|HEM1_ORYSJ Glutamyl-tRNA reductase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os10g0502400 PE=2 SV=1	Back alignment and function description

>sp\|A2Z928\|HEM1_ORYSI Glutamyl-tRNA reductase, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_033071 PE=2 SV=2	Back alignment and function description

>sp\|Q117I4\|HEM1_TRIEI Glutamyl-tRNA reductase OS=Trichodesmium erythraeum (strain IMS101) GN=hemA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		513
225458990		545	PREDICTED: glutamyl-tRNA reductase 1, ch	0.976	0.919	0.869	0.0
150171033		542	glutamyl tRNA Reductase [Nicotiana tabac	0.920	0.870	0.889	0.0
449461347		552	PREDICTED: glutamyl-tRNA reductase 1, ch	0.968	0.900	0.835	0.0
356552995		538	PREDICTED: glutamyl-tRNA reductase 1, ch	0.957	0.912	0.844	0.0
449521415		552	PREDICTED: LOW QUALITY PROTEIN: glutamyl	0.968	0.900	0.833	0.0
356500793		542	PREDICTED: glutamyl-tRNA reductase 1, ch	0.957	0.905	0.842	0.0
4324495		542	glutamyl-tRNA reductase precursor [Glyci	0.957	0.905	0.842	0.0
356515671		536	PREDICTED: glutamyl-tRNA reductase 1, ch	0.962	0.921	0.832	0.0
255537860		565	Glutamyl-tRNA reductase 1, chloroplast p	0.974	0.884	0.850	0.0
356507973		539	PREDICTED: glutamyl-tRNA reductase 1, ch	0.962	0.916	0.829	0.0

>gi\|225458990\|ref\|XP_002285583.1\| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic [Vitis vinifera] gi\|147816412\|emb\|CAN77439.1\| hypothetical protein VITISV_007402 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/515 (86%), Positives = 471/515 (91%), Gaps = 14/515 (2%)

Query: 11  QIRVACKPNRNERNLQQSRRGVV---RCEVAVD---------PSSASALEQLKASAPDRY 58
           Q R+ CKP R  R+L Q  RG     RCEVA D          SS SALEQLK SA DRY
Sbjct: 33  QYRIFCKPARTRRSLIQ--RGASLNSRCEVASDALVDTDSTRSSSVSALEQLKTSAADRY 90

Query: 59  TKERSSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIY 118
           TKERSSIVVIGLS+HT PVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIY
Sbjct: 91  TKERSSIVVIGLSIHTTPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIY 150

Query: 119 VVALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQ 178
           VVALSQHRGVKEVTEWMSKTSG+PV+ELC HRFLLYNKDATQHLFEVSAGLDSLVLGEGQ
Sbjct: 151 VVALSQHRGVKEVTEWMSKTSGVPVSELCHHRFLLYNKDATQHLFEVSAGLDSLVLGEGQ 210

Query: 179 ILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMK 238
           ILAQVKQVVKVGQGVVGFGRNISGLFKHAI+VGKRVRTETNIAAGAVSVSSAAVELALMK
Sbjct: 211 ILAQVKQVVKVGQGVVGFGRNISGLFKHAITVGKRVRTETNIAAGAVSVSSAAVELALMK 270

Query: 239 LPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYK 298
           LPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMV+VNR EERVAAI EE+  VEIIY+
Sbjct: 271 LPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVIVNRGEERVAAIREEMKDVEIIYR 330

Query: 299 PLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCV 358
           PL+EML+CAA+ADVVFTSTASE PLFLK+HV+DLP V   VGGLRLF+DISVPRNVG+CV
Sbjct: 331 PLTEMLACAAEADVVFTSTASETPLFLKEHVKDLPAVGQDVGGLRLFVDISVPRNVGACV 390

Query: 359 ADVETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLR 418
           +D+ETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQF AWRDSLETVPTIKKLR
Sbjct: 391 SDLETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFEAWRDSLETVPTIKKLR 450

Query: 419 AYAERIRVAELDKCLSKMGDDISKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTLD 478
           AYAERIRVAEL+KCLSKMGDDISKKTRRAVDDLSRGI+NKLLHGPMQHLRCDGSDSRTL 
Sbjct: 451 AYAERIRVAELEKCLSKMGDDISKKTRRAVDDLSRGIVNKLLHGPMQHLRCDGSDSRTLS 510

Query: 479 ETLENMHALNRMFGLETDTSLFEQKVRAKIEQNQK 513
           ETLENMHALNRMF LET+ SL EQK+RAK+EQ QK
Sbjct: 511 ETLENMHALNRMFSLETEISLLEQKIRAKVEQTQK 545

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|150171033\|emb\|CAN88916.1\| glutamyl tRNA Reductase [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|449461347\|ref\|XP_004148403.1\| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic-like [Cucumis sativus] gi\|2495155\|sp\|P93111.1\|HEM11_CUCSA RecName: Full=Glutamyl-tRNA reductase 1, chloroplastic; Short=GluTR; Flags: Precursor gi\|1694926\|dbj\|BAA08910.1\| glutamyl-tRNA reductase [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356552995\|ref\|XP_003544844.1\| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|449521415\|ref\|XP_004167725.1\| PREDICTED: LOW QUALITY PROTEIN: glutamyl-tRNA reductase 1, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356500793\|ref\|XP_003519215.1\| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|4324495\|gb\|AAD16897.1\| glutamyl-tRNA reductase precursor [Glycine max]	Back alignment and taxonomy information

>gi\|356515671\|ref\|XP_003526522.1\| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|255537860\|ref\|XP_002509995.1\| Glutamyl-tRNA reductase 1, chloroplast precursor, putative [Ricinus communis] gi\|223550696\|gb\|EEF52182.1\| Glutamyl-tRNA reductase 1, chloroplast precursor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356507973\|ref\|XP_003522737.1\| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		513
TAIR\|locus:2016605		543	HEMA1 [Arabidopsis thaliana (t	0.988	0.933	0.765	5e-202
TAIR\|locus:2024392		530	HEMA2 [Arabidopsis thaliana (t	0.953	0.922	0.747	6.7e-191
TAIR\|locus:2042516		524	HEMA3 [Arabidopsis thaliana (t	0.923	0.904	0.633	3.7e-151
TIGR_CMR\|GSU_3284		434	GSU_3284 "glutamyl-tRNA reduct	0.820	0.970	0.348	5.1e-58
TIGR_CMR\|CHY_1207		449	CHY_1207 "glutamyl-tRNA reduct	0.764	0.873	0.353	2.2e-57
UNIPROTKB\|Q9KQ24		419	hemA "Glutamyl-tRNA reductase"	0.764	0.935	0.353	4.3e-54
TIGR_CMR\|VC_2180		419	VC_2180 "glutamyl-tRNA reducta	0.764	0.935	0.353	4.3e-54
TIGR_CMR\|SO_3834		416	SO_3834 "glutamyl-tRNA reducta	0.762	0.939	0.329	9.2e-52
TIGR_CMR\|BA_4698		444	BA_4698 "glutamyl-tRNA reducta	0.760	0.878	0.328	1.1e-50
UNIPROTKB\|P0A6X1		418	hemA "HemA" [Escherichia coli	0.812	0.997	0.299	7.7e-48

TAIR\|locus:2016605 HEMA1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1955 (693.3 bits), Expect = 5.0e-202, P = 5.0e-202
 Identities = 392/512 (76%), Positives = 433/512 (84%)

Query:     5 QSQLGQQ-IRVACKPNRNERNLQQSRRGVVRC--EVAVDPSSASALEQLKASAPDRYTKE 61
             Q+ LG   +RV  K NR  R L Q  R  +    + A + +S SALEQLK SA DRYTKE
Sbjct:    34 QTPLGLNGVRVLPKNNRTRRGLIQKARCELSASSDSASNAASISALEQLKNSAADRYTKE 93

Query:    62 RSSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVA 121
             RSSIVVIGLS+HTAPVEMREKLAIPEAEWPRAI ELC LNHIEEAAVLSTCNRMEIYV+A
Sbjct:    94 RSSIVVIGLSIHTAPVEMREKLAIPEAEWPRAIAELCGLNHIEEAAVLSTCNRMEIYVLA 153

Query:   122 LSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILA 181
             LSQHRGVKEVTEWMSKTSGIPV+E+C+HRFLLYNKDATQH+FEVSAGLDSLVLGEGQILA
Sbjct:   154 LSQHRGVKEVTEWMSKTSGIPVSEICQHRFLLYNKDATQHIFEVSAGLDSLVLGEGQILA 213

Query:   182 XXXXXXXXXXXXXXFGRNISGLFKHAISVGKRVRTETNIXXXXXXXXXXXXELALMKLPE 241
                           FGRNISGLFKHAI+VGKRVRTETNI            ELALMKLP+
Sbjct:   214 QVKQVVKVGQGVNGFGRNISGLFKHAITVGKRVRTETNIASGAVSVSSAAVELALMKLPQ 273

Query:   242 SSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLS 301
             SS+ +ARM VIGAGKMGKLVIKHL+AKGCTK+VVVNRSEERV+AI EE+ G+EIIY+PL 
Sbjct:   274 SSNVSARMCVIGAGKMGKLVIKHLMAKGCTKVVVVNRSEERVSAIREEMPGIEIIYRPLD 333

Query:   302 EMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVADV 361
             EML+CA++ADVVFTSTASE PLFLK+HV++LP     VGGLR F+DISVPRNVGSCV +V
Sbjct:   334 EMLACASEADVVFTSTASETPLFLKEHVENLPQASPEVGGLRHFVDISVPRNVGSCVGEV 393

Query:   362 ETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYA 421
             ETARVYNVDDLKEVVAANKEDR+RKAMEAQ IITEES QF AWRDSLETVPTIKKLRAYA
Sbjct:   394 ETARVYNVDDLKEVVAANKEDRMRKAMEAQTIITEESTQFEAWRDSLETVPTIKKLRAYA 453

Query:   422 ERIRVAELDKCLSKMGDDISKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTLDETL 481
             ERIRVAEL+KC+SKMGDDI+KKT RAVDDLSRGI+N+ LHGPMQHLRCDGSDSRTL ETL
Sbjct:   454 ERIRVAELEKCMSKMGDDINKKTTRAVDDLSRGIVNRFLHGPMQHLRCDGSDSRTLSETL 513

Query:   482 ENMHALNRMFGLETDTSLFEQKVRAKIEQNQK 513
             ENMHALNRM+GLE D  + E+K++A  EQ QK
Sbjct:   514 ENMHALNRMYGLEKD--ILEEKLKAMAEQQQK 543

GO:0000166 "nucleotide binding" evidence=IEA

GO:0008883 "glutamyl-tRNA reductase activity" evidence=IEA;IGI;TAS

GO:0009507 "chloroplast" evidence=ISM;IDA;TAS

GO:0033014 "tetrapyrrole biosynthetic process" evidence=IEA

GO:0050661 "NADP binding" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0006783 "heme biosynthetic process" evidence=RCA;IMP

GO:0015995 "chlorophyll biosynthetic process" evidence=IMP

GO:0005515 "protein binding" evidence=IPI

GO:0000302 "response to reactive oxygen species" evidence=RCA

GO:0010039 "response to iron ion" evidence=RCA

GO:0055072 "iron ion homeostasis" evidence=RCA

GO:0006779 "porphyrin-containing compound biosynthetic process" evidence=TAS

GO:0009416 "response to light stimulus" evidence=IEP

TAIR\|locus:2024392 HEMA2 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2042516 HEMA3 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_3284 GSU_3284 "glutamyl-tRNA reductase" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_1207 CHY_1207 "glutamyl-tRNA reductase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KQ24 hemA "Glutamyl-tRNA reductase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_2180 VC_2180 "glutamyl-tRNA reductase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_3834 SO_3834 "glutamyl-tRNA reductase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_4698 BA_4698 "glutamyl-tRNA reductase" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

UNIPROTKB\|P0A6X1 hemA "HemA" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q3M6T2	HEM1_ANAVT	1, ., 2, ., 1, ., 7, 0	0.4683	0.8167	0.9789	yes	no
A2Z928	HEM1_ORYSI	1, ., 2, ., 1, ., 7, 0	0.7344	0.9064	0.8659	N/A	no
B0BZF9	HEM1_ACAM1	1, ., 2, ., 1, ., 7, 0	0.4625	0.8362	0.9907	yes	no
O65796	HEM13_HORVU	1, ., 2, ., 1, ., 7, 0	0.7087	0.9064	0.8691	N/A	no
P49295	HEM12_CUCSA	1, ., 2, ., 1, ., 7, 0	0.7654	0.9103	0.8616	N/A	no
Q46LG2	HEM1_PROMT	1, ., 2, ., 1, ., 7, 0	0.4107	0.8343	0.9705	yes	no
B2J5E4	HEM1_NOSP7	1, ., 2, ., 1, ., 7, 0	0.4683	0.8167	0.9789	yes	no
Q5N3B4	HEM1_SYNP6	1, ., 2, ., 1, ., 7, 0	0.4411	0.8323	0.9748	yes	no
C6DYY7	HEM1_GEOSM	1, ., 2, ., 1, ., 7, 0	0.3849	0.8011	0.9470	yes	no
Q2JJG8	HEM1_SYNJB	1, ., 2, ., 1, ., 7, 0	0.4465	0.8167	0.9721	yes	no
Q2JWU6	HEM1_SYNJA	1, ., 2, ., 1, ., 7, 0	0.4431	0.8148	0.9698	yes	no
A2C1K4	HEM1_PROM1	1, ., 2, ., 1, ., 7, 0	0.4129	0.8343	0.9705	yes	no
A5GTE8	HEM1_SYNR3	1, ., 2, ., 1, ., 7, 0	0.3981	0.8167	0.9479	yes	no
Q3AK73	HEM1_SYNSC	1, ., 2, ., 1, ., 7, 0	0.4233	0.8206	0.9745	yes	no
A2BW63	HEM1_PROM5	1, ., 2, ., 1, ., 7, 0	0.4077	0.8245	0.9724	yes	no
O08393	HEM1_NOSS1	1, ., 2, ., 1, ., 7, 0	0.4683	0.8167	0.9789	yes	no
Q7V1T7	HEM1_PROMP	1, ., 2, ., 1, ., 7, 0	0.4159	0.8226	0.9745	yes	no
B5EBG7	HEM1_GEOBB	1, ., 2, ., 1, ., 7, 0	0.3826	0.8011	0.9470	yes	no
B8HR03	HEM1_CYAP4	1, ., 2, ., 1, ., 7, 0	0.4610	0.8304	0.9861	yes	no
Q96563	HEM12_HORVU	1, ., 2, ., 1, ., 7, 0	0.7311	0.9025	0.9956	N/A	no
P49294	HEM12_ARATH	1, ., 2, ., 1, ., 7, 0	0.7980	0.9493	0.9188	no	no
P93111	HEM11_CUCSA	1, ., 2, ., 1, ., 7, 0	0.8352	0.9688	0.9003	N/A	no
A5GLB0	HEM1_SYNPW	1, ., 2, ., 1, ., 7, 0	0.4236	0.8245	0.9657	yes	no
Q42843	HEM11_HORVU	1, ., 2, ., 1, ., 7, 0	0.7189	0.9415	0.9165	N/A	no
A9BAR3	HEM1_PROM4	1, ., 2, ., 1, ., 7, 0	0.4231	0.8109	0.9563	yes	no
Q117I4	HEM1_TRIEI	1, ., 2, ., 1, ., 7, 0	0.4655	0.8265	0.9837	yes	no
P42804	HEM11_ARATH	1, ., 2, ., 1, ., 7, 0	0.8081	0.9805	0.9263	yes	no
Q0I9I2	HEM1_SYNS3	1, ., 2, ., 1, ., 7, 0	0.4292	0.8226	0.9656	yes	no
P0C587	HEM1_ORYSJ	1, ., 2, ., 1, ., 7, 0	0.7344	0.9064	0.8659	yes	no
B7K1R5	HEM1_CYAP8	1, ., 2, ., 1, ., 7, 0	0.4688	0.8245	0.9883	yes	no
B1XLK6	HEM1_SYNP2	1, ., 2, ., 1, ., 7, 0	0.4472	0.8265	0.9976	yes	no
A5D3L4	HEM1_PELTS	1, ., 2, ., 1, ., 7, 0	0.3615	0.8109	0.9369	yes	no
Q8DI53	HEM1_THEEB	1, ., 2, ., 1, ., 7, 0	0.4421	0.8187	0.9859	yes	no
B1WQ09	HEM1_CYAA5	1, ., 2, ., 1, ., 7, 0	0.4688	0.8245	0.9837	yes	no
Q7NLA8	HEM1_GLOVI	1, ., 2, ., 1, ., 7, 0	0.4078	0.8226	0.9813	yes	no
Q31QY3	HEM1_SYNE7	1, ., 2, ., 1, ., 7, 0	0.4411	0.8323	0.9748	yes	no
Q7U769	HEM1_SYNPX	1, ., 2, ., 1, ., 7, 0	0.4282	0.8245	0.9791	yes	no
Q3AXK4	HEM1_SYNS9	1, ., 2, ., 1, ., 7, 0	0.4324	0.8206	0.9745	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	1.2.1.70	0.979
3rd Layer	1.2.1	0.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00015045001	RecName- Full=Glutamyl-tRNA reductase; EC=1.2.1.70; (545 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00017986001	SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (411 aa)	•	•	•	•	•	0.997
	GSVIVG00015405001	RecName- Full=Delta-aminolevulinic acid dehydratase; EC=4.2.1.24; (430 aa)	•	•		•	•	0.977
	GSVIVG00036298001	SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (566 aa)				•	•	0.975
	GSVIVG00022488001	SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (427 aa)				•	•	0.933
	GSVIVG00008868001	SubName- Full=Chromosome chr13 scaffold_210, whole genome shotgun sequence; (278 aa)	•	•			•	0.926
	GSVIVG00027816001	SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (338 aa)	•	•			•	0.838
	GSVIVG00029410001	SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (380 aa)	•	•			•	0.836
	GSVIVG00037523001	SubName- Full=Chromosome undetermined scaffold_89, whole genome shotgun sequence; (352 aa)	•				•	0.730
	GSVIVG00032163001	RecName- Full=Ferrochelatase; EC=4.99.1.1;; Catalyzes the ferrous insertion into protoporphyrin [...] (422 aa)	•				•	0.707
	GSVIVG00010463001	SubName- Full=Chromosome chr17 scaffold_263, whole genome shotgun sequence; (473 aa)	•				•	0.671

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		513
PLN00203		519	PLN00203, PLN00203, glutamyl-tRNA reductase	0.0
PRK00045		423	PRK00045, hemA, glutamyl-tRNA reductase; Reviewed	1e-151
COG0373		414	COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme m	1e-119
TIGR01035		417	TIGR01035, hemA, glutamyl-tRNA reductase	1e-109
cd05213		311	cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-bindi	1e-103
pfam05201		150	pfam05201, GlutR_N, Glutamyl-tRNAGlu reductase, N-	8e-54
pfam01488		133	pfam01488, Shikimate_DH, Shikimate / quinate 5-deh	8e-43
PRK13940		414	PRK13940, PRK13940, glutamyl-tRNA reductase; Provi	1e-42
pfam00745		101	pfam00745, GlutR_dimer, Glutamyl-tRNAGlu reductase	8e-27
PRK00676		338	PRK00676, hemA, glutamyl-tRNA reductase; Validated	6e-13
cd01065		155	cd01065, NAD_bind_Shikimate_DH, NAD(P) binding dom	9e-09
COG0169		283	COG0169, AroE, Shikimate 5-dehydrogenase [Amino ac	2e-07
pfam03807		93	pfam03807, F420_oxidored, NADP oxidoreductase coen	9e-07
cd01078		194	cd01078, NAD_bind_H4MPT_DH, NADP binding domain of	3e-05
COG2423		330	COG2423, COG2423, Predicted ornithine cyclodeamina	4e-05
pfam03435		380	pfam03435, Saccharop_dh, Saccharopine dehydrogenas	2e-04
COG0345		266	COG0345, ProC, Pyrroline-5-carboxylate reductase [	0.001
cd08242		319	cd08242, MDR_like, Medium chain dehydrogenases/red	0.002
PRK00258		278	PRK00258, aroE, shikimate 5-dehydrogenase; Reviewe	0.002
pfam03446		163	pfam03446, NAD_binding_2, NAD binding domain of 6-	0.002
PRK11880		267	PRK11880, PRK11880, pyrroline-5-carboxylate reduct	0.003

>gnl\|CDD\|215101 PLN00203, PLN00203, glutamyl-tRNA reductase	Back alignment and domain information

 Score =  904 bits (2339), Expect = 0.0
 Identities = 392/482 (81%), Positives = 432/482 (89%), Gaps = 3/482 (0%)

Query: 18  PNRNERNLQQSRRGVVRCEVAVDPSSASALEQLKASAPDRYTKERSSIVVIGLSVHTAPV 77
           P+        +    V    +   +SASALEQLK SA DRYTKE+SSIVVIGLS+HTAPV
Sbjct: 41  PSVVGSAAGLATA--VDSASS-KAASASALEQLKNSAADRYTKEKSSIVVIGLSIHTAPV 97

Query: 78  EMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSK 137
           EMREKLAIPEAEWPRAI ELC+LNHIEEAAVLSTCNRMEIYVVALS HRGVKEVTEWMSK
Sbjct: 98  EMREKLAIPEAEWPRAIAELCSLNHIEEAAVLSTCNRMEIYVVALSWHRGVKEVTEWMSK 157

Query: 138 TSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFG 197
           TSGIPV+EL +H FLLY+KDATQHLFEVS GLDSLVLGEGQILAQVKQVVKVGQGV GFG
Sbjct: 158 TSGIPVSELRQHLFLLYDKDATQHLFEVSGGLDSLVLGEGQILAQVKQVVKVGQGVDGFG 217

Query: 198 RNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPESSHATARMLVIGAGKM 257
           RN+SGLFKHAI+ GKRVRTETNIA+GAVSVSSAAVELALMKLPESSHA+AR+LVIGAGKM
Sbjct: 218 RNLSGLFKHAITAGKRVRTETNIASGAVSVSSAAVELALMKLPESSHASARVLVIGAGKM 277

Query: 258 GKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEMLSCAADADVVFTST 317
           GKL++KHLV+KGCTKMVVVNRSEERVAA+ EE   VEIIYKPL EML+CAA+ADVVFTST
Sbjct: 278 GKLLVKHLVSKGCTKMVVVNRSEERVAALREEFPDVEIIYKPLDEMLACAAEADVVFTST 337

Query: 318 ASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVADVETARVYNVDDLKEVVA 377
           +SE PLFLK+HV+ LPP    VGG RLF+DISVPRNVG+CV+++E+ARVYNVDDLKEVVA
Sbjct: 338 SSETPLFLKEHVEALPPASDTVGGKRLFVDISVPRNVGACVSELESARVYNVDDLKEVVA 397

Query: 378 ANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELDKCLSKMG 437
           ANKEDRLRKAMEAQ II EESK F AWRDSLETVPTIKKLR+YAERIR AEL+KCLSKMG
Sbjct: 398 ANKEDRLRKAMEAQTIIREESKNFEAWRDSLETVPTIKKLRSYAERIRAAELEKCLSKMG 457

Query: 438 DDISKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTLDETLENMHALNRMFGLETDT 497
           DD++KK R+AV+DLSRGI+NKLLHGPMQHLRCDGSDSRT+ ETLENMHALNRMF LET+ 
Sbjct: 458 DDLTKKQRKAVEDLSRGIVNKLLHGPMQHLRCDGSDSRTVSETLENMHALNRMFDLETEI 517

Query: 498 SL 499
           + 
Sbjct: 518 AG 519

Length = 519

>gnl\|CDD\|234592 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed	Back alignment and domain information

>gnl\|CDD\|223450 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|233242 TIGR01035, hemA, glutamyl-tRNA reductase	Back alignment and domain information

>gnl\|CDD\|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>gnl\|CDD\|218494 pfam05201, GlutR_N, Glutamyl-tRNAGlu reductase, N-terminal domain	Back alignment and domain information

>gnl\|CDD\|216527 pfam01488, Shikimate_DH, Shikimate / quinate 5-dehydrogenase	Back alignment and domain information

>gnl\|CDD\|172450 PRK13940, PRK13940, glutamyl-tRNA reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|201424 pfam00745, GlutR_dimer, Glutamyl-tRNAGlu reductase, dimerisation domain	Back alignment and domain information

>gnl\|CDD\|234810 PRK00676, hemA, glutamyl-tRNA reductase; Validated	Back alignment and domain information

>gnl\|CDD\|133443 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|223247 COG0169, AroE, Shikimate 5-dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|202773 pfam03807, F420_oxidored, NADP oxidoreductase coenzyme F420-dependent	Back alignment and domain information

>gnl\|CDD\|133446 cd01078, NAD_bind_H4MPT_DH, NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>gnl\|CDD\|225280 COG2423, COG2423, Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|217556 pfam03435, Saccharop_dh, Saccharopine dehydrogenase	Back alignment and domain information

>gnl\|CDD\|223422 COG0345, ProC, Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|234703 PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|237008 PRK11880, PRK11880, pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		513
PLN00203		519	glutamyl-tRNA reductase	100.0
PRK13940		414	glutamyl-tRNA reductase; Provisional	100.0
COG0373		414	HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	100.0
TIGR01035		417	hemA glutamyl-tRNA reductase. This enzyme, togethe	100.0
PRK00045		423	hemA glutamyl-tRNA reductase; Reviewed	100.0
PRK00676		338	hemA glutamyl-tRNA reductase; Validated	100.0
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	100.0
PF05201		152	GlutR_N: Glutamyl-tRNAGlu reductase, N-terminal do	100.0
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	99.9
PRK14982		340	acyl-ACP reductase; Provisional	99.81
PF00745		101	GlutR_dimer: Glutamyl-tRNAGlu reductase, dimerisat	99.72
COG0169		283	AroE Shikimate 5-dehydrogenase [Amino acid transpo	99.67
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	99.67
TIGR01809		282	Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO	99.65
KOG0024		354	consensus Sorbitol dehydrogenase [Secondary metabo	99.65
PRK00258		278	aroE shikimate 5-dehydrogenase; Reviewed	99.62
PRK12749		288	quinate/shikimate dehydrogenase; Reviewed	99.62
PRK14027		283	quinate/shikimate dehydrogenase; Provisional	99.61
PRK12548		289	shikimate 5-dehydrogenase; Provisional	99.55
PRK12550		272	shikimate 5-dehydrogenase; Reviewed	99.53
TIGR00507		270	aroE shikimate 5-dehydrogenase. This model finds p	99.51
PRK09310		477	aroDE bifunctional 3-dehydroquinate dehydratase/sh	99.48
COG1063		350	Tdh Threonine dehydrogenase and related Zn-depende	99.46
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	99.42
TIGR02992		326	ectoine_eutC ectoine utilization protein EutC. Mem	99.34
PLN02520		529	bifunctional 3-dehydroquinate dehydratase/shikimat	99.34
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	99.27
PRK08291		330	ectoine utilization protein EutC; Validated	99.27
TIGR03366		280	HpnZ_proposed putative phosphonate catabolism asso	99.19
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	99.13
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	99.09
PRK09880		343	L-idonate 5-dehydrogenase; Provisional	99.07
PRK06141		314	ornithine cyclodeaminase; Validated	99.06
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	99.05
PRK06407		301	ornithine cyclodeaminase; Provisional	99.03
PRK07340		304	ornithine cyclodeaminase; Validated	99.02
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	99.01
PRK08618		325	ornithine cyclodeaminase; Validated	99.0
PRK06823		315	ornithine cyclodeaminase; Validated	98.97
PRK08306		296	dipicolinate synthase subunit A; Reviewed	98.97
cd08230		355	glucose_DH Glucose dehydrogenase. Glucose dehydrog	98.96
TIGR02371		325	ala_DH_arch alanine dehydrogenase, Archaeoglobus f	98.95
cd05311		226	NAD_bind_2_malic_enz NAD(P) binding domain of mali	98.94
TIGR02819		393	fdhA_non_GSH formaldehyde dehydrogenase, glutathio	98.9
cd08239		339	THR_DH_like L-threonine dehydrogenase (TDH)-like.	98.9
cd08237		341	ribitol-5-phosphate_DH ribitol-5-phosphate dehydro	98.88
PF02423		313	OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst	98.86
COG1062		366	AdhC Zn-dependent alcohol dehydrogenases, class II	98.84
PRK07589		346	ornithine cyclodeaminase; Validated	98.84
TIGR01202		308	bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl	98.84
PRK10309		347	galactitol-1-phosphate dehydrogenase; Provisional	98.82
PLN02586		360	probable cinnamyl alcohol dehydrogenase	98.78
TIGR03201		349	dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co	98.77
PLN02178		375	cinnamyl-alcohol dehydrogenase	98.72
TIGR02822		329	adh_fam_2 zinc-binding alcohol dehydrogenase famil	98.7
TIGR02818		368	adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr	98.66
cd08281		371	liver_ADH_like1 Zinc-dependent alcohol dehydrogena	98.65
PRK06046		326	alanine dehydrogenase; Validated	98.64
TIGR00561		511	pntA NAD(P) transhydrogenase, alpha subunit. In so	98.63
COG5322		351	Predicted dehydrogenase [General function predicti	98.62
PLN02740		381	Alcohol dehydrogenase-like	98.61
PLN02827		378	Alcohol dehydrogenase-like	98.61
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	98.61
COG2423		330	Predicted ornithine cyclodeaminase, mu-crystallin	98.6
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	98.55
cd08233		351	butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog	98.54
cd08300		368	alcohol_DH_class_III class III alcohol dehydrogena	98.52
TIGR03451		358	mycoS_dep_FDH mycothiol-dependent formaldehyde deh	98.52
PRK06199		379	ornithine cyclodeaminase; Validated	98.46
cd08277		365	liver_alcohol_DH_like Liver alcohol dehydrogenase.	98.44
PRK14175		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.43
PLN02514		357	cinnamyl-alcohol dehydrogenase	98.42
PRK10083		339	putative oxidoreductase; Provisional	98.42
cd08301		369	alcohol_DH_plants Plant alcohol dehydrogenase. NAD	98.41
PF00670		162	AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase	98.4
KOG0023		360	consensus Alcohol dehydrogenase, class V [Secondar	98.4
KOG0022		375	consensus Alcohol dehydrogenase, class III [Second	98.38
PRK05476		425	S-adenosyl-L-homocysteine hydrolase; Provisional	98.37
PRK14192		283	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.37
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	98.36
PLN02702		364	L-idonate 5-dehydrogenase	98.34
cd08238		410	sorbose_phosphate_red L-sorbose-1-phosphate reduct	98.33
cd08285		351	NADP_ADH NADP(H)-dependent alcohol dehydrogenases.	98.3
cd08231		361	MDR_TM0436_like Hypothetical enzyme TM0436 resembl	98.3
cd08293		345	PTGR2 Prostaglandin reductase. Prostaglandins and	98.29
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	98.24
COG2084		286	MmsB 3-hydroxyisobutyrate dehydrogenase and relate	98.24
cd08287		345	FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik	98.23
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	98.2
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	98.2
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	98.18
cd08299		373	alcohol_DH_class_I_II_IV class I, II, IV alcohol d	98.15
cd08296		333	CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci	98.14
cd08255		277	2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_	98.12
COG0604		326	Qor NADPH:quinone reductase and related Zn-depende	98.11
cd08256		350	Zn_ADH2 Alcohol dehydrogenases of the MDR family.	98.1
cd05191		86	NAD_bind_amino_acid_DH NAD(P) binding domain of am	98.1
cd05188		271	MDR Medium chain reductase/dehydrogenase (MDR)/zin	98.1
PTZ00075		476	Adenosylhomocysteinase; Provisional	98.1
cd08269		312	Zn_ADH9 Alcohol dehydrogenases of the MDR family.	98.06
cd08265		384	Zn_ADH3 Alcohol dehydrogenases of the MDR family.	98.04
cd08232		339	idonate-5-DH L-idonate 5-dehydrogenase. L-idonate	98.03
COG0686		371	Ald Alanine dehydrogenase [Amino acid transport an	98.0
cd05285		343	sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a	98.0
cd08291		324	ETR_like_1 2-enoyl thioester reductase (ETR) like	97.99
PRK05396		341	tdh L-threonine 3-dehydrogenase; Validated	97.99
cd05284		340	arabinose_DH_like D-arabinose dehydrogenase. This	97.98
cd08278		365	benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be	97.97
cd08240		350	6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy	97.96
cd08282		375	PFDH_like Pseudomonas putida aldehyde-dismutating	97.93
PLN02928		347	oxidoreductase family protein	97.92
PRK13243		333	glyoxylate reductase; Reviewed	97.91
cd08298		329	CAD2 Cinnamyl alcohol dehydrogenases (CAD). These	97.91
PRK12491		272	pyrroline-5-carboxylate reductase; Reviewed	97.9
cd08234		334	threonine_DH_like L-threonine dehydrogenase. L-thr	97.9
cd08284		344	FDH_like_2 Glutathione-dependent formaldehyde dehy	97.89
PRK14194		301	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.89
PLN02494		477	adenosylhomocysteinase	97.88
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	97.88
cd05212		140	NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom	97.87
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	97.84
cd08283		386	FDH_like_1 Glutathione-dependent formaldehyde dehy	97.84
cd08236		343	sugar_DH NAD(P)-dependent sugar dehydrogenases. Th	97.83
PRK09422		338	ethanol-active dehydrogenase/acetaldehyde-active r	97.83
TIGR00692		340	tdh L-threonine 3-dehydrogenase. E. coli His-90 mo	97.82
PRK14188		296	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.81
cd05279		365	Zn_ADH1 Liver alcohol dehydrogenase and related zi	97.81
cd08262		341	Zn_ADH8 Alcohol dehydrogenases of the MDR family.	97.79
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	97.79
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	97.78
cd08246		393	crotonyl_coA_red crotonyl-CoA reductase. Crotonyl-	97.78
cd05283		337	CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam	97.76
PRK07574		385	formate dehydrogenase; Provisional	97.75
PRK15461		296	NADH-dependent gamma-hydroxybutyrate dehydrogenase	97.74
cd08242		319	MDR_like Medium chain dehydrogenases/reductase (MD	97.74
KOG0409		327	consensus Predicted dehydrogenase [General functio	97.74
PLN02350		493	phosphogluconate dehydrogenase (decarboxylating)	97.73
PLN03139		386	formate dehydrogenase; Provisional	97.71
cd08235		343	iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ	97.71
COG0499		420	SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me	97.7
cd08270		305	MDR4 Medium chain dehydrogenases/reductase (MDR)/z	97.7
PRK12480		330	D-lactate dehydrogenase; Provisional	97.69
COG2085		211	Predicted dinucleotide-binding enzymes [General fu	97.68
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	97.67
PRK15469		312	ghrA bifunctional glyoxylate/hydroxypyruvate reduc	97.67
PRK00257		381	erythronate-4-phosphate dehydrogenase; Validated	97.67
PRK06476		258	pyrroline-5-carboxylate reductase; Reviewed	97.66
PRK13403		335	ketol-acid reductoisomerase; Provisional	97.66
PRK15438		378	erythronate-4-phosphate dehydrogenase PdxB; Provis	97.65
cd08292		324	ETR_like_2 2-enoyl thioester reductase (ETR) like	97.65
cd08258		306	Zn_ADH4 Alcohol dehydrogenases of the MDR family.	97.64
PRK12490		299	6-phosphogluconate dehydrogenase-like protein; Rev	97.64
cd08264		325	Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam	97.63
cd08254		338	hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo	97.63
cd01079		197	NAD_bind_m-THF_DH NAD binding domain of methylene-	97.62
PRK08410		311	2-hydroxyacid dehydrogenase; Provisional	97.62
PRK06436		303	glycerate dehydrogenase; Provisional	97.61
PRK09599		301	6-phosphogluconate dehydrogenase-like protein; Rev	97.61
PRK07680		273	late competence protein ComER; Validated	97.61
cd08261		337	Zn_ADH7 Alcohol dehydrogenases of the MDR family.	97.6
COG0345		266	ProC Pyrroline-5-carboxylate reductase [Amino acid	97.6
cd08245		330	CAD Cinnamyl alcohol dehydrogenases (CAD) and rela	97.58
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	97.58
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	97.58
PRK07634		245	pyrroline-5-carboxylate reductase; Reviewed	97.57
cd08260		345	Zn_ADH6 Alcohol dehydrogenases of the MDR family.	97.57
PRK07679		279	pyrroline-5-carboxylate reductase; Reviewed	97.57
cd08286		345	FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik	97.56
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	97.56
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	97.55
PRK05479		330	ketol-acid reductoisomerase; Provisional	97.55
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	97.55
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	97.55
COG0281		432	SfcA Malic enzyme [Energy production and conversio	97.54
PRK06932		314	glycerate dehydrogenase; Provisional	97.53
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	97.53
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	97.53
cd05281		341	TDH Threonine dehydrogenase. L-threonine dehydroge	97.52
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	97.52
PRK14189		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.52
PF03435		386	Saccharop_dh: Saccharopine dehydrogenase ; InterPr	97.52
KOG3007		333	consensus Mu-crystallin [Amino acid transport and	97.52
PF07991		165	IlvN: Acetohydroxy acid isomeroreductase, catalyti	97.51
TIGR00873		467	gnd 6-phosphogluconate dehydrogenase, decarboxylat	97.51
COG1052		324	LdhA Lactate dehydrogenase and related dehydrogena	97.51
PLN03154		348	putative allyl alcohol dehydrogenase; Provisional	97.5
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	97.5
TIGR01915		219	npdG NADPH-dependent F420 reductase. This model re	97.49
cd08250		329	Mgc45594_like Mgc45594 gene product and other MDR	97.49
COG0111		324	SerA Phosphoglycerate dehydrogenase and related de	97.48
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	97.47
PRK10792		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.47
cd05278		347	FDH_like Formaldehyde dehydrogenases. Formaldehyde	97.44
PRK13771		334	putative alcohol dehydrogenase; Provisional	97.43
cd08290		341	ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi	97.42
KOG0069		336	consensus Glyoxylate/hydroxypyruvate reductase (D-	97.42
cd05312		279	NAD_bind_1_malic_enz NAD(P) binding domain of mali	97.42
PRK13302		271	putative L-aspartate dehydrogenase; Provisional	97.42
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	97.42
PRK11880		267	pyrroline-5-carboxylate reductase; Reviewed	97.41
PF02882		160	THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl	97.4
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	97.4
TIGR01692		288	HIBADH 3-hydroxyisobutyrate dehydrogenase. This en	97.4
PRK06487		317	glycerate dehydrogenase; Provisional	97.4
PRK08605		332	D-lactate dehydrogenase; Validated	97.39
cd08294		329	leukotriene_B4_DH_like 13-PGR is a bifunctional en	97.38
PRK14179		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.38
PRK14176		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.38
PRK08655		437	prephenate dehydrogenase; Provisional	97.37
TIGR02825		325	B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15	97.37
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	97.37
PLN02306		386	hydroxypyruvate reductase	97.37
PRK06719		157	precorrin-2 dehydrogenase; Validated	97.37
PLN02688		266	pyrroline-5-carboxylate reductase	97.36
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	97.35
PRK08762		376	molybdopterin biosynthesis protein MoeB; Validated	97.35
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	97.34
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	97.34
PRK15409		323	bifunctional glyoxylate/hydroxypyruvate reductase	97.33
PRK14191		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.33
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	97.32
TIGR01327		525	PGDH D-3-phosphoglycerate dehydrogenase. This mode	97.32
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	97.31
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	97.3
cd08259		332	Zn_ADH5 Alcohol dehydrogenases of the MDR family.	97.3
cd00762		254	NAD_bind_malic_enz NAD(P) binding domain of malic	97.3
PRK07417		279	arogenate dehydrogenase; Reviewed	97.29
PLN02819		1042	lysine-ketoglutarate reductase/saccharopine dehydr	97.28
TIGR01751		398	crot-CoA-red crotonyl-CoA reductase. The enzyme mo	97.28
PF03949		255	Malic_M: Malic enzyme, NAD binding domain; InterPr	97.28
TIGR02817		336	adh_fam_1 zinc-binding alcohol dehydrogenase famil	97.27
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	97.27
PRK13304		265	L-aspartate dehydrogenase; Reviewed	97.27
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	97.27
cd08295		338	double_bond_reductase_like Arabidopsis alkenal dou	97.27
PRK11790		409	D-3-phosphoglycerate dehydrogenase; Provisional	97.27
cd05282		323	ETR_like 2-enoyl thioester reductase-like. 2-enoyl	97.26
PRK13581		526	D-3-phosphoglycerate dehydrogenase; Provisional	97.26
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	97.25
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	97.25
cd08244		324	MDR_enoyl_red Possible enoyl reductase. Member ide	97.25
cd08274		350	MDR9 Medium chain dehydrogenases/reductase (MDR)/z	97.23
PRK14193		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.22
PF00107		130	ADH_zinc_N: Zinc-binding dehydrogenase; InterPro:	97.22
PF00056		141	Ldh_1_N: lactate/malate dehydrogenase, NAD binding	97.22
PRK14178		279	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.22
PRK15059		292	tartronate semialdehyde reductase; Provisional	97.22
PRK14190		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.22
PRK12861		764	malic enzyme; Reviewed	97.21
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	97.21
PRK14180		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.2
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	97.2
cd05276		323	p53_inducible_oxidoreductase PIG3 p53-inducible qu	97.19
PRK05597		355	molybdopterin biosynthesis protein MoeB; Validated	97.19
cd08289		326	MDR_yhfp_like Yhfp putative quinone oxidoreductase	97.19
PLN02858		1378	fructose-bisphosphate aldolase	97.18
cd08297		341	CAD3 Cinnamyl alcohol dehydrogenases (CAD). These	97.18
cd08263		367	Zn_ADH10 Alcohol dehydrogenases of the MDR family.	97.17
cd00757		228	ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1	97.17
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	97.15
cd08249		339	enoyl_reductase_like enoyl_reductase_like. Member	97.15
TIGR00465		314	ilvC ketol-acid reductoisomerase. This is the seco	97.14
cd05286		320	QOR2 Quinone oxidoreductase (QOR). Quinone oxidore	97.13
PRK07232		752	bifunctional malic enzyme oxidoreductase/phosphotr	97.12
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	97.12
cd08279		363	Zn_ADH_class_III Class III alcohol dehydrogenase.	97.11
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	97.11
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	97.1
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	97.1
COG0300		265	DltE Short-chain dehydrogenases of various substra	97.09
PRK12862		763	malic enzyme; Reviewed	97.08
smart00829		288	PKS_ER Enoylreductase. Enoylreductase in Polyketid	97.07
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	97.07
cd08266		342	Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam	97.06
PRK08223		287	hypothetical protein; Validated	97.06
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	97.06
PRK14183		281	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.05
COG0569		225	TrkA K+ transport systems, NAD-binding component [	97.05
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	97.04
PRK06545		359	prephenate dehydrogenase; Validated	97.04
PLN02545		295	3-hydroxybutyryl-CoA dehydrogenase	97.04
PRK14619		308	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	97.02
PRK08507		275	prephenate dehydrogenase; Validated	97.02
cd05195		293	enoyl_red enoyl reductase of polyketide synthase.	97.02
PRK10754		327	quinone oxidoreductase, NADPH-dependent; Provision	97.0
PRK14169		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.0
PRK15116		268	sulfur acceptor protein CsdL; Provisional	97.0
PRK14173		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.0
PRK14177		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.99
PLN03209		576	translocon at the inner envelope of chloroplast su	96.98
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.98
PRK14172		278	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.96
PRK14170		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.95
PTZ00082		321	L-lactate dehydrogenase; Provisional	96.95
cd08243		320	quinone_oxidoreductase_like_1 Quinone oxidoreducta	96.95
cd05280		325	MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone	96.94
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	96.92
PRK14166		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.92
cd00755		231	YgdL_like Family of activating enzymes (E1) of ubi	96.91
PTZ00354		334	alcohol dehydrogenase; Provisional	96.91
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	96.91
PRK08268		507	3-hydroxy-acyl-CoA dehydrogenase; Validated	96.89
cd08248		350	RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu	96.89
cd08252		336	AL_MDR Arginate lyase and other MDR family members	96.89
TIGR02279		503	PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa	96.88
cd01076		227	NAD_bind_1_Glu_DH NAD(P) binding domain of glutama	96.88
PLN02256		304	arogenate dehydrogenase	96.88
PRK11199		374	tyrA bifunctional chorismate mutase/prephenate deh	96.88
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	96.84
PLN02516		299	methylenetetrahydrofolate dehydrogenase (NADP+)	96.84
cd08276		336	MDR7 Medium chain dehydrogenases/reductase (MDR)/z	96.84
PRK14187		294	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.84
COG2910		211	Putative NADH-flavin reductase [General function p	96.83
cd08241		323	QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t	96.83
cd01492		197	Aos1_SUMO Ubiquitin activating enzyme (E1) subunit	96.82
cd08267		319	MDR1 Medium chain dehydrogenases/reductase (MDR)/z	96.81
PLN02858		1378	fructose-bisphosphate aldolase	96.81
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.79
PRK06928		277	pyrroline-5-carboxylate reductase; Reviewed	96.78
PTZ00117		319	malate dehydrogenase; Provisional	96.78
cd01485		198	E1-1_like Ubiquitin activating enzyme (E1), repeat	96.78
PLN03129		581	NADP-dependent malic enzyme; Provisional	96.77
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	96.77
COG1712		255	Predicted dinucleotide-utilizing enzyme [General f	96.77
PRK08328		231	hypothetical protein; Provisional	96.76
PRK14171		288	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.76
PRK14186		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.76
PRK05866		293	short chain dehydrogenase; Provisional	96.74
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	96.73
PRK13529		563	malate dehydrogenase; Provisional	96.73
PRK07411		390	hypothetical protein; Validated	96.72
PRK06057		255	short chain dehydrogenase; Provisional	96.71
cd08253		325	zeta_crystallin Zeta-crystallin with NADP-dependen	96.71
KOG1197		336	consensus Predicted quinone oxidoreductase [Energy	96.7
PRK06223		307	malate dehydrogenase; Reviewed	96.69
cd08273		331	MDR8 Medium chain dehydrogenases/reductase (MDR)/z	96.69
PRK05872		296	short chain dehydrogenase; Provisional	96.69
PRK07825		273	short chain dehydrogenase; Provisional	96.68
PLN02897		345	tetrahydrofolate dehydrogenase/cyclohydrolase, put	96.68
PRK14182		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.68
TIGR01381		664	E1_like_apg7 E1-like protein-activating enzyme Gsa	96.67
PRK14181		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.67
COG4221		246	Short-chain alcohol dehydrogenase of unknown speci	96.67
PLN02616		364	tetrahydrofolate dehydrogenase/cyclohydrolase, put	96.65
PRK14806		735	bifunctional cyclohexadienyl dehydrogenase/ 3-phos	96.65
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	96.65
PRK07878		392	molybdopterin biosynthesis-like protein MoeZ; Vali	96.63
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.63
PRK14168		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.63
COG0287		279	TyrA Prephenate dehydrogenase [Amino acid transpor	96.62
cd01486		307	Apg7 Apg7 is an E1-like protein, that activates tw	96.61
cd05211		217	NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of	96.61
PRK07326		237	short chain dehydrogenase; Provisional	96.6
cd05288		329	PGDH Prostaglandin dehydrogenases. Prostaglandins	96.6
PRK12829		264	short chain dehydrogenase; Provisional	96.6
PLN02712		667	arogenate dehydrogenase	96.59
PRK14185		293	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.57
PRK07060		245	short chain dehydrogenase; Provisional	96.56
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.56
TIGR03325		262	BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro	96.55
PRK06196		315	oxidoreductase; Provisional	96.55
cd05292		308	LDH_2 A subgroup of L-lactate dehydrogenases. L-la	96.54
PRK14174		295	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.54
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	96.54
PRK06139		330	short chain dehydrogenase; Provisional	96.53
PRK07523		255	gluconate 5-dehydrogenase; Provisional	96.53
PRK08265		261	short chain dehydrogenase; Provisional	96.52
PRK14184		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.52
PRK14167		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.52
PRK06500		249	short chain dehydrogenase; Provisional	96.52
TIGR02823		323	oxido_YhdH putative quinone oxidoreductase, YhdH/Y	96.49
cd05289		309	MDR_like_2 alcohol dehydrogenase and quinone reduc	96.48
TIGR02824		325	quinone_pig3 putative NAD(P)H quinone oxidoreducta	96.48
PRK05717		255	oxidoreductase; Validated	96.46
PRK06200		263	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog	96.46
PRK08339		263	short chain dehydrogenase; Provisional	96.45
PRK06138		252	short chain dehydrogenase; Provisional	96.45
cd08251		303	polyketide_synthase polyketide synthase. Polyketid	96.44
PTZ00317		559	NADP-dependent malic enzyme; Provisional	96.44
cd01491		286	Ube1_repeat1 Ubiquitin activating enzyme (E1), rep	96.43
PRK06153		393	hypothetical protein; Provisional	96.43
PRK07063		260	short chain dehydrogenase; Provisional	96.43
cd08268		328	MDR2 Medium chain dehydrogenases/reductase (MDR)/z	96.43
PRK12828		239	short chain dehydrogenase; Provisional	96.4
cd00300		300	LDH_like L-lactate dehydrogenase-like enzymes. Mem	96.39
PRK05867		253	short chain dehydrogenase; Provisional	96.37
KOG2017		427	consensus Molybdopterin synthase sulfurylase [Coen	96.37
PRK09496		453	trkA potassium transporter peripheral membrane com	96.36
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.35
COG0190		283	FolD 5,10-methylene-tetrahydrofolate dehydrogenase	96.35
PRK08267		260	short chain dehydrogenase; Provisional	96.35
cd01484		234	E1-2_like Ubiquitin activating enzyme (E1), repeat	96.35
cd05293		312	LDH_1 A subgroup of L-lactate dehydrogenases. L-la	96.34
PRK06949		258	short chain dehydrogenase; Provisional	96.34
PRK06194		287	hypothetical protein; Provisional	96.33
PRK12939		250	short chain dehydrogenase; Provisional	96.33
TIGR01546		333	GAPDH-II_archae glyceraldehyde-3-phosphate dehydro	96.33
COG0059		338	IlvC Ketol-acid reductoisomerase [Amino acid trans	96.33
PRK08085		254	gluconate 5-dehydrogenase; Provisional	96.32
PRK12439		341	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	96.31
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	96.31
PLN02712		667	arogenate dehydrogenase	96.3
COG0240		329	GpsA Glycerol-3-phosphate dehydrogenase [Energy pr	96.3
cd05290		307	LDH_3 A subgroup of L-lactate dehydrogenases. L-la	96.29
cd00650		263	LDH_MDH_like NAD-dependent, lactate dehydrogenase-	96.29
PRK05562		223	precorrin-2 dehydrogenase; Provisional	96.28
PRK06182		273	short chain dehydrogenase; Validated	96.27
PRK07890		258	short chain dehydrogenase; Provisional	96.26
CHL00194		317	ycf39 Ycf39; Provisional	96.26
PRK08277		278	D-mannonate oxidoreductase; Provisional	96.26
PRK13394		262	3-hydroxybutyrate dehydrogenase; Provisional	96.25
PRK07814		263	short chain dehydrogenase; Provisional	96.25
PRK07067		257	sorbitol dehydrogenase; Provisional	96.24
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	96.24
PF00106		167	adh_short: short chain dehydrogenase alcohol dehyd	96.22
PTZ00431		260	pyrroline carboxylate reductase; Provisional	96.22
PLN02253		280	xanthoxin dehydrogenase	96.22
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	96.21
cd01339		300	LDH-like_MDH L-lactate dehydrogenase-like malate d	96.21
cd01488		291	Uba3_RUB Ubiquitin activating enzyme (E1) subunit	96.21
PRK07666		239	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.19
PF01113		124	DapB_N: Dihydrodipicolinate reductase, N-terminus;	96.19
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	96.18
PRK02472		447	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.18
PRK06172		253	short chain dehydrogenase; Provisional	96.16
PRK11730		715	fadB multifunctional fatty acid oxidation complex	96.16
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	96.15
PLN00141		251	Tic62-NAD(P)-related group II protein; Provisional	96.15
COG1648		210	CysG Siroheme synthase (precorrin-2 oxidase/ferroc	96.15
PRK06180		277	short chain dehydrogenase; Provisional	96.14
TIGR03589		324	PseB UDP-N-acetylglucosamine 4,6-dehydratase. This	96.13
PRK07478		254	short chain dehydrogenase; Provisional	96.13
PRK09186		256	flagellin modification protein A; Provisional	96.13
PRK09496		453	trkA potassium transporter peripheral membrane com	96.13
PRK09291		257	short chain dehydrogenase; Provisional	96.12
PRK07576		264	short chain dehydrogenase; Provisional	96.11
PRK14851		679	hypothetical protein; Provisional	96.11
COG0673		342	MviM Predicted dehydrogenases and related proteins	96.1
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	96.1
PRK05876		275	short chain dehydrogenase; Provisional	96.1
PRK08217		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.08
PRK07074		257	short chain dehydrogenase; Provisional	96.08
PRK12742		237	oxidoreductase; Provisional	96.08
PRK07062		265	short chain dehydrogenase; Provisional	96.06
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	96.06
PRK07774		250	short chain dehydrogenase; Provisional	96.04
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	96.03
PRK10538		248	malonic semialdehyde reductase; Provisional	96.03
PRK05653		246	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.02
PRK05225		487	ketol-acid reductoisomerase; Validated	96.02
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	96.0
PRK07109		334	short chain dehydrogenase; Provisional	95.98
PRK09242		257	tropinone reductase; Provisional	95.98
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	95.97
PRK08213		259	gluconate 5-dehydrogenase; Provisional	95.96
PRK12936		245	3-ketoacyl-(acyl-carrier-protein) reductase NodG;	95.96
PLN02602		350	lactate dehydrogenase	95.96
PRK14852		989	hypothetical protein; Provisional	95.95
PRK08264		238	short chain dehydrogenase; Validated	95.95
PRK05875		276	short chain dehydrogenase; Provisional	95.95
PRK06124		256	gluconate 5-dehydrogenase; Provisional	95.95
cd05297		423	GH4_alpha_glucosidase_galactosidase Glycoside Hydr	95.94
PRK07024		257	short chain dehydrogenase; Provisional	95.93
PRK05854		313	short chain dehydrogenase; Provisional	95.93
PRK07453		322	protochlorophyllide oxidoreductase; Validated	95.9
PRK04207		341	glyceraldehyde-3-phosphate dehydrogenase; Provisio	95.9
KOG2380		480	consensus Prephenate dehydrogenase (NADP+) [Amino	95.9
cd01489		312	Uba2_SUMO Ubiquitin activating enzyme (E1) subunit	95.9
PRK06125		259	short chain dehydrogenase; Provisional	95.89
PRK08945		247	putative oxoacyl-(acyl carrier protein) reductase;	95.89
PF05368		233	NmrA: NmrA-like family; InterPro: IPR008030 NmrA i	95.88
PRK08589		272	short chain dehydrogenase; Validated	95.88
PRK05565		247	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.88
cd08272		326	MDR6 Medium chain dehydrogenases/reductase (MDR)/z	95.87
PRK06197		306	short chain dehydrogenase; Provisional	95.86
PRK07424		406	bifunctional sterol desaturase/short chain dehydro	95.86
PTZ00345		365	glycerol-3-phosphate dehydrogenase; Provisional	95.85
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	95.85
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	95.84
TIGR03376		342	glycerol3P_DH glycerol-3-phosphate dehydrogenase (	95.84
PRK09072		263	short chain dehydrogenase; Provisional	95.82
PRK06841		255	short chain dehydrogenase; Provisional	95.8
PRK07454		241	short chain dehydrogenase; Provisional	95.79
COG1250		307	FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo	95.79
PF01118		121	Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi	95.78
PRK05993		277	short chain dehydrogenase; Provisional	95.78
TIGR03206		250	benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr	95.76
PRK06198		260	short chain dehydrogenase; Provisional	95.74
PRK00048		257	dihydrodipicolinate reductase; Provisional	95.74
PRK08263		275	short chain dehydrogenase; Provisional	95.71
PRK07677		252	short chain dehydrogenase; Provisional	95.7
PRK12367		245	short chain dehydrogenase; Provisional	95.69
PRK08324		681	short chain dehydrogenase; Validated	95.69
PRK08643		256	acetoin reductase; Validated	95.68
PRK06505		271	enoyl-(acyl carrier protein) reductase; Provisiona	95.67
PRK13301		267	putative L-aspartate dehydrogenase; Provisional	95.67
cd08271		325	MDR5 Medium chain dehydrogenases/reductase (MDR)/z	95.67
COG4091		438	Predicted homoserine dehydrogenase [Amino acid tra	95.67
PRK06935		258	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	95.67
PRK08628		258	short chain dehydrogenase; Provisional	95.66

>PLN00203 glutamyl-tRNA reductase	Back alignment and domain information

Probab=100.00  E-value=8.3e-102  Score=833.87  Aligned_cols=457  Identities=85%  Similarity=1.244  Sum_probs=422.4

Q ss_pred             CCchHHHHHhhhcCCcccccCcceEEEEEeecCCCCHHHHhhhcCCCCChHHHHHHHhccCCCcceEEeeecCeeEEEEE
Q 010322           41 PSSASALEQLKASAPDRYTKERSSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVV  120 (513)
Q Consensus        41 ~~~~~~~~~~~~~~~~~~~~~~~~i~~igi~hk~apv~~RE~~a~~~~~~~~~l~~l~~~~~i~e~viLsTCNR~EiY~~  120 (513)
                      .++.+||+|||++++||||+|+|+|+++|+||||||+++||||+|++++++.++.+|+..+++.|++|||||||||||++
T Consensus        61 ~~~~~~~~~~~~~~~~~~~~~~~~i~~ig~shktapveiREkla~~~~~~~~~l~~l~~~~~i~e~viLSTCNR~EiY~~  140 (519)
T PLN00203         61 AASASALEQLKNSAADRYTKEKSSIVVIGLSIHTAPVEMREKLAIPEAEWPRAIAELCSLNHIEEAAVLSTCNRMEIYVV  140 (519)
T ss_pred             cchHHHHHHHHHhhhhhHHHhcCeEEEEEEeCCcCCHHHHHHhcCCHHHHHHHHHHHHhcCCcceEEEEeccCeEEEEEE
Confidence            38999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccccccHHHHHHHHHHhcCCChhhhhhHHHHhcCCceeeeeeeeccCCCCcccCcchhhchHHHHHHHhHhcCcccchh
Q 010322          121 ALSQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFGRNI  200 (513)
Q Consensus       121 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~G~eav~hlf~V~sGldS~vvGE~qIlgQvk~A~~~a~~~~~~g~~L  200 (513)
                      +++.+.+.+.+.+||++++|++.+++.+++|.+.|.||+.|||+|+|||||||+||+||+||||+||..|++.|++|+.|
T Consensus       141 ~~~~~~~~~~v~~~l~~~~~~~~~~l~~~~~~~~g~~Av~HLfrVasGLDSmVlGE~QIlgQVK~A~~~A~~~g~~g~~L  220 (519)
T PLN00203        141 ALSWHRGVKEVTEWMSKTSGIPVSELRQHLFLLYDKDATQHLFEVSGGLDSLVLGEGQILAQVKQVVKVGQGVDGFGRNL  220 (519)
T ss_pred             ecCcchhHHHHHHHHHHhcCCCHHHHhhhheeecCHHHHHHHHHHHhhhhhhhhCChHHHHHHHHHHHHHHHcCCccHHH
Confidence            87666677889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHhhCccccccccccCCCchHHHHHHHHHHhhCCCCCCCCCeEEEEcccHHHHHHHHHHHHcCCCeEEEEeCCH
Q 010322          201 SGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSE  280 (513)
Q Consensus       201 ~~lf~~ai~v~k~Vr~et~i~~~~~Sva~~Av~la~~~~~~~~l~g~~VlVIGaG~mG~~ia~~L~~~G~~~V~v~nRs~  280 (513)
                      +++|+.|++++|+||++|+|+.+++|++++||+++++.|+.+++.+++|+|||+|.||++++++|...|+.+|+++||+.
T Consensus       221 ~~LF~~Ai~~~KrVRteT~I~~~~vSv~s~Av~la~~~~~~~~l~~kkVlVIGAG~mG~~~a~~L~~~G~~~V~V~nRs~  300 (519)
T PLN00203        221 SGLFKHAITAGKRVRTETNIASGAVSVSSAAVELALMKLPESSHASARVLVIGAGKMGKLLVKHLVSKGCTKMVVVNRSE  300 (519)
T ss_pred             HHHHHHHHHHHHHHhhccCCCCCCcCHHHHHHHHHHHhcCCCCCCCCEEEEEeCHHHHHHHHHHHHhCCCCeEEEEeCCH
Confidence            99999999999999999999999999999999999998852248899999999999999999999999998899999999


Q ss_pred             HHHHHHHHHhCCcceeecccchHHhhcCCCcEEEEcCCCCccCCChhhhhcCCchhhhcCCcEEEEeccCCCCCCccccc
Q 010322          281 ERVAAICEELNGVEIIYKPLSEMLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVAD  360 (513)
Q Consensus       281 ~ra~~la~~~g~~~~~~~~~~~~~~~l~~aDVVI~AT~s~~~vi~~~~l~~~~~~~~~~~g~~viiDlavPrdidp~v~~  360 (513)
                      ++++.++..+++..+.+.+++++.+.+.++|+||+||++++|+++.++++.+++.+.+.++++++||+++||||+|.+.+
T Consensus       301 era~~La~~~~g~~i~~~~~~dl~~al~~aDVVIsAT~s~~pvI~~e~l~~~~~~~~~~~~~~~~IDLAvPRdIdp~v~~  380 (519)
T PLN00203        301 ERVAALREEFPDVEIIYKPLDEMLACAAEADVVFTSTSSETPLFLKEHVEALPPASDTVGGKRLFVDISVPRNVGACVSE  380 (519)
T ss_pred             HHHHHHHHHhCCCceEeecHhhHHHHHhcCCEEEEccCCCCCeeCHHHHHHhhhcccccCCCeEEEEeCCCCCCcccccc
Confidence            99999999886433345567777788899999999999999999999998764322222467899999999999999999


Q ss_pred             ccCeEEEccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC
Q 010322          361 VETARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELDKCLSKMGDDI  440 (513)
Q Consensus       361 l~gv~ly~iDdl~~v~~~~~~~R~~~~~~ae~iI~e~~~~f~~w~~~~~~~p~I~~lr~~~e~i~~~el~~~~~kl~~~~  440 (513)
                      ++|+++||+|||+.+++.|.+.|..++..|+.||++++.+|..|++.+.+.|+|++||+++++|++.||+|+++||++++
T Consensus       381 l~~v~lydiDdL~~i~~~n~~~R~~~~~~Ae~II~ee~~~F~~w~~~~~~~p~I~~lr~~~~~i~~~Eler~~~kl~~~~  460 (519)
T PLN00203        381 LESARVYNVDDLKEVVAANKEDRLRKAMEAQTIIREESKNFEAWRDSLETVPTIKKLRSYAERIRAAELEKCLSKMGDDL  460 (519)
T ss_pred             CCCCeEEEeccHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHhccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999997668


Q ss_pred             ChHHHHHHHHHHHHHHHHHhhhHHHHHhhcCCCCCchhhhHHHHHHHHHHhCCCCCc
Q 010322          441 SKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTLDETLENMHALNRMFGLETDT  497 (513)
Q Consensus       441 ~~~~~~~i~~~~~~~~~k~lh~P~~~lk~~~~~~~~~~~~~~~~~~~~~lf~l~~~~  497 (513)
                      ++++++.|++++++++|||||.|+.+||+.+.++...++.+.+++++++||+|+.++
T Consensus       461 ~~~~~~~ie~~~~~ivnkllh~P~~~Lr~~a~~~~~~~~~~~~~~~l~~lF~l~~~~  517 (519)
T PLN00203        461 TKKQRKAVEDLSRGIVNKLLHGPMQHLRCDGSDSRTVSETLENMHALNRMFDLETEI  517 (519)
T ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccCcccHHHHHHHHHHHhCCCccc
Confidence            999999999999999999999999999985532222234467999999999998774

>PRK13940 glutamyl-tRNA reductase; Provisional	Back alignment and domain information

>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	Back alignment and domain information

>TIGR01035 hemA glutamyl-tRNA reductase	Back alignment and domain information

>PRK00045 hemA glutamyl-tRNA reductase; Reviewed	Back alignment and domain information

>PRK00676 hemA glutamyl-tRNA reductase; Validated	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>PF05201 GlutR_N: Glutamyl-tRNAGlu reductase, N-terminal domain; InterPro: IPR015895 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway []	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>PRK14982 acyl-ACP reductase; Provisional	Back alignment and domain information

>PF00745 GlutR_dimer: Glutamyl-tRNAGlu reductase, dimerisation domain; InterPro: IPR015896 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway []	Back alignment and domain information

>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type	Back alignment and domain information

>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK12749 quinate/shikimate dehydrogenase; Reviewed	Back alignment and domain information

>PRK14027 quinate/shikimate dehydrogenase; Provisional	Back alignment and domain information

>PRK12548 shikimate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK12550 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00507 aroE shikimate 5-dehydrogenase	Back alignment and domain information

>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed	Back alignment and domain information

>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>TIGR02992 ectoine_eutC ectoine utilization protein EutC	Back alignment and domain information

>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK08291 ectoine utilization protein EutC; Validated	Back alignment and domain information

>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>PRK09880 L-idonate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK06141 ornithine cyclodeaminase; Validated	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PRK06407 ornithine cyclodeaminase; Provisional	Back alignment and domain information

>PRK07340 ornithine cyclodeaminase; Validated	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PRK08618 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK06823 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>cd08230 glucose_DH Glucose dehydrogenase	Back alignment and domain information

>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type	Back alignment and domain information

>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2	Back alignment and domain information

>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent	Back alignment and domain information

>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like	Back alignment and domain information

>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase	Back alignment and domain information

>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline []	Back alignment and domain information

>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]	Back alignment and domain information

>PRK07589 ornithine cyclodeaminase; Validated	Back alignment and domain information

>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase	Back alignment and domain information

>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02586 probable cinnamyl alcohol dehydrogenase	Back alignment and domain information

>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase	Back alignment and domain information

>PLN02178 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein	Back alignment and domain information

>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	Back alignment and domain information

>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase)	Back alignment and domain information

>PRK06046 alanine dehydrogenase; Validated	Back alignment and domain information

>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit	Back alignment and domain information

>COG5322 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PLN02740 Alcohol dehydrogenase-like	Back alignment and domain information

>PLN02827 Alcohol dehydrogenase-like	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase	Back alignment and domain information

>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases	Back alignment and domain information

>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase	Back alignment and domain information

>PRK06199 ornithine cyclodeaminase; Validated	Back alignment and domain information

>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase	Back alignment and domain information

>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02514 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>PRK10083 putative oxidoreductase; Provisional	Back alignment and domain information

>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase	Back alignment and domain information

>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3	Back alignment and domain information

>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional	Back alignment and domain information

>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>PLN02702 L-idonate 5-dehydrogenase	Back alignment and domain information

>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase	Back alignment and domain information

>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases	Back alignment and domain information

>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH)	Back alignment and domain information

>cd08293 PTGR2 Prostaglandin reductase	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]	Back alignment and domain information

>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases	Back alignment and domain information

>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members	Back alignment and domain information

>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]	Back alignment and domain information

>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins	Back alignment and domain information

>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PTZ00075 Adenosylhomocysteinase; Provisional	Back alignment and domain information

>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08232 idonate-5-DH L-idonate 5-dehydrogenase	Back alignment and domain information

>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>cd05285 sorbitol_DH Sorbitol dehydrogenase	Back alignment and domain information

>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1	Back alignment and domain information

>PRK05396 tdh L-threonine 3-dehydrogenase; Validated	Back alignment and domain information

>cd05284 arabinose_DH_like D-arabinose dehydrogenase	Back alignment and domain information

>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase	Back alignment and domain information

>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase	Back alignment and domain information

>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH)	Back alignment and domain information

>PLN02928 oxidoreductase family protein	Back alignment and domain information

>PRK13243 glyoxylate reductase; Reviewed	Back alignment and domain information

>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>PRK12491 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>cd08234 threonine_DH_like L-threonine dehydrogenase	Back alignment and domain information

>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2	Back alignment and domain information

>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02494 adenosylhomocysteinase	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1	Back alignment and domain information

>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases	Back alignment and domain information

>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional	Back alignment and domain information

>TIGR00692 tdh L-threonine 3-dehydrogenase	Back alignment and domain information

>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases	Back alignment and domain information

>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>cd08246 crotonyl_coA_red crotonyl-CoA reductase	Back alignment and domain information

>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>PRK07574 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>KOG0409 consensus Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PLN02350 phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PLN03139 formate dehydrogenase; Provisional	Back alignment and domain information

>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase	Back alignment and domain information

>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]	Back alignment and domain information

>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PRK12480 D-lactate dehydrogenase; Provisional	Back alignment and domain information

>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional	Back alignment and domain information

>PRK00257 erythronate-4-phosphate dehydrogenase; Validated	Back alignment and domain information

>PRK06476 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK13403 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional	Back alignment and domain information

>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2	Back alignment and domain information

>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members	Back alignment and domain information

>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase	Back alignment and domain information

>PRK08410 2-hydroxyacid dehydrogenase; Provisional	Back alignment and domain information

>PRK06436 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>PRK07680 late competence protein ComER; Validated	Back alignment and domain information

>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>PRK07634 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PRK07679 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK05479 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>COG0281 SfcA Malic enzyme [Energy production and conversion]	Back alignment and domain information

>PRK06932 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd05281 TDH Threonine dehydrogenase	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase	Back alignment and domain information

>KOG3007 consensus Mu-crystallin [Amino acid transport and metabolism]	Back alignment and domain information

>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates	Back alignment and domain information

>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating	Back alignment and domain information

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>PLN03154 putative allyl alcohol dehydrogenase; Provisional	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01915 npdG NADPH-dependent F420 reductase	Back alignment and domain information

>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members	Back alignment and domain information

>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd05278 FDH_like Formaldehyde dehydrogenases	Back alignment and domain information

>PRK13771 putative alcohol dehydrogenase; Provisional	Back alignment and domain information

>cd08290 ETR 2-enoyl thioester reductase (ETR)	Back alignment and domain information

>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion]	Back alignment and domain information

>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1	Back alignment and domain information

>PRK13302 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK11880 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF)	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase	Back alignment and domain information

>PRK06487 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK08605 D-lactate dehydrogenase; Validated	Back alignment and domain information

>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity	Back alignment and domain information

>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK08655 prephenate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>PLN02306 hydroxypyruvate reductase	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>PLN02688 pyrroline-5-carboxylate reductase	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>PRK08762 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional	Back alignment and domain information

>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase	Back alignment and domain information

>TIGR01751 crot-CoA-red crotonyl-CoA reductase	Back alignment and domain information

>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e	Back alignment and domain information

>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK13304 L-aspartate dehydrogenase; Reviewed	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase	Back alignment and domain information

>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>cd05282 ETR_like 2-enoyl thioester reductase-like	Back alignment and domain information

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd08244 MDR_enoyl_red Possible enoyl reductase	Back alignment and domain information

>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1	Back alignment and domain information

>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK15059 tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK12861 malic enzyme; Reviewed	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase	Back alignment and domain information

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>cd08249 enoyl_reductase_like enoyl_reductase_like	Back alignment and domain information

>TIGR00465 ilvC ketol-acid reductoisomerase	Back alignment and domain information

>cd05286 QOR2 Quinone oxidoreductase (QOR)	Back alignment and domain information

>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]	Back alignment and domain information

>PRK12862 malic enzyme; Reviewed	Back alignment and domain information

>smart00829 PKS_ER Enoylreductase	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PRK08223 hypothetical protein; Validated	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PRK06545 prephenate dehydrogenase; Validated	Back alignment and domain information

>PLN02545 3-hydroxybutyryl-CoA dehydrogenase	Back alignment and domain information

>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK08507 prephenate dehydrogenase; Validated	Back alignment and domain information

>cd05195 enoyl_red enoyl reductase of polyketide synthase	Back alignment and domain information

>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional	Back alignment and domain information

>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PTZ00082 L-lactate dehydrogenase; Provisional	Back alignment and domain information

>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR)	Back alignment and domain information

>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E	Back alignment and domain information

>PTZ00354 alcohol dehydrogenase; Provisional	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1	Back alignment and domain information

>cd08252 AL_MDR Arginate lyase and other MDR family members	Back alignment and domain information

>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC	Back alignment and domain information

>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+)	Back alignment and domain information

>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG2910 Putative NADH-flavin reductase [General function prediction only]	Back alignment and domain information

>cd08241 QOR1 Quinone oxidoreductase (QOR)	Back alignment and domain information

>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1	Back alignment and domain information

>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06928 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PTZ00117 malate dehydrogenase; Provisional	Back alignment and domain information

>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like	Back alignment and domain information

>PLN03129 NADP-dependent malic enzyme; Provisional	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK05866 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK13529 malate dehydrogenase; Provisional	Back alignment and domain information

>PRK07411 hypothetical protein; Validated	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR)	Back alignment and domain information

>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only]	Back alignment and domain information

>PRK06223 malate dehydrogenase; Reviewed	Back alignment and domain information

>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PRK05872 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07825 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative	Back alignment and domain information

>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p	Back alignment and domain information

>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]	Back alignment and domain information

>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative	Back alignment and domain information

>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively	Back alignment and domain information

>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd05288 PGDH Prostaglandin dehydrogenases	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	Back alignment and domain information

>PRK06196 oxidoreductase; Provisional	Back alignment and domain information

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK06139 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK06500 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family	Back alignment and domain information

>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases	Back alignment and domain information

>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family	Back alignment and domain information

>PRK05717 oxidoreductase; Validated	Back alignment and domain information

>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional	Back alignment and domain information

>PRK08339 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06138 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd08251 polyketide_synthase polyketide synthase	Back alignment and domain information

>PTZ00317 NADP-dependent malic enzyme; Provisional	Back alignment and domain information

>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1	Back alignment and domain information

>PRK06153 hypothetical protein; Provisional	Back alignment and domain information

>PRK07063 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd00300 LDH_like L-lactate dehydrogenase-like enzymes	Back alignment and domain information

>PRK05867 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism]	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like	Back alignment and domain information

>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II	Back alignment and domain information

>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK08085 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family	Back alignment and domain information

>PRK05562 precorrin-2 dehydrogenase; Provisional	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07890 short chain dehydrogenase; Provisional	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PRK08277 D-mannonate oxidoreductase; Provisional	Back alignment and domain information

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK07814 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07067 sorbitol dehydrogenase; Provisional	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases	Back alignment and domain information

>PTZ00431 pyrroline carboxylate reductase; Provisional	Back alignment and domain information

>PLN02253 xanthoxin dehydrogenase	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins	Back alignment and domain information

>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3	Back alignment and domain information

>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK06172 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>PLN00141 Tic62-NAD(P)-related group II protein; Provisional	Back alignment and domain information

>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]	Back alignment and domain information

>PRK06180 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase	Back alignment and domain information

>PRK07478 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09186 flagellin modification protein A; Provisional	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK09291 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07576 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14851 hypothetical protein; Provisional	Back alignment and domain information

>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12742 oxidoreductase; Provisional	Back alignment and domain information

>PRK07062 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>PRK10538 malonic semialdehyde reductase; Provisional	Back alignment and domain information

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK05225 ketol-acid reductoisomerase; Validated	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>PRK07109 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09242 tropinone reductase; Provisional	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed	Back alignment and domain information

>PLN02602 lactate dehydrogenase	Back alignment and domain information

>PRK14852 hypothetical protein; Provisional	Back alignment and domain information

>PRK08264 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK05875 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05854 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07453 protochlorophyllide oxidoreductase; Validated	Back alignment and domain information

>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism]	Back alignment and domain information

>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2	Back alignment and domain information

>PRK06125 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA	Back alignment and domain information

>PRK08589 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PRK06197 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated	Back alignment and domain information

>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+))	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07454 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]	Back alignment and domain information

>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate	Back alignment and domain information

>PRK05993 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase	Back alignment and domain information

>PRK06198 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK00048 dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>PRK08263 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07677 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12367 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08324 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK08643 acetoin reductase; Validated	Back alignment and domain information

>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK13301 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK08628 short chain dehydrogenase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		513
1gpj_A		404	Glutamyl-Trna Reductase From Methanopyrus Kandleri		4e-26

>pdb|1GPJ|A Chain A, Glutamyl-Trna Reductase From Methanopyrus Kandleri Length = 404

Back alignment and structure

Iteration: 1

Score = 116 bits (290), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 96/337 (28%), Positives = 159/337 (47%), Gaps = 36/337 (10%) Query: 65 IVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQ 124 +V +G++ A VE EK E R I E L+ + +L T NR+E+Y Sbjct: 4 LVSVGITHKEAEVEELEKARFESDEAVRDIVESFGLSG---SVLLQTSNRVEVYA----- 55 Query: 125 HRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAXXX 184 G ++ E + + + ++ +A +HLF V++GL+S+++GE +IL Sbjct: 56 -SGARDRAEELGDL-------IHDDAWVKRGSEAVRHLFRVASGLESMMVGEQEILRQVK 107 Query: 185 XXXXXXXXXXXFGRNISGLFKHAISVGKRVRTETNIXXXXXXXXXXXXELALMKLPESSH 244 + +F+ AI++GKR R ET I ELA +L Sbjct: 108 KAYDRAARLGTLDEALKIVFRRAINLGKRAREETRISEGAVSIGSAAVELAERELGSLHD 167 Query: 245 ATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSEML 304 T +LV+GAG+MGK V K LV +G ++V NR+ ER + +L G + + L + L Sbjct: 168 KT--VLVVGAGEMGKTVAKSLVDRGVRAVLVANRTYERAVELARDLGGEAVRFDELVDHL 225 Query: 305 SCAADADVVFTSTASEAPLFLKDHVQDL-------PPVEAAVGGLRLFIDISVPRNVGSC 357 A +DVV ++TA+ P+ D V++ P+ L IDI+ PR+V Sbjct: 226 ---ARSDVVVSATAAPHPVIHVDDVREALRKRDRRSPI--------LIIDIANPRDVEEG 274 Query: 358 VADVETARVYNVDDLKEVVAANKEDRLRKAMEAQAII 394 V ++E V +DDL+ + N E R ++ + + +I Sbjct: 275 VENIEDVEVRTIDDLRVIARENLERRRKEIPKVEKLI 311

PyMOL of 1gpj

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		513
1gpj_A		404	Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro	1e-168
3oj0_A		144	Glutr, glutamyl-tRNA reductase; structural genomic	4e-48
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
3d4o_A		293	Dipicolinate synthase subunit A; NP_243269.1, stru	1e-09
2i99_A		312	MU-crystallin homolog; thyroid hormine binding pro	1e-08
1omo_A		322	Alanine dehydrogenase; two-domain, beta-sandwich-d	1e-08
2egg_A		297	AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff	2e-07
3hdj_A		313	Probable ornithine cyclodeaminase; APC62486, borde	5e-06
2o7s_A		523	DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat	5e-06
1x7d_A		350	Ornithine cyclodeaminase; binds NAD+, binds L-orni	1e-05
2rir_A		300	Dipicolinate synthase, A chain; structural genomic	1e-05
1yqg_A		263	Pyrroline-5-carboxylate reductase; structural geno	2e-05
3d1l_A		266	Putative NADP oxidoreductase BF3122; structural ge	3e-05
3pwz_A		272	Shikimate dehydrogenase 3; alpha-beta, oxidoreduct	4e-05
3jyo_A		283	Quinate/shikimate dehydrogenase; enzyme-cofactor c	1e-04
3don_A		277	Shikimate dehydrogenase; alpha-beta structure, ros	1e-04
2axq_A		467	Saccharopine dehydrogenase; rossmann fold variant,	2e-04
1ff9_A		450	Saccharopine reductase; lysine biosynthesis, alpha	2e-04
3u62_A		253	Shikimate dehydrogenase; shikimate pathway, oxidor	2e-04
3ic5_A		118	Putative saccharopine dehydrogenase; structural ge	2e-04
3o8q_A		281	Shikimate 5-dehydrogenase I alpha; structural geno	2e-04
3tri_A		280	Pyrroline-5-carboxylate reductase; amino acid bios	2e-04
3fbt_A		282	Chorismate mutase and shikimate 5-dehydrogenase fu	3e-04
3gt0_A		247	Pyrroline-5-carboxylate reductase; structural geno	3e-04
2ahr_A		259	Putative pyrroline carboxylate reductase; pyrrolin	5e-04
1npy_A		271	Hypothetical shikimate 5-dehydrogenase-like protei	5e-04
4dll_A		320	2-hydroxy-3-oxopropionate reductase; structural ge	7e-04
3qsg_A		312	NAD-binding phosphogluconate dehydrogenase-like P;	9e-04

>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Length = 404	Back alignment and structure

 Score =  479 bits (1236), Expect = e-168
 Identities = 116/432 (26%), Positives = 202/432 (46%), Gaps = 30/432 (6%)

Query: 63  SSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVAL 122
             +V +G++   A VE  EK      E   A+ ++     +  + +L T NR+E+Y    
Sbjct: 2   EDLVSVGITHKEAEVEELEKARFESDE---AVRDIVESFGLSGSVLLQTSNRVEVYAS-- 56

Query: 123 SQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQ 182
               G ++  E +          + +  ++    +A +HLF V++GL+S+++GE +IL Q
Sbjct: 57  ----GARDRAEELGD-------LIHDDAWVKRGSEAVRHLFRVASGLESMMVGEQEILRQ 105

Query: 183 VKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIAAGAVSVSSAAVELALMKLPES 242
           VK+       +      +  +F+ AI++GKR R ET I+ GAVS+ SAAVELA  +L   
Sbjct: 106 VKKAYDRAARLGTLDEALKIVFRRAINLGKRAREETRISEGAVSIGSAAVELAERELGSL 165

Query: 243 SHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLSE 302
              T   LV+GAG+MGK V K LV +G   ++V NR+ ER   +  +L G  +      E
Sbjct: 166 HDKTV--LVVGAGEMGKTVAKSLVDRGVRAVLVANRTYERAVELARDLGGEAV---RFDE 220

Query: 303 MLSCAADADVVFTSTASEAPLFLKDHVQDLPPVEAAVGGLRLFIDISVPRNVGSCVADVE 362
           ++   A +DVV ++TA+  P+   D V++          + L IDI+ PR+V   V ++E
Sbjct: 221 LVDHLARSDVVVSATAAPHPVIHVDDVREALRKRDRRSPI-LIIDIANPRDVEEGVENIE 279

Query: 363 TARVYNVDDLKEVVAANKEDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAE 422
              V  +DDL+ +   N E R ++  + + +I EE        + L+    +  +     
Sbjct: 280 DVEVRTIDDLRVIARENLERRRKEIPKVEKLIEEELSTVEEELEKLKERRLVADVAKSLH 339

Query: 423 RIRVAELDKCLSKMGDDISKKTRRAVDDLSRGIMNKLLHGPMQHLRCDGSDSRTLDETLE 482
            I+  EL++ L ++     +     + D +     +L++     +     + R       
Sbjct: 340 EIKDRELERALRRLKTGDPEN---VLQDFAEAYTKRLINVLTSAIMELPDEYRR-----A 391

Query: 483 NMHALNRMFGLE 494
              AL R   L 
Sbjct: 392 ASRALRRASELN 403

PyMOL of 1gpj

>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Length = 144	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293	Back alignment and structure

>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Length = 312	Back alignment and structure

>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Length = 322	Back alignment and structure

>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Length = 297	Back alignment and structure

>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Length = 313	Back alignment and structure

>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Length = 523	Back alignment and structure

>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Length = 350	Back alignment and structure

>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300	Back alignment and structure

>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Length = 263	Back alignment and structure

>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Length = 266	Back alignment and structure

>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Length = 272	Back alignment and structure

>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Length = 283	Back alignment and structure

>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Length = 277	Back alignment and structure

>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Length = 467	Back alignment and structure

>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Length = 450	Back alignment and structure

>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Length = 253	Back alignment and structure

>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118	Back alignment and structure

>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Length = 281	Back alignment and structure

>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Length = 280	Back alignment and structure

>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Length = 282	Back alignment and structure

>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Length = 247	Back alignment and structure

>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Length = 259	Back alignment and structure

>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Length = 271	Back alignment and structure

>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320	Back alignment and structure

>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Length = 312	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		513
1gpj_A		404	Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro	100.0
3oj0_A		144	Glutr, glutamyl-tRNA reductase; structural genomic	99.8
2egg_A		297	AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff	99.76
3pwz_A		272	Shikimate dehydrogenase 3; alpha-beta, oxidoreduct	99.72
3fbt_A		282	Chorismate mutase and shikimate 5-dehydrogenase fu	99.69
3o8q_A		281	Shikimate 5-dehydrogenase I alpha; structural geno	99.69
3jyo_A		283	Quinate/shikimate dehydrogenase; enzyme-cofactor c	99.68
3t4e_A		312	Quinate/shikimate dehydrogenase; structural genomi	99.67
3don_A		277	Shikimate dehydrogenase; alpha-beta structure, ros	99.65
3tnl_A		315	Shikimate dehydrogenase; structural genomics, cent	99.65
1nyt_A		271	Shikimate 5-dehydrogenase; alpha/beta domains, WID	99.63
1npy_A		271	Hypothetical shikimate 5-dehydrogenase-like protei	99.62
3tum_A		269	Shikimate dehydrogenase family protein; rossmann-f	99.59
3phh_A		269	Shikimate dehydrogenase; shikimate pathway, helico	99.58
1p77_A		272	Shikimate 5-dehydrogenase; NADPH, oxidoreductase;	99.58
3u62_A		253	Shikimate dehydrogenase; shikimate pathway, oxidor	99.55
2hk9_A		275	Shikimate dehydrogenase; shikimate pathway, drug d	99.52
2d5c_A		263	AROE, shikimate 5-dehydrogenase; substrate, dimer,	99.49
1vl6_A		388	Malate oxidoreductase; TM0542, NAD-dependent malic	99.38
1nvt_A		287	Shikimate 5'-dehydrogenase; structural genomics, P	99.37
2o7s_A		523	DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat	99.31
1edz_A		320	5,10-methylenetetrahydrofolate dehydrogenase; nucl	99.3
4ej6_A		370	Putative zinc-binding dehydrogenase; structural ge	99.18
1pl8_A		356	Human sorbitol dehydrogenase; NAD, oxidoreductase;	99.15
4a2c_A		346	Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc	99.14
2d8a_A		348	PH0655, probable L-threonine 3-dehydrogenase; pyro	99.12
3m6i_A		363	L-arabinitol 4-dehydrogenase; medium chain dehydro	99.11
3d4o_A		293	Dipicolinate synthase subunit A; NP_243269.1, stru	99.1
1vj0_A		380	Alcohol dehydrogenase, zinc-containing; TM0436, st	99.07
1e3j_A		352	NADP(H)-dependent ketose reductase; oxidoreductase	99.06
3two_A		348	Mannitol dehydrogenase; cinnamyl-alcohol dehydroge	99.02
3fpc_A		352	NADP-dependent alcohol dehydrogenase; oxydoreducta	99.01
3jv7_A		345	ADH-A; dehydrogenase, nucleotide binding, rossmann	99.0
2dq4_A		343	L-threonine 3-dehydrogenase; NAD-dependent, oxidor	98.98
3s2e_A		340	Zinc-containing alcohol dehydrogenase superfamily;	98.96
1piw_A		360	Hypothetical zinc-type alcohol dehydrogenase- like	98.93
1rjw_A		339	ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD	98.92
1f8f_A		371	Benzyl alcohol dehydrogenase; rossmann fold, oxido	98.92
3uog_A		363	Alcohol dehydrogenase; structural genomics, protei	98.91
1uuf_A		369	YAHK, zinc-type alcohol dehydrogenase-like protein	98.91
3ip1_A		404	Alcohol dehydrogenase, zinc-containing; structural	98.9
2b5w_A		357	Glucose dehydrogenase; nucleotide binding motif, o	98.89
3p2y_A		381	Alanine dehydrogenase/pyridine nucleotide transhy;	98.89
1yqd_A		366	Sinapyl alcohol dehydrogenase; lignin, monolignol,	98.89
3uko_A		378	Alcohol dehydrogenase class-3; alcohol dehydrogena	98.89
1p0f_A		373	NADP-dependent alcohol dehydrogenase; ADH topology	98.88
2h6e_A		344	ADH-4, D-arabinose 1-dehydrogenase; rossman fold,	98.87
1leh_A		364	Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi	98.87
1kol_A		398	Formaldehyde dehydrogenase; oxidoreductase; HET: N	98.87
3hdj_A		313	Probable ornithine cyclodeaminase; APC62486, borde	98.86
2dph_A		398	Formaldehyde dismutase; dismutation of aldehydes,	98.86
1e3i_A		376	Alcohol dehydrogenase, class II; HET: NAD; 2.08A {	98.86
1h2b_A		359	Alcohol dehydrogenase; oxidoreductase, archaea, hy	98.86
2jhf_A		374	Alcohol dehydrogenase E chain; oxidoreductase, met	98.86
1cdo_A		374	Alcohol dehydrogenase; oxidoreductase, oxidoreduct	98.85
1omo_A		322	Alanine dehydrogenase; two-domain, beta-sandwich-d	98.85
1pjc_A		361	Protein (L-alanine dehydrogenase); oxidoreductase,	98.85
2fzw_A		373	Alcohol dehydrogenase class III CHI chain; S-nitro	98.84
2dvm_A		439	Malic enzyme, 439AA long hypothetical malate oxido	98.83
4eez_A		348	Alcohol dehydrogenase 1; site-saturation mutagenes	98.83
2rir_A		300	Dipicolinate synthase, A chain; structural genomic	98.83
2cf5_A		357	Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign	98.83
2cdc_A		366	Glucose dehydrogenase glucose 1-dehydrogenase, DHG	98.8
2hcy_A		347	Alcohol dehydrogenase 1; tetramer of asymmetric di	98.78
1jvb_A		347	NAD(H)-dependent alcohol dehydrogenase; archaeon,	98.77
2vhw_A		377	Alanine dehydrogenase; NAD, secreted, oxidoreducta	98.75
4dio_A		405	NAD(P) transhydrogenase subunit alpha PART 1; stru	98.72
2eez_A		369	Alanine dehydrogenase; TTHA0216, structural genomi	98.72
2c2x_A		281	Methylenetetrahydrofolate dehydrogenase- methenylt	98.71
3goh_A		315	Alcohol dehydrogenase, zinc-containing; NP_718042.	98.71
1x7d_A		350	Ornithine cyclodeaminase; binds NAD+, binds L-orni	98.71
2eih_A		343	Alcohol dehydrogenase; zinc ION binding protein, s	98.71
4eye_A		342	Probable oxidoreductase; structural genomics, niai	98.69
1l7d_A		384	Nicotinamide nucleotide transhydrogenase, subunit	98.69
2i99_A		312	MU-crystallin homolog; thyroid hormine binding pro	98.67
4dvj_A		363	Putative zinc-dependent alcohol dehydrogenase Pro;	98.67
3jyn_A		325	Quinone oxidoreductase; rossmann fold, protein-NAD	98.66
1wly_A		333	CAAR, 2-haloacrylate reductase; NADPH-dependent ox	98.62
3tqh_A		321	Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella	98.61
1x13_A		401	NAD(P) transhydrogenase subunit alpha; NAD(H)-bind	98.61
3pi7_A		349	NADH oxidoreductase; groes-like fold, NAD(P)-bindi	98.58
3gms_A		340	Putative NADPH:quinone reductase; structural genom	98.57
3fbg_A		346	Putative arginate lyase; structural genomics, unkn	98.56
1qor_A		327	Quinone oxidoreductase; HET: NAP; 2.20A {Escherich	98.55
4a0s_A		447	Octenoyl-COA reductase/carboxylase; oxidoreductase	98.55
2vn8_A		375	Reticulon-4-interacting protein 1; mitochondrion,	98.55
4dup_A		353	Quinone oxidoreductase; PSI-biology, structural ge	98.55
2j8z_A		354	Quinone oxidoreductase; medium-chain dehydrogenase	98.54
3qwb_A		334	Probable quinone oxidoreductase; rossmann fold, qu	98.52
1yb5_A		351	Quinone oxidoreductase; medium-chain dehydrogenase	98.51
2c0c_A		362	Zinc binding alcohol dehydrogenase, domain contain	98.5
3gvp_A		435	Adenosylhomocysteinase 3; protein CO-factor comple	98.49
1lu9_A		287	Methylene tetrahydromethanopterin dehydrogenase; a	98.49
3krt_A		456	Crotonyl COA reductase; structural genomics, prote	98.48
3l07_A		285	Bifunctional protein fold; structural genomics, ID	98.47
3iup_A		379	Putative NADPH:quinone oxidoreductase; YP_296108.1	98.45
2zb4_A		357	Prostaglandin reductase 2; rossmann fold, alternat	98.45
3gaz_A		343	Alcohol dehydrogenase superfamily protein; oxidore	98.42
1zsy_A		357	Mitochondrial 2-enoyl thioester reductase; medium-	98.41
3p2o_A		285	Bifunctional protein fold; structural genomics, ce	98.41
1gu7_A		364	Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s	98.4
3gqv_A		371	Enoyl reductase; medium-chain reductase (MDR super	98.39
1a4i_A		301	Methylenetetrahydrofolate dehydrogenase / methenyl	98.36
4b7c_A		336	Probable oxidoreductase; NADP cofactor, rossmann f	98.34
3ngx_A		276	Bifunctional protein fold; methylenetetrahydrofola	98.33
4a27_A		349	Synaptic vesicle membrane protein VAT-1 homolog-L;	98.32
4a26_A		300	Putative C-1-tetrahydrofolate synthase, cytoplasm;	98.32
1b0a_A		288	Protein (fold bifunctional protein); folate, dehyd	98.29
3ic5_A		118	Putative saccharopine dehydrogenase; structural ge	98.28
2j3h_A		345	NADP-dependent oxidoreductase P1; double bond redu	98.28
3n58_A		464	Adenosylhomocysteinase; ssgcid, hydrolase, structu	98.28
3h9u_A		436	Adenosylhomocysteinase; NAD CO-factor complex, str	98.23
4a5o_A		286	Bifunctional protein fold; oxidoreductase, hydrola	98.22
3obb_A		300	Probable 3-hydroxyisobutyrate dehydrogenase; struc	98.17
1xa0_A		328	Putative NADPH dependent oxidoreductases; structur	98.15
1tt7_A		330	YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st	98.13
1v3u_A		333	Leukotriene B4 12- hydroxydehydrogenase/prostaglan	98.13
3ce6_A		494	Adenosylhomocysteinase; protein-substrate complex,	98.13
2a9f_A		398	Putative malic enzyme ((S)-malate:NAD+ oxidoreduct	98.13
2z2v_A		365	Hypothetical protein PH1688; L-lysine dehydrogenas	98.11
3jtm_A		351	Formate dehydrogenase, mitochondrial; mitochondrio	98.11
3dtt_A		245	NADP oxidoreductase; structural genomics, joint ce	98.09
1iz0_A		302	Quinone oxidoreductase; APO-enzyme, riken structur	98.09
3nx4_A		324	Putative oxidoreductase; csgid, structural genomic	98.07
2j6i_A		364	Formate dehydrogenase; oxidoreductase, D-specific-	98.04
3g0o_A		303	3-hydroxyisobutyrate dehydrogenase; NAD(P), valine	98.03
2dbq_A		334	Glyoxylate reductase; D-3-phosphoglycerate dehydro	98.02
3d1l_A		266	Putative NADP oxidoreductase BF3122; structural ge	98.02
4e5n_A		330	Thermostable phosphite dehydrogenase; D-2-hydroxya	98.0
4huj_A		220	Uncharacterized protein; PSI-biology, nysgrc, stru	97.99
3d64_A		494	Adenosylhomocysteinase; structural genomics, ssgci	97.99
3doj_A		310	AT3G25530, dehydrogenase-like protein; gamma-hydro	97.99
4dll_A		320	2-hydroxy-3-oxopropionate reductase; structural ge	97.99
2g76_A		335	3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor	97.98
3gt0_A		247	Pyrroline-5-carboxylate reductase; structural geno	97.98
2h78_A		302	Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601	97.98
3pef_A		287	6-phosphogluconate dehydrogenase, NAD-binding; gam	97.97
1wwk_A		307	Phosphoglycerate dehydrogenase; riken structural g	97.97
3ond_A		488	Adenosylhomocysteinase; plant protein, enzyme-subs	97.97
2d0i_A		333	Dehydrogenase; structural genomics, NPPSFA, nation	97.97
1jw9_B		249	Molybdopterin biosynthesis MOEB protein; MOEB: mod	97.97
2nac_A		393	NAD-dependent formate dehydrogenase; oxidoreductas	97.97
3hg7_A		324	D-isomer specific 2-hydroxyacid dehydrogenase FAM	97.96
1v8b_A		479	Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2	97.95
2ekl_A		313	D-3-phosphoglycerate dehydrogenase; structural gen	97.95
3tri_A		280	Pyrroline-5-carboxylate reductase; amino acid bios	97.95
3pdu_A		287	3-hydroxyisobutyrate dehydrogenase family protein;	97.94
3evt_A		324	Phosphoglycerate dehydrogenase; structural genomic	97.94
1mx3_A		347	CTBP1, C-terminal binding protein 1; nuclear prote	97.93
3pp8_A		315	Glyoxylate/hydroxypyruvate reductase A; structural	97.92
1lss_A		140	TRK system potassium uptake protein TRKA homolog;	97.91
2w2k_A		348	D-mandelate dehydrogenase; 2-hydroxyacid dehydroge	97.91
1gdh_A		320	D-glycerate dehydrogenase; oxidoreductase(CHOH (D)	97.9
2pi1_A		334	D-lactate dehydrogenase; oxidoreductase, D-LDH, NA	97.9
2zyd_A		480	6-phosphogluconate dehydrogenase, decarboxylating;	97.89
3slk_A		795	Polyketide synthase extender module 2; rossmann fo	97.89
3gvx_A		290	Glycerate dehydrogenase related protein; NYSGXRC,	97.89
3gg9_A		352	D-3-phosphoglycerate dehydrogenase oxidoreductase;	97.89
4e21_A		358	6-phosphogluconate dehydrogenase (decarboxylating;	97.89
3l6d_A		306	Putative oxidoreductase; structural genomics, prot	97.88
4g2n_A		345	D-isomer specific 2-hydroxyacid dehydrogenase, Na;	97.88
2axq_A		467	Saccharopine dehydrogenase; rossmann fold variant,	97.88
2g1u_A		155	Hypothetical protein TM1088A; structural genomics,	97.88
2gcg_A		330	Glyoxylate reductase/hydroxypyruvate reductase; NA	97.87
3oet_A		381	Erythronate-4-phosphate dehydrogenase; structural	97.87
3c85_A		183	Putative glutathione-regulated potassium-efflux S	97.86
1yqg_A		263	Pyrroline-5-carboxylate reductase; structural geno	97.86
2cuk_A		311	Glycerate dehydrogenase/glyoxylate reductase; stru	97.85
3qsg_A		312	NAD-binding phosphogluconate dehydrogenase-like P;	97.85
4hy3_A		365	Phosphoglycerate oxidoreductase; PSI-biology, stru	97.84
2ahr_A		259	Putative pyrroline carboxylate reductase; pyrrolin	97.84
4dgs_A		340	Dehydrogenase; structural genomics, PSI-biology, N	97.84
3qha_A		296	Putative oxidoreductase; seattle structural genomi	97.81
4e12_A		283	Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1	97.8
2iz1_A		474	6-phosphogluconate dehydrogenase, decarboxylating;	97.78
2o4c_A		380	Erythronate-4-phosphate dehydrogenase; erythronate	97.78
4gwg_A		484	6-phosphogluconate dehydrogenase, decarboxylating;	97.77
2hmt_A		144	YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane	97.76
3dfz_A		223	SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase	97.76
1zej_A		293	HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural	97.75
1qp8_A		303	Formate dehydrogenase; oxidoreductase; HET: NDP; 2	97.75
2cvz_A		289	Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase;	97.74
2yq5_A		343	D-isomer specific 2-hydroxyacid dehydrogenase; oxi	97.74
3ba1_A		333	HPPR, hydroxyphenylpyruvate reductase; two domain	97.74
3ggo_A		314	Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b	97.74
2p4q_A		497	6-phosphogluconate dehydrogenase, decarboxylating;	97.73
1pgj_A		478	6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o	97.72
3llv_A		141	Exopolyphosphatase-related protein; NAD(P)-binding	97.72
2dpo_A		319	L-gulonate 3-dehydrogenase; structural genomics, N	97.71
2uyy_A		316	N-PAC protein; long-chain dehydrogenase, cytokine;	97.7
4gbj_A		297	6-phosphogluconate dehydrogenase NAD-binding; stru	97.7
2vns_A		215	Metalloreductase steap3; metal-binding, transmembr	97.7
1jay_A		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma	97.69
1ff9_A		450	Saccharopine reductase; lysine biosynthesis, alpha	97.69
1z82_A		335	Glycerol-3-phosphate dehydrogenase; TM0378, struct	97.67
4ezb_A		317	Uncharacterized conserved protein; structural geno	97.66
3l4b_C		218	TRKA K+ channel protien TM1088B; potassium channel	97.65
1j4a_A		333	D-LDH, D-lactate dehydrogenase; NAD-dependent dehy	97.64
2izz_A		322	Pyrroline-5-carboxylate reductase 1; amino-acid bi	97.64
2g5c_A		281	Prephenate dehydrogenase; TYRA, oxidoreductase; HE	97.62
3abi_A		365	Putative uncharacterized protein PH1688; L-lysine	97.61
1xdw_A		331	NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas	97.61
1zud_1		251	Adenylyltransferase THIF; thiamin, thiazole, prote	97.59
1ygy_A		529	PGDH, D-3-phosphoglycerate dehydrogenase; oxidored	97.59
1pqw_A		198	Polyketide synthase; rossmann fold, dimer, structu	97.59
2pgd_A		482	6-phosphogluconate dehydrogenase; oxidoreductase (	97.58
1f0y_A		302	HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive	97.58
3fwz_A		140	Inner membrane protein YBAL; TRKA-N domain, E.coli	97.58
1np3_A		338	Ketol-acid reductoisomerase; A DEEP figure-OF-eigh	97.58
3nv9_A		487	Malic enzyme; rossmann fold, oxidoreductase; 2.25A	97.57
2f1k_A		279	Prephenate dehydrogenase; tyrosine synthesis, X-RA	97.56
1hyh_A		309	L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2	97.56
1vpd_A		299	Tartronate semialdehyde reductase; structural geno	97.55
1id1_A		153	Putative potassium channel protein; RCK domain, E.	97.52
2gf2_A		296	Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct	97.52
3k5p_A		416	D-3-phosphoglycerate dehydrogenase; niaid, ssgcid,	97.51
3cky_A		301	2-hydroxymethyl glutarate dehydrogenase; rossmann	97.51
1dxy_A		333	D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc	97.51
1bg6_A		359	N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L	97.5
3c24_A		286	Putative oxidoreductase; YP_511008.1, structural g	97.48
3rui_A		340	Ubiquitin-like modifier-activating enzyme ATG7; au	97.47
2ew2_A		316	2-dehydropantoate 2-reductase, putative; alpha-str	97.46
3k96_A		356	Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA	97.46
3e8x_A		236	Putative NAD-dependent epimerase/dehydratase; stru	97.46
4ina_A		405	Saccharopine dehydrogenase; structural genomics, P	97.45
2qrj_A		394	Saccharopine dehydrogenase, NAD+, L-lysine- formin	97.45
3h8v_A		292	Ubiquitin-like modifier-activating enzyme 5; rossm	97.44
1yb4_A		295	Tartronic semialdehyde reductase; structural genom	97.44
3ktd_A		341	Prephenate dehydrogenase; structural genomics, joi	97.43
3b1f_A		290	Putative prephenate dehydrogenase; enzyme, 4-hydro	97.4
2ewd_A		317	Lactate dehydrogenase,; protein-substrate_cofactor	97.4
3gg2_A		450	Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd	97.38
1sc6_A		404	PGDH, D-3-phosphoglycerate dehydrogenase; alloster	97.37
1txg_A		335	Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid	97.37
1i36_A		264	Conserved hypothetical protein MTH1747; NADP bindi	97.37
1evy_A		366	Glycerol-3-phosphate dehydrogenase; rossmann fold,	97.31
3gvi_A		324	Malate dehydrogenase; NAD, oxidoreductase, tricarb	97.3
1mv8_A		436	GMD, GDP-mannose 6-dehydrogenase; rossman fold, do	97.29
3vku_A		326	L-LDH, L-lactate dehydrogenase; rossmann fold, NAD	97.28
3kb6_A		334	D-lactate dehydrogenase; oxidoreductase, D-LDH, NA	97.28
3fr7_A		525	Putative ketol-acid reductoisomerase (OS05G057370	97.27
4e6p_A		259	Probable sorbitol dehydrogenase (L-iditol 2-dehyd;	97.27
2glx_A		332	1,5-anhydro-D-fructose reductase; NADP(H) dependen	97.25
3rwb_A		247	TPLDH, pyridoxal 4-dehydrogenase; short chain dehy	97.25
1c1d_A		355	L-phenylalanine dehydrogenase; amino acid dehydrog	97.24
3euw_A		344	MYO-inositol dehydrogenase; protein structure init	97.24
3db2_A		354	Putative NADPH-dependent oxidoreductase; two domai	97.24
3mog_A		483	Probable 3-hydroxybutyryl-COA dehydrogenase; struc	97.24
1t2d_A		322	LDH-P, L-lactate dehydrogenase; ternary complex, o	97.23
2i76_A		276	Hypothetical protein; NADP, dehydrogenase, TM1727,	97.22
1hdc_A		254	3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi	97.21
3h5n_A		353	MCCB protein; ubiquitin-activating enzyme, microci	97.19
3pid_A		432	UDP-glucose 6-dehydrogenase; rossmann fold, oxidor	97.19
3n74_A		261	3-ketoacyl-(acyl-carrier-protein) reductase; seatt	97.19
4gsl_A		615	Ubiquitin-like modifier-activating enzyme ATG7; ub	97.19
1guz_A		310	Malate dehydrogenase; oxidoreductase, tricarboxyli	97.18
3uuw_A		308	Putative oxidoreductase with NAD(P)-binding rossm	97.18
4a7p_A		446	UDP-glucose dehydrogenase; oxidoreductase, carbohy	97.18
2gn4_A		344	FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann	97.17
4dqx_A		277	Probable oxidoreductase protein; structural genomi	97.17
3vh1_A		598	Ubiquitin-like modifier-activating enzyme ATG7; au	97.17
4hkt_A		331	Inositol 2-dehydrogenase; structural genomics, nys	97.17
2ho3_A		325	Oxidoreductase, GFO/IDH/MOCA family; streptococcus	97.17
3r6d_A		221	NAD-dependent epimerase/dehydratase; structural ge	97.16
3d3w_A		244	L-xylulose reductase; uronate cycle, short-chain d	97.16
3p7m_A		321	Malate dehydrogenase; putative dehydrogenase, enzy	97.15
2hjr_A		328	Malate dehydrogenase; malaria, structural genomics	97.15
4fgs_A		273	Probable dehydrogenase protein; PSI-biology, nysgr	97.15
2rcy_A		262	Pyrroline carboxylate reductase; malaria, structur	97.14
3pqe_A		326	L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas	97.14
2yjz_A		201	Metalloreductase steap4; oxidoreductase, metabolic	96.21
1ur5_A		309	Malate dehydrogenase; oxidoreductase, tricarboxyli	97.13
1pzg_A		331	LDH, lactate dehydrogenase; apicomplexa, APAD, tet	97.12
3grp_A		266	3-oxoacyl-(acyl carrierprotein) reductase; structu	97.12
3ew7_A		221	LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend	97.12
3op4_A		248	3-oxoacyl-[acyl-carrier protein] reductase; 3-keto	97.11
1nff_A		260	Putative oxidoreductase RV2002; directed evolution	97.11
1zcj_A		463	Peroxisomal bifunctional enzyme; peroxisomal multi	97.11
2o23_A		265	HADH2 protein; HSD17B10, schad, ERAB, type II HADH	97.1
3q2i_A		354	Dehydrogenase; rossmann fold, UDP-sugar binding, N	97.1
3ado_A		319	Lambda-crystallin; L-gulonate 3-dehydrogenase, str	97.1
1a5z_A		319	L-lactate dehydrogenase; oxidoreductase, glycolysi	97.1
3ai3_A		263	NADPH-sorbose reductase; rossmann-fold, NADPH-depe	97.1
3ak4_A		263	NADH-dependent quinuclidinone reductase; SDR, (R)-	97.09
1yj8_A		375	Glycerol-3-phosphate dehydrogenase; SGPP, structur	97.08
1xq6_A		253	Unknown protein; structural genomics, protein stru	97.08
4eso_A		255	Putative oxidoreductase; NADP, structural genomics	97.08
4dyv_A		272	Short-chain dehydrogenase/reductase SDR; structura	97.08
1vl8_A		267	Gluconate 5-dehydrogenase; TM0441, structural geno	97.07
3cea_A		346	MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore	97.07
2wsb_A		254	Galactitol dehydrogenase; oxidoreductase, SDR, ros	97.06
3k6j_A		460	Protein F01G10.3, confirmed by transcript evidenc;	97.05
2d4a_B		308	Malate dehydrogenase; archaea, hyperthermophIle, o	97.05
3ezy_A		344	Dehydrogenase; structural genomics, unknown functi	97.05
1oju_A		294	MDH, malate dehydrogenase; hyperthermophilic, oxid	97.04
1hxh_A		253	3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b	97.04
3rd5_A		291	Mypaa.01249.C; ssgcid, structural genomics, seattl	97.04
3imf_A		257	Short chain dehydrogenase; structural genomics, in	97.03
3gvc_A		277	Oxidoreductase, probable short-chain type dehydrog	97.03
1x0v_A		354	GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase	97.03
1yde_A		270	Retinal dehydrogenase/reductase 3; oxidoreductase,	97.03
1ldn_A		316	L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA	97.02
1uls_A		245	Putative 3-oxoacyl-acyl carrier protein reductase;	97.02
2raf_A		209	Putative dinucleotide-binding oxidoreductase; NP_7	97.02
3f9i_A		249	3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto	97.01
2y0c_A		478	BCEC, UDP-glucose dehydrogenase; oxidoreductase, c	97.01
1cyd_A		244	Carbonyl reductase; short-chain dehydrogenase, oxi	97.01
3tl2_A		315	Malate dehydrogenase; center for structural genomi	97.0
2jah_A		247	Clavulanic acid dehydrogenase; short-chain dehydro	97.0
3mz0_A		344	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd;	97.0
3tzq_B		271	Short-chain type dehydrogenase/reductase; ssgcid,	96.98
2v6b_A		304	L-LDH, L-lactate dehydrogenase; oxidoreductase, ra	96.98
1iy8_A		267	Levodione reductase; oxidoreductase; HET: NAD; 1.6	96.97
3ldh_A		330	Lactate dehydrogenase; oxidoreductase, CHOH donor,	96.97
4b4u_A		303	Bifunctional protein fold; oxidoreductase; HET: NA	96.97
1spx_A		278	Short-chain reductase family member (5L265); paral	96.96
2b4q_A		276	Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier	96.95
2z1n_A		260	Dehydrogenase; reductase, SDR, oxidoreductase; 1.8	96.95
3rc1_A		350	Sugar 3-ketoreductase; sugar biosynthesis, TDP bin	96.95
4aj2_A		331	L-lactate dehydrogenase A chain; oxidoreductase-in	96.94
3tpc_A		257	Short chain alcohol dehydrogenase-related dehydro;	96.93
4fn4_A		254	Short chain dehydrogenase; NADH-binding, rossmann	96.93
3e9m_A		330	Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA,	96.93
3pk0_A		262	Short-chain dehydrogenase/reductase SDR; ssgcid, s	96.93
3l77_A		235	Short-chain alcohol dehydrogenase; oxidoreductase;	96.93
2pnf_A		248	3-oxoacyl-[acyl-carrier-protein] reductase; short	96.93
3r1i_A		276	Short-chain type dehydrogenase/reductase; structur	96.92
3zv4_A		281	CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox	96.92
2a4k_A		263	3-oxoacyl-[acyl carrier protein] reductase; reduct	96.92
3g79_A		478	NDP-N-acetyl-D-galactosaminuronic acid dehydrogen;	96.92
2rhc_B		277	Actinorhodin polyketide ketoreductase; oxidoreduct	96.92
2bgk_A		278	Rhizome secoisolariciresinol dehydrogenase; oxidor	96.91
1fmc_A		255	7 alpha-hydroxysteroid dehydrogenase; short-chain	96.91
2ae2_A		260	Protein (tropinone reductase-II); oxidoreductase,	96.91
3hwr_A		318	2-dehydropantoate 2-reductase; YP_299159.1, PANE/A	96.91
3qiv_A		253	Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR	96.91
4dry_A		281	3-oxoacyl-[acyl-carrier-protein] reductase; struct	96.9
3dhn_A		227	NAD-dependent epimerase/dehydratase; reductase, PF	96.89
3l6e_A		235	Oxidoreductase, short-chain dehydrogenase/reducta;	96.89
3ego_A		307	Probable 2-dehydropantoate 2-reductase; structural	96.89
1y8q_A		346	Ubiquitin-like 1 activating enzyme E1A; SUMO, hete	96.89
4egf_A		266	L-xylulose reductase; structural genomics, ssgcid,	96.89
2qyt_A		317	2-dehydropantoate 2-reductase; APC81190, porphyrom	96.89
1xg5_A		279	ARPG836; short chain dehydrogenase, human, SGC, st	96.89
1hdo_A		206	Biliverdin IX beta reductase; foetal metabolism, H	96.88
3tjr_A		301	Short chain dehydrogenase; structural genomics, se	96.88
3gaf_A		256	7-alpha-hydroxysteroid dehydrogenase; seattle stru	96.87
1ae1_A		273	Tropinone reductase-I; oxidoreductase, tropane alk	96.86
3awd_A		260	GOX2181, putative polyol dehydrogenase; oxidoreduc	96.86
3dii_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	96.86
4g81_D		255	Putative hexonate dehydrogenase; enzyme function i	96.86
1dlj_A		402	UDP-glucose dehydrogenase; rossmann fold, ternary	96.86
1xea_A		323	Oxidoreductase, GFO/IDH/MOCA family; structural ge	96.86
2ag5_A		246	DHRS6, dehydrogenase/reductase (SDR family) member	96.86
1yb1_A		272	17-beta-hydroxysteroid dehydrogenase type XI; shor	96.85
2pd6_A		264	Estradiol 17-beta-dehydrogenase 8; short-chain deh	96.85
3dqp_A		219	Oxidoreductase YLBE; alpha-beta protein., structur	96.84
2ehd_A		234	Oxidoreductase, oxidoreductase, short-chain dehydr	96.84
1zk4_A		251	R-specific alcohol dehydrogenase; short chain redu	96.83
4ibo_A		271	Gluconate dehydrogenase; enzyme function initiativ	96.83
3h7a_A		252	Short chain dehydrogenase; oxidoreductase, PSI-2,	96.83
1lld_A		319	L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N	96.82
3tfo_A		264	Putative 3-oxoacyl-(acyl-carrier-protein) reducta;	96.82
2uvd_A		246	3-oxoacyl-(acyl-carrier-protein) reductase; beta-k	96.82
3d0o_A		317	L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly	96.82
3tox_A		280	Short chain dehydrogenase; structural genomics, PS	96.81
3ius_A		286	Uncharacterized conserved protein; APC63810, silic	96.81
3guy_A		230	Short-chain dehydrogenase/reductase SDR; structura	96.81
2q3e_A		467	UDP-glucose 6-dehydrogenase; hexamer, structural g	96.8
1zem_A		262	Xylitol dehydrogenase; rossmann fold, dinucleotide	96.8
2cfc_A		250	2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor	96.79
3ec7_A		357	Putative dehydrogenase; alpha-beta, structural gen	96.79
3ohs_X		334	Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d	96.79
3o38_A		266	Short chain dehydrogenase; tuberculosis, ortholog	96.79
1y1p_A		342	ARII, aldehyde reductase II; rossmann fold, short	96.78
3i83_A		320	2-dehydropantoate 2-reductase; structural genomics	96.78
2pv7_A		298	T-protein [includes: chorismate mutase (EC 5.4.99	96.77
3nyw_A		250	Putative oxidoreductase; fatty acid synthesis,3-ox	96.77
1w6u_A		302	2,4-dienoyl-COA reductase, mitochondrial precursor	96.77
2d1y_A		256	Hypothetical protein TT0321; strucrtural genomics,	96.77
2zat_A		260	Dehydrogenase/reductase SDR family member 4; alpha	96.76
3fi9_A		343	Malate dehydrogenase; structural genomics, oxidore	96.76
3f1l_A		252	Uncharacterized oxidoreductase YCIK; E. coli, NADP	96.75
3v8b_A		283	Putative dehydrogenase, possibly 3-oxoacyl-[acyl-	96.75
2aef_A		234	Calcium-gated potassium channel MTHK; rossmann fol	96.75
4g65_A		461	TRK system potassium uptake protein TRKA; structur	96.75
2wtb_A		725	MFP2, fatty acid multifunctional protein (ATMFP2);	96.74
3svt_A		281	Short-chain type dehydrogenase/reductase; ssgcid,	96.73
4fc7_A		277	Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman	96.73
3m1a_A		281	Putative dehydrogenase; short, PSI, MCSG, structur	96.73
1xkq_A		280	Short-chain reductase family member (5D234); parra	96.72
3i1j_A		247	Oxidoreductase, short chain dehydrogenase/reducta;	96.72
1mxh_A		276	Pteridine reductase 2; SDR topology, protein-subst	96.72
3ppi_A		281	3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de	96.71
1geg_A		256	Acetoin reductase; SDR family, oxidoreductase; HET	96.71
3rih_A		293	Short chain dehydrogenase or reductase; structural	96.71
3h2s_A		224	Putative NADH-flavin reductase; Q03B84, NESG, LCR1	96.71
1ks9_A		291	KPA reductase;, 2-dehydropantoate 2-reductase; PAN	96.71
4fb5_A		393	Probable oxidoreductase protein; PSI-biology, nysg	96.71
3cxt_A		291	Dehydrogenase with different specificities; rossma	96.7
3nep_X		314	Malate dehydrogenase; halophIle, molecular adpatat	96.7
3ghy_A		335	Ketopantoate reductase protein; oxidoreductase, NA	96.69
1yxm_A		303	Pecra, peroxisomal trans 2-enoyl COA reductase; pe	96.69
1sby_A		254	Alcohol dehydrogenase; ternary complex, NAD, trifl	96.68
3ucx_A		264	Short chain dehydrogenase; ssgcid, seattle structu	96.68
3ftp_A		270	3-oxoacyl-[acyl-carrier protein] reductase; ssgcid	96.68
3lyl_A		247	3-oxoacyl-(acyl-carrier-protein) reductase; alpha	96.67
1tlt_A		319	Putative oxidoreductase (virulence factor MVIM HO;	96.67
3lf2_A		265	Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross	96.67
3ged_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	96.67
1ez4_A		318	Lactate dehydrogenase; rossmann fold, oxidoreducta	96.67
1ydw_A		362	AX110P-like protein; structural genomics, protein	96.66
2zqz_A		326	L-LDH, L-lactate dehydrogenase; oxidoreductase, ro	96.66
1xhl_A		297	Short-chain dehydrogenase/reductase family member	96.66
1x1t_A		260	D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S	96.65
1gee_A		261	Glucose 1-dehydrogenase; short-chain dehydrogenase	96.65
4fs3_A		256	Enoyl-[acyl-carrier-protein] reductase [NADPH] FA;	96.64
3sju_A		279	Keto reductase; short-chain dehydrogenase, oxidore	96.64
2ew8_A		249	(S)-1-phenylethanol dehydrogenase; transferase; 2.	96.64
3rkr_A		262	Short chain oxidoreductase; rossmann fold; HET: NA	96.63
3pgx_A		280	Carveol dehydrogenase; structural genomics, seattl	96.63
1wdk_A		715	Fatty oxidation complex alpha subunit; alpha2BETA2	96.63
3gem_A		260	Short chain dehydrogenase; structural genomics, AP	96.63
1xq1_A		266	Putative tropinone reducatse; structural genomics,	96.62
3afn_B		258	Carbonyl reductase; alpha/beta/alpha, rossmann-fol	96.62
4imr_A		275	3-oxoacyl-(acyl-carrier-protein) reductase; oxidor	96.62
4had_A		350	Probable oxidoreductase protein; structural genomi	96.61
4gqa_A		412	NAD binding oxidoreductase; structural genomics, P	96.6
3l9w_A		413	Glutathione-regulated potassium-efflux system Pro	96.59
1h6d_A		433	Precursor form of glucose-fructose oxidoreductase;	96.58
2gdz_A		267	NAD+-dependent 15-hydroxyprostaglandin dehydrogen;	96.57
3uve_A		286	Carveol dehydrogenase ((+)-trans-carveol dehydrog;	96.57
3c7a_A		404	Octopine dehydrogenase; L) stereospecific opine de	96.56
3v2h_A		281	D-beta-hydroxybutyrate dehydrogenase; structural g	96.55
3t4x_A		267	Oxidoreductase, short chain dehydrogenase/reducta;	96.55
1nvm_B		312	Acetaldehyde dehydrogenase (acylating), 4-hydroxy-	96.54
4h3v_A		390	Oxidoreductase domain protein; structural genomics	96.53
3ojo_A		431	CAP5O; rossmann fold, complex with cofactor NAD an	96.53
1zh8_A		340	Oxidoreductase; TM0312, structural genomics, JO ce	96.52
2x9g_A		288	PTR1, pteridine reductase; short chain dehydrogena	96.51
1wma_A		276	Carbonyl reductase [NADPH] 1; oxidoreductase; HET:	96.51
1tt5_B		434	Ubiquitin-activating enzyme E1C isoform 1; cell cy	96.51
2c07_A		285	3-oxoacyl-(acyl-carrier protein) reductase; oxidor	96.5
1e7w_A		291	Pteridine reductase; dihydrofolate reductase, shor	96.5
2nwq_A		272	Probable short-chain dehydrogenase; oxidoreductase	96.5
1ja9_A		274	4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p	96.5
2xxj_A		310	L-LDH, L-lactate dehydrogenase; oxidoreductase, hy	96.5
2gas_A		307	Isoflavone reductase; NADPH-dependent reductase, o	96.49
2bd0_A		244	Sepiapterin reductase; oxidoreductase; HET: NAP BI	96.49
2bka_A		242	CC3, TAT-interacting protein TIP30; NADPH, PEG600,	96.49
3ioy_A		319	Short-chain dehydrogenase/reductase SDR; structura	96.48
3evn_A		329	Oxidoreductase, GFO/IDH/MOCA family; structural ge	96.48
1y6j_A		318	L-lactate dehydrogenase; southeast collaboratory f	96.47
1zmo_A		244	Halohydrin dehalogenase; haloalcohol dehalogenase,	96.46
1qyd_A		313	Pinoresinol-lariciresinol reductase; NADPH-depende	96.46
3pxx_A		287	Carveol dehydrogenase; structural genomics, seattl	96.44
3sx2_A		278	Putative 3-ketoacyl-(acyl-carrier-protein) reduct;	96.44
3o26_A		311	Salutaridine reductase; short chain dehydrogenase/	96.44
3a28_C		258	L-2.3-butanediol dehydrogenase; chiral substrate r	96.43
4gmf_A		372	Yersiniabactin biosynthetic protein YBTU; rossmann	96.41
3asu_A		248	Short-chain dehydrogenase/reductase SDR; SDR famil	96.4
2x0j_A		294	Malate dehydrogenase; oxidoreductase, hyperthermop	96.4
2o3j_A		481	UDP-glucose 6-dehydrogenase; structural genomics,	96.4
2qq5_A		260	DHRS1, dehydrogenase/reductase SDR family member 1	96.39
2dc1_A		236	L-aspartate dehydrogenase; NAD, oxidoreductase; HE	96.39
2qhx_A		328	Pteridine reductase 1; oxidoreductase, short-chain	96.39
3e18_A		359	Oxidoreductase; dehydrogenase, NAD-binding, struct	96.38
4da9_A		280	Short-chain dehydrogenase/reductase; structural ge	96.37
2p2s_A		336	Putative oxidoreductase; YP_050235.1, structural g	96.37
2i6t_A		303	Ubiquitin-conjugating enzyme E2-like isoform A; L-	96.35
3rku_A		287	Oxidoreductase YMR226C; substrate fingerprint, sho	96.35
2wyu_A		261	Enoyl-[acyl carrier protein] reductase; oxidoreduc	96.35
1xu9_A		286	Corticosteroid 11-beta-dehydrogenase, isozyme 1; h	96.35
3s55_A		281	Putative short-chain dehydrogenase/reductase; stru	96.33
3p19_A		266	BFPVVD8, putative blue fluorescent protein; rossma	96.33
1o5i_A		249	3-oxoacyl-(acyl carrier protein) reductase; TM1169	96.32
2q2v_A		255	Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore	96.31
3v2g_A		271	3-oxoacyl-[acyl-carrier-protein] reductase; struct	96.3
2hq1_A		247	Glucose/ribitol dehydrogenase; CTH-1438, structura	96.3
3u3x_A		361	Oxidoreductase; structural genomics, PSI-biology,	96.3
2h7i_A		269	Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi	96.29
3t7c_A		299	Carveol dehydrogenase; structural genomics, seattl	96.29
3qvo_A		236	NMRA family protein; structural genomics, PSI-biol	96.29
2p91_A		285	Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD	96.28
3upl_A		446	Oxidoreductase; rossmann fold, NADPH binding; 1.50	96.27
1y8q_B		640	Anthracycline-, ubiquitin-like 2 activating enzyme	96.26
3kzv_A		254	Uncharacterized oxidoreductase YIR035C; cytoplasmi	96.26
3v5n_A		417	Oxidoreductase; structural genomics, PSI-biology,	96.26
4dmm_A		269	3-oxoacyl-[acyl-carrier-protein] reductase; rossma	96.24
4iin_A		271	3-ketoacyl-acyl carrier protein reductase (FABG);	96.23
3gpi_A		286	NAD-dependent epimerase/dehydratase; structural ge	96.23
2czc_A		334	Glyceraldehyde-3-phosphate dehydrogenase; glycolys	96.22
2yut_A		207	Putative short-chain oxidoreductase; alpha and bet	96.22
2pd4_A		275	Enoyl-[acyl-carrier-protein] reductase [NADH]; ant	96.22
3bio_A		304	Oxidoreductase, GFO/IDH/MOCA family; structural ge	96.2
3c1o_A		321	Eugenol synthase; phenylpropene, PIP reductase, sh	96.2
1qyc_A		308	Phenylcoumaran benzylic ether reductase PT1; NADPH	96.17
3tsc_A		277	Putative oxidoreductase; structural genomics, seat	96.16
3m2t_A		359	Probable dehydrogenase; PSI, SGXNY, structural gen	96.16
1qsg_A		265	Enoyl-[acyl-carrier-protein] reductase; enoyl redu	96.16

>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1	Back alignment and structure

Probab=100.00  E-value=3.4e-70  Score=576.99  Aligned_cols=401  Identities=29%  Similarity=0.426  Sum_probs=351.7

Q ss_pred             ce-EEEEEeecCCCCHHHHhhhcCCCCChHHHHHHHhccCCCcceEEeeecCeeEEEEEeccccccHHHHHHHHHHhcCC
Q 010322           63 SS-IVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSKTSGI  141 (513)
Q Consensus        63 ~~-i~~igi~hk~apv~~RE~~a~~~~~~~~~l~~l~~~~~i~e~viLsTCNR~EiY~~~~~~~~~~~~~~~~l~~~~~~  141 (513)
                      |+ |+++|+||||||+++||||+|++++   ++..|+..+++.|++|||||||+|||+..+. +     +..++.++.+ 
T Consensus         1 m~~~~~~g~~h~~a~v~~re~~~~~~~~---~~~~l~~~~~~~e~~ilsTCnR~E~y~~~~~-~-----~~~~~~~~~~-   70 (404)
T 1gpj_A            1 MEDLVSVGITHKEAEVEELEKARFESDE---AVRDIVESFGLSGSVLLQTSNRVEVYASGAR-D-----RAEELGDLIH-   70 (404)
T ss_dssp             CTTEEEEEEETTTSCHHHHHHHSCCCTT---HHHHHHHHHTCSEEEEEEETTEEEEEEESCT-T-----CHHHHHHTTC-
T ss_pred             CccEEEEEEECCcCCHHHHHHHhCCHHH---HHHHHhcCCCCccEEEEecCCeEEEEEecch-h-----HHHHHHHHHh-
Confidence            66 9999999999999999999999876   7788888889999999999999999987642 2     4455555543 


Q ss_pred             ChhhhhhHHHHhcCCceeeeeeeeccCCCCcccCcchhhchHHHHHHHhHhcCcccchhhHHHHHHHhhCcccccccccc
Q 010322          142 PVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNIA  221 (513)
Q Consensus       142 ~~~~~~~~~~~~~G~eav~hlf~V~sGldS~vvGE~qIlgQvk~A~~~a~~~~~~g~~L~~lf~~ai~v~k~Vr~et~i~  221 (513)
                            +++|.+.|+++++|+|+|++|+||+++||+||++|++.+|..|...|.++.+++..|+.++.+++++++++.++
T Consensus        71 ------~~~~~~~g~~a~~~i~~v~~Glds~~vGe~~Il~qvk~~~~~~~~~G~~~~~~~~~~~~a~~~~k~v~~~~~~~  144 (404)
T 1gpj_A           71 ------DDAWVKRGSEAVRHLFRVASGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKIVFRRAINLGKRAREETRIS  144 (404)
T ss_dssp             ------TTCEEEEHHHHHHHHHHHHTTTTSSSTTCHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHSSTT
T ss_pred             ------hheeeecCchHhhhheeeccCCCCCcCCcchhHHHHHHHHHHHHHcCCchHHHHHHHHHHhhhhccCcchhhhc
Confidence                  27899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCchHHHHHHHHHHhhCCCCCCCCCeEEEEcccHHHHHHHHHHHHcCCCeEEEEeCCHHHHHHHHHHhCCcceeecccc
Q 010322          222 AGAVSVSSAAVELALMKLPESSHATARMLVIGAGKMGKLVIKHLVAKGCTKMVVVNRSEERVAAICEELNGVEIIYKPLS  301 (513)
Q Consensus       222 ~~~~Sva~~Av~la~~~~~~~~l~g~~VlVIGaG~mG~~ia~~L~~~G~~~V~v~nRs~~ra~~la~~~g~~~~~~~~~~  301 (513)
                      .+++|++++|+.++...+  +++.|++|+|||+|+||+++++.|...|+.+|+++||++++++++++++|.   .+.+++
T Consensus       145 ~~~~s~a~~av~~a~~~~--~~l~g~~VlIiGaG~iG~~~a~~l~~~G~~~V~v~~r~~~ra~~la~~~g~---~~~~~~  219 (404)
T 1gpj_A          145 EGAVSIGSAAVELAEREL--GSLHDKTVLVVGAGEMGKTVAKSLVDRGVRAVLVANRTYERAVELARDLGG---EAVRFD  219 (404)
T ss_dssp             CSCCSHHHHHHHHHHHHH--SCCTTCEEEEESCCHHHHHHHHHHHHHCCSEEEEECSSHHHHHHHHHHHTC---EECCGG
T ss_pred             CCCccHHHHHHHHHHHHh--ccccCCEEEEEChHHHHHHHHHHHHHCCCCEEEEEeCCHHHHHHHHHHcCC---ceecHH
Confidence            999999999998876444  357899999999999999999999999998899999999998889999875   334556


Q ss_pred             hHHhhcCCCcEEEEcCCCCccCCChhhhhc-CCchhhhcCCcEEEEeccCCCCCCcccccccCeEEEccCCHHHHHHHHH
Q 010322          302 EMLSCAADADVVFTSTASEAPLFLKDHVQD-LPPVEAAVGGLRLFIDISVPRNVGSCVADVETARVYNVDDLKEVVAANK  380 (513)
Q Consensus       302 ~~~~~l~~aDVVI~AT~s~~~vi~~~~l~~-~~~~~~~~~g~~viiDlavPrdidp~v~~l~gv~ly~iDdl~~v~~~~~  380 (513)
                      ++.+.+.++|+||+||+++.++++.+.+.. +++.  +++++.+++|++.|++++|.+.+++|+++|++||+..++..+.
T Consensus       220 ~l~~~l~~aDvVi~at~~~~~~~~~~~l~~~~lk~--r~~~~~v~vdia~P~~i~~~l~~l~~v~l~d~d~l~~~~~~~~  297 (404)
T 1gpj_A          220 ELVDHLARSDVVVSATAAPHPVIHVDDVREALRKR--DRRSPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENL  297 (404)
T ss_dssp             GHHHHHHTCSEEEECCSSSSCCBCHHHHHHHHHHC--SSCCCEEEEECCSSCSBCTTGGGSTTEEEEEHHHHHHHHHHHH
T ss_pred             hHHHHhcCCCEEEEccCCCCceecHHHHHHHHHhc--cCCCCEEEEEccCCCCCCccccccCCeEEEeHhhHHHHHHHHH
Confidence            777777899999999999999887777654 2110  1357799999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCChHHHHHHHHHHHHHHHHHh
Q 010322          381 EDRLRKAMEAQAIITEESKQFAAWRDSLETVPTIKKLRAYAERIRVAELDKCLSKMGDDISKKTRRAVDDLSRGIMNKLL  460 (513)
Q Consensus       381 ~~R~~~~~~ae~iI~e~~~~f~~w~~~~~~~p~I~~lr~~~e~i~~~el~~~~~kl~~~~~~~~~~~i~~~~~~~~~k~l  460 (513)
                      +.|...+.++++||.+++..|..|++.....|+|+.+++++++++++|++|++++|++   +++++++++++++++||||
T Consensus       298 ~~r~~~~~~~~~li~q~~~~f~~w~~~~~~~~~I~~lr~~~~~~~~~e~~~~~~~l~~---~~~~~~~~~~~~~~~~k~l  374 (404)
T 1gpj_A          298 ERRRKEIPKVEKLIEEELSTVEEELEKLKERRLVADVAKSLHEIKDRELERALRRLKT---GDPENVLQDFAEAYTKRLI  374 (404)
T ss_dssp             HHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCSCC--------CCTTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcccHHHHHHHHHHHHHHHHHHHHHHHHhcCC---ccHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999974   5678999999999999999


Q ss_pred             hhHHHHHhhcCCCCCchhhhHHHHHHHHHHhCCC
Q 010322          461 HGPMQHLRCDGSDSRTLDETLENMHALNRMFGLE  494 (513)
Q Consensus       461 h~P~~~lk~~~~~~~~~~~~~~~~~~~~~lf~l~  494 (513)
                      |.|+.+||+.+.++.     .+++++++++|.|+
T Consensus       375 ~~p~~~l~~~~~~~~-----~~~~~~~~~~~~~~  403 (404)
T 1gpj_A          375 NVLTSAIMELPDEYR-----RAASRALRRASELN  403 (404)
T ss_dssp             HHHHHHHHSSCTTTT-----THHHHHHHHHHHHT
T ss_pred             HHHHHHHHHhhhcCh-----HHHHHHHHHHHhhc
Confidence            999999997644332     35899999999764

PyMOL of 1gpj

>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium}	Back alignment and structure

>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus}	Back alignment and structure

>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida}	Back alignment and structure

>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B*	Back alignment and structure

>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A	Back alignment and structure

>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A*	Back alignment and structure

>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A*	Back alignment and structure

>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A*	Back alignment and structure

>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5	Back alignment and structure

>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5	Back alignment and structure

>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A*	Back alignment and structure

>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A*	Back alignment and structure

>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima}	Back alignment and structure

>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A	Back alignment and structure

>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A*	Back alignment and structure

>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A*	Back alignment and structure

>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5	Back alignment and structure

>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A*	Back alignment and structure

>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A*	Back alignment and structure

>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A*	Back alignment and structure

>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A	Back alignment and structure

>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli}	Back alignment and structure

>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A*	Back alignment and structure

>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa}	Back alignment and structure

>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans}	Back alignment and structure

>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori}	Back alignment and structure

>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A	Back alignment and structure

>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A*	Back alignment and structure

>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A*	Back alignment and structure

>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A*	Back alignment and structure

>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A	Back alignment and structure

>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A	Back alignment and structure

>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021}	Back alignment and structure

>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima}	Back alignment and structure

>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A*	Back alignment and structure

>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str}	Back alignment and structure

>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A*	Back alignment and structure

>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana}	Back alignment and structure

>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A*	Back alignment and structure

>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus}	Back alignment and structure

>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1	Back alignment and structure

>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis}	Back alignment and structure

>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida}	Back alignment and structure

>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A*	Back alignment and structure

>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ...	Back alignment and structure

>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A	Back alignment and structure

>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A	Back alignment and structure

>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A*	Back alignment and structure

>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A*	Back alignment and structure

>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A*	Back alignment and structure

>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis}	Back alignment and structure

>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A*	Back alignment and structure

>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A*	Back alignment and structure

>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae}	Back alignment and structure

>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A*	Back alignment and structure

>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A*	Back alignment and structure

>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti}	Back alignment and structure

>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus}	Back alignment and structure

>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A	Back alignment and structure

>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis}	Back alignment and structure

>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A*	Back alignment and structure

>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus}	Back alignment and structure

>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus}	Back alignment and structure

>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A*	Back alignment and structure

>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens}	Back alignment and structure

>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli}	Back alignment and structure

>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A*	Back alignment and structure

>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP}	Back alignment and structure

>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii}	Back alignment and structure

>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A*	Back alignment and structure

>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti}	Back alignment and structure

>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis}	Back alignment and structure

>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus}	Back alignment and structure

>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A	Back alignment and structure

>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens}	Back alignment and structure

>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli}	Back alignment and structure

>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A*	Back alignment and structure

>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A*	Back alignment and structure

>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A*	Back alignment and structure

>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A*	Back alignment and structure

>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A*	Back alignment and structure

>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A	Back alignment and structure

>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis}	Back alignment and structure

>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha}	Back alignment and structure

>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A*	Back alignment and structure

>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans}	Back alignment and structure

>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A	Back alignment and structure

>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp}	Back alignment and structure

>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A	Back alignment and structure

>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A*	Back alignment and structure

>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A*	Back alignment and structure

>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A*	Back alignment and structure

>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A	Back alignment and structure

>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens}	Back alignment and structure

>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major}	Back alignment and structure

>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2	Back alignment and structure

>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi}	Back alignment and structure

>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A*	Back alignment and structure

>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus}	Back alignment and structure

>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A*	Back alignment and structure

>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A*	Back alignment and structure

>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A*	Back alignment and structure

>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A*	Back alignment and structure

>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A*	Back alignment and structure

>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes}	Back alignment and structure

>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A	Back alignment and structure

>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP}	Back alignment and structure

>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D	Back alignment and structure

>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A*	Back alignment and structure

>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A	Back alignment and structure

>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium}	Back alignment and structure

>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A*	Back alignment and structure

>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis}	Back alignment and structure

>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A*	Back alignment and structure

>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti}	Back alignment and structure

>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A*	Back alignment and structure

>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana}	Back alignment and structure

>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP}	Back alignment and structure

>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens}	Back alignment and structure

>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579}	Back alignment and structure

>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens}	Back alignment and structure

>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii}	Back alignment and structure

>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A*	Back alignment and structure

>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii}	Back alignment and structure

>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B*	Back alignment and structure

>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A	Back alignment and structure

>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp}	Back alignment and structure

>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3	Back alignment and structure

>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii}	Back alignment and structure

>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii}	Back alignment and structure

>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens}	Back alignment and structure

>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum}	Back alignment and structure

>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A*	Back alignment and structure

>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A	Back alignment and structure

>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9	Back alignment and structure

>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B	Back alignment and structure

>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1	Back alignment and structure

>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A*	Back alignment and structure

>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa}	Back alignment and structure

>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum}	Back alignment and structure

>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum}	Back alignment and structure

>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens}	Back alignment and structure

>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida}	Back alignment and structure

>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP}	Back alignment and structure

>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A*	Back alignment and structure

>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A	Back alignment and structure

>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp}	Back alignment and structure

>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A*	Back alignment and structure

>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus}	Back alignment and structure

>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli}	Back alignment and structure

>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A	Back alignment and structure

>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium}	Back alignment and structure

>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A*	Back alignment and structure

>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A*	Back alignment and structure

>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A	Back alignment and structure

>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A*	Back alignment and structure

>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium}	Back alignment and structure

>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1	Back alignment and structure

>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A*	Back alignment and structure

>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A*	Back alignment and structure

>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A*	Back alignment and structure

>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A*	Back alignment and structure

>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae}	Back alignment and structure

>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6	Back alignment and structure

>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens}	Back alignment and structure

>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans}	Back alignment and structure

>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A*	Back alignment and structure

>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A*	Back alignment and structure

>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A	Back alignment and structure

>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima}	Back alignment and structure

>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti}	Back alignment and structure

>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima}	Back alignment and structure

>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A*	Back alignment and structure

>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A*	Back alignment and structure

>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6	Back alignment and structure

>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii}	Back alignment and structure

>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans}	Back alignment and structure

>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A	Back alignment and structure

>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A*	Back alignment and structure

>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1	Back alignment and structure

>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A*	Back alignment and structure

>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A*	Back alignment and structure

>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12}	Back alignment and structure

>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6	Back alignment and structure

>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica}	Back alignment and structure

>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6	Back alignment and structure

>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6	Back alignment and structure

>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9	Back alignment and structure

>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A*	Back alignment and structure

>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus}	Back alignment and structure

>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri}	Back alignment and structure

>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1	Back alignment and structure

>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6	Back alignment and structure

>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP}	Back alignment and structure

>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A*	Back alignment and structure

>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis}	Back alignment and structure

>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii}	Back alignment and structure

>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}	Back alignment and structure

>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes}	Back alignment and structure

>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A*	Back alignment and structure

>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A*	Back alignment and structure

>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium}	Back alignment and structure

>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A	Back alignment and structure

>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A	Back alignment and structure

>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis}	Back alignment and structure

>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A*	Back alignment and structure

>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6	Back alignment and structure

>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6	Back alignment and structure

>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A*	Back alignment and structure

>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A*	Back alignment and structure

>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A*	Back alignment and structure

>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A*	Back alignment and structure

>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus}	Back alignment and structure

>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I*	Back alignment and structure

>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A	Back alignment and structure

>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens}	Back alignment and structure

>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A*	Back alignment and structure

>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A*	Back alignment and structure

>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum}	Back alignment and structure

>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2}	Back alignment and structure

>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli}	Back alignment and structure

>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A*	Back alignment and structure

>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6	Back alignment and structure

>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A*	Back alignment and structure

>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A	Back alignment and structure

>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A*	Back alignment and structure

>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus}	Back alignment and structure

>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A	Back alignment and structure

>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A*	Back alignment and structure

>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile}	Back alignment and structure

>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea}	Back alignment and structure

>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A*	Back alignment and structure

>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli}	Back alignment and structure

>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A	Back alignment and structure

>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti}	Back alignment and structure

>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A*	Back alignment and structure

>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*	Back alignment and structure

>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis}	Back alignment and structure

>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum}	Back alignment and structure

>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli}	Back alignment and structure

>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum}	Back alignment and structure

>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A*	Back alignment and structure

>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus}	Back alignment and structure

>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A*	Back alignment and structure

>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A*	Back alignment and structure

>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A	Back alignment and structure

>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes}	Back alignment and structure

>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E	Back alignment and structure

>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A*	Back alignment and structure

>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus}	Back alignment and structure

>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A*	Back alignment and structure

>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A*	Back alignment and structure

>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A*	Back alignment and structure

>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A*	Back alignment and structure

>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens}	Back alignment and structure

>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum}	Back alignment and structure

>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A*	Back alignment and structure

>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A	Back alignment and structure

>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus}	Back alignment and structure

>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A*	Back alignment and structure

>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans}	Back alignment and structure

>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix}	Back alignment and structure

>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima}	Back alignment and structure

>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A*	Back alignment and structure

>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2	Back alignment and structure

>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis}	Back alignment and structure

>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str}	Back alignment and structure

>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis}	Back alignment and structure

>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A*	Back alignment and structure

>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A*	Back alignment and structure

>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0	Back alignment and structure

>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A*	Back alignment and structure

>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2	Back alignment and structure

>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis}	Back alignment and structure

>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A*	Back alignment and structure

>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A*	Back alignment and structure

>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0	Back alignment and structure

>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans}	Back alignment and structure

>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2	Back alignment and structure

>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1	Back alignment and structure

>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A*	Back alignment and structure

>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix}	Back alignment and structure

>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A*	Back alignment and structure

>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ...	Back alignment and structure

>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti}	Back alignment and structure

>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius}	Back alignment and structure

>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis}	Back alignment and structure

>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A*	Back alignment and structure

>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A*	Back alignment and structure

>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum}	Back alignment and structure

>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A*	Back alignment and structure

>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1}	Back alignment and structure

>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A*	Back alignment and structure

>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A*	Back alignment and structure

>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A*	Back alignment and structure

>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A*	Back alignment and structure

>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha}	Back alignment and structure

>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp}	Back alignment and structure

>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0	Back alignment and structure

>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis}	Back alignment and structure

>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A*	Back alignment and structure

>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis}	Back alignment and structure

>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis}	Back alignment and structure

>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*	Back alignment and structure

>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp}	Back alignment and structure

>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis}	Back alignment and structure

>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2	Back alignment and structure

>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans}	Back alignment and structure

>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp}	Back alignment and structure

>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A*	Back alignment and structure

>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5	Back alignment and structure

>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens}	Back alignment and structure

>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp}	Back alignment and structure

>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus}	Back alignment and structure

>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A	Back alignment and structure

>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum}	Back alignment and structure

>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris}	Back alignment and structure

>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T*	Back alignment and structure

>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti}	Back alignment and structure

>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis}	Back alignment and structure

>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A*	Back alignment and structure

>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti}	Back alignment and structure

>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3}	Back alignment and structure

>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus}	Back alignment and structure

>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A	Back alignment and structure

>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2	Back alignment and structure

>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus}	Back alignment and structure

>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium}	Back alignment and structure

>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X	Back alignment and structure

>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis}	Back alignment and structure

>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A	Back alignment and structure

>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus}	Back alignment and structure

>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6	Back alignment and structure

>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A*	Back alignment and structure

>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A*	Back alignment and structure

>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis}	Back alignment and structure

>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A	Back alignment and structure

>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti}	Back alignment and structure

>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A	Back alignment and structure

>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus}	Back alignment and structure

>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana}	Back alignment and structure

>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans}	Back alignment and structure

>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A*	Back alignment and structure

>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis}	Back alignment and structure

>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0	Back alignment and structure

>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A*	Back alignment and structure

>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium}	Back alignment and structure

>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2	Back alignment and structure

>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus}	Back alignment and structure

>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334}	Back alignment and structure

>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A*	Back alignment and structure

>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli}	Back alignment and structure

>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber}	Back alignment and structure

>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum}	Back alignment and structure

>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A*	Back alignment and structure

>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei}	Back alignment and structure

>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2	Back alignment and structure

>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5	Back alignment and structure

>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A*	Back alignment and structure

>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A*	Back alignment and structure

>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A	Back alignment and structure

>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A*	Back alignment and structure

>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A*	Back alignment and structure

>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A*	Back alignment and structure

>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A	Back alignment and structure

>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber}	Back alignment and structure

>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A*	Back alignment and structure

>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5}	Back alignment and structure

>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A*	Back alignment and structure

>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV}	Back alignment and structure

>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A	Back alignment and structure

>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A*	Back alignment and structure

>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum}	Back alignment and structure

>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli}	Back alignment and structure

>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae}	Back alignment and structure

>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A*	Back alignment and structure

>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A*	Back alignment and structure

>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A*	Back alignment and structure

>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B*	Back alignment and structure

>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti}	Back alignment and structure

>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis}	Back alignment and structure

>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1	Back alignment and structure

>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida}	Back alignment and structure

>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A*	Back alignment and structure

>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5	Back alignment and structure

>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ...	Back alignment and structure

>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A*	Back alignment and structure

>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B*	Back alignment and structure

>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2	Back alignment and structure

>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A*	Back alignment and structure

>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2	Back alignment and structure

>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A	Back alignment and structure

>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa}	Back alignment and structure

>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2	Back alignment and structure

>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A	Back alignment and structure

>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444}	Back alignment and structure

>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V}	Back alignment and structure

>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP}	Back alignment and structure

>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2	Back alignment and structure

>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp}	Back alignment and structure

>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0	Back alignment and structure

>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum}	Back alignment and structure

>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A*	Back alignment and structure

>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A*	Back alignment and structure

>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A*	Back alignment and structure

>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans}	Back alignment and structure

>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens}	Back alignment and structure

>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus}	Back alignment and structure

>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2	Back alignment and structure

>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua}	Back alignment and structure

>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A	Back alignment and structure

>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A*	Back alignment and structure

>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ...	Back alignment and structure

>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0	Back alignment and structure

>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus}	Back alignment and structure

>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A	Back alignment and structure

>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti}	Back alignment and structure

>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum}	Back alignment and structure

>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti}	Back alignment and structure

>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ...	Back alignment and structure

>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium}	Back alignment and structure

>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A}	Back alignment and structure

>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus}	Back alignment and structure

>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A*	Back alignment and structure

>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A	Back alignment and structure

>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A*	Back alignment and structure

>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A	Back alignment and structure

>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT}	Back alignment and structure

>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1	Back alignment and structure

>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus}	Back alignment and structure

>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A*	Back alignment and structure

>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis}	Back alignment and structure

>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri}	Back alignment and structure

>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2	Back alignment and structure

>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0	Back alignment and structure

>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum}	Back alignment and structure

>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		513
d1gpja3		143	d.58.39.1 (A:1-143) Glutamyl tRNA-reductase cataly	3e-36
d1gpja2		159	c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle	1e-33
d1gpja1		102	a.151.1.1 (A:303-404) Glutamyl tRNA-reductase dime	1e-16
d1e5qa1		182	c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase	1e-08
d1yqga2		152	c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductas	0.003

>d1gpja3 d.58.39.1 (A:1-143) Glutamyl tRNA-reductase catalytic, N-terminal domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 143	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Glutamyl tRNA-reductase catalytic, N-terminal domain
family: Glutamyl tRNA-reductase catalytic, N-terminal domain
domain: Glutamyl tRNA-reductase catalytic, N-terminal domain
species: Archaeon Methanopyrus kandleri [TaxId: 2320]

 Score =  129 bits (325), Expect = 3e-36
 Identities = 42/158 (26%), Positives = 76/158 (48%), Gaps = 16/158 (10%)

Query: 63  SSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVAL 122
             +V +G++   A VE  EK      E   A+ ++     +  + +L T NR+E+Y    
Sbjct: 2   EDLVSVGITHKEAEVEELEKARFESDE---AVRDIVESFGLSGSVLLQTSNRVEVYAS-- 56

Query: 123 SQHRGVKEVTEWMSKTSGIPVAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQ 182
               G ++  E +            +  ++    +A +HLF V++GL+S+++GE +IL Q
Sbjct: 57  ----GARDRAEELGDLI-------HDDAWVKRGSEAVRHLFRVASGLESMMVGEQEILRQ 105

Query: 183 VKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNI 220
           VK+       +      +  +F+ AI++GKR R ET I
Sbjct: 106 VKKAYDRAARLGTLDEALKIVFRRAINLGKRAREETRI 143

PyMOL of d1gpja3

>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 159	Back information, alignment and structure

>d1gpja1 a.151.1.1 (A:303-404) Glutamyl tRNA-reductase dimerization domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 102	Back information, alignment and structure

>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182	Back information, alignment and structure

>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Length = 152	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		513
d1gpja3		143	Glutamyl tRNA-reductase catalytic, N-terminal doma	100.0
d1gpja2		159	Glutamyl tRNA-reductase middle domain {Archaeon Me	99.96
d1gpja1		102	Glutamyl tRNA-reductase dimerization domain {Archa	99.69
d1nyta1		170	Shikimate 5-dehydrogenase AroE {Escherichia coli [	99.45
d1npya1		167	Shikimate 5-dehydrogenase-like protein HI0607 {Hae	99.41
d1p77a1		171	Shikimate 5-dehydrogenase AroE {Haemophilus influe	99.35
d1nvta1		177	Shikimate 5-dehydrogenase AroE {Archaeon Methanoco	99.35
d1vi2a1		182	Putative shikimate dehydrogenase YdiB {Escherichia	99.27
d1pl8a2		171	Ketose reductase (sorbitol dehydrogenase) {Human (	99.21
d1e3ja2		170	Ketose reductase (sorbitol dehydrogenase) {Silverl	99.07
d1jqba2		174	Bacterial secondary alcohol dehydrogenase {Clostri	99.02
d1h2ba2		172	Alcohol dehydrogenase {Archaeon Aeropyrum pernix [	98.99
d1vj0a2		182	Hypothetical protein TM0436 {Thermotoga maritima [	98.9
d1uufa2		168	Hypothetical protein YahK {Escherichia coli [TaxId	98.9
d1piwa2		168	Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas	98.87
d1pjca1		168	L-alanine dehydrogenase {Phormidium lapideum [TaxI	98.83
d1kola2		195	Formaldehyde dehydrogenase {Pseudomonas putida [Ta	98.83
d1p0fa2		174	Alcohol dehydrogenase {Frog (Rana perezi) [TaxId:	98.77
d1luaa1		191	Methylene-tetrahydromethanopterin dehydrogenase {M	98.75
d1jvba2		170	Alcohol dehydrogenase {Archaeon Sulfolobus solfata	98.73
d1e3ia2		174	Alcohol dehydrogenase {Mouse (Mus musculus), class	98.72
d1omoa_		320	Archaeal alanine dehydrogenase {Archaeon Archaeogl	98.72
d1llua2		166	Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax	98.68
d1f8fa2		174	Benzyl alcohol dehydrogenase {Acinetobacter calcoa	98.67
d1x7da_		340	Ornithine cyclodeaminase {Pseudomonas putida [TaxI	98.63
d1d1ta2		176	Alcohol dehydrogenase {Human (Homo sapiens), diffe	98.59
d1l7da1		183	Nicotinamide nucleotide transhydrogenase dI compon	98.52
d1e5qa1		182	Saccharopine reductase {Rice blast fungus (Magnapo	98.47
d1li4a1		163	S-adenosylhomocystein hydrolase {Human (Homo sapie	98.38
d2fzwa2		176	Alcohol dehydrogenase {Human (Homo sapiens), diffe	98.36
d1v8ba1		163	S-adenosylhomocystein hydrolase {Plasmodium falcip	98.32
d1rjwa2		168	Alcohol dehydrogenase {Bacillus stearothermophilus	98.3
d1vpda2		161	Hydroxyisobutyrate dehydrogenase {Salmonella typhi	98.3
d1yqga2		152	Pyrroline-5-carboxylate reductase ProC {Neisseria	98.29
d2jhfa2		176	Alcohol dehydrogenase {Horse (Equus caballus) [Tax	98.25
d2ahra2		152	Pyrroline-5-carboxylate reductase ProC {Streptococ	98.24
d1iz0a2		171	Quinone oxidoreductase {Thermus thermophilus [TaxI	98.24
d1cdoa2		175	Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI	98.23
d2f1ka2		165	Prephenate dehydrogenase TyrA {Synechocystis sp. p	98.19
d3cuma2		162	Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru	98.18
d2pgda2		176	6-phosphogluconate dehydrogenase {Sheep (Ovis orie	98.1
d2i76a2		153	Hypothetical protein TM1727 {Thermotoga maritima [	98.09
d1bg6a2		184	N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A	98.06
d1yb5a2		174	Quinone oxidoreductase {Human (Homo sapiens) [TaxI	98.0
d1pqwa_		183	Putative enoyl reductase domain of polyketide synt	97.94
d1qp8a1		181	Putative formate dehydrogenase {Archaeon Pyrobacul	97.92
d1mx3a1		193	Transcription corepressor CtbP {Human (Homo sapien	97.84
d1edza1		171	Methylenetetrahydrofolate dehydrogenase/cyclohydro	97.83
d1j4aa1		197	D-lactate dehydrogenase {Lactobacillus helveticus	97.82
d2g5ca2		171	Prephenate dehydrogenase TyrA {Aquifex aeolicus [T	97.8
d1f0ya2		192	Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum	97.76
d1cyda_		242	Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1	97.74
d1lssa_		132	Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax	97.73
d1i36a2		152	Conserved hypothetical protein MTH1747 {Archaeon M	97.72
d1pr9a_		244	Carbonyl reductase {Human (Homo sapiens) [TaxId: 9	97.71
d1n1ea2		189	Glycerol-3- phosphate dehydrogenase {Trypanosome (	97.7
d1gdha1		191	D-glycerate dehydrogenase {Hyphomicrobium methylov	97.68
d1ygya1		184	Phosphoglycerate dehydrogenase {Mycobacterium tube	97.68
d1ez4a1		146	Lactate dehydrogenase {Lactobacillus pentosus [Tax	97.67
d1xa0a2		176	B. subtilis YhfP homologue {Bacillus stearothermop	97.66
d1ldna1		148	Lactate dehydrogenase {Bacillus stearothermophilus	97.65
d2naca1		188	Formate dehydrogenase {Pseudomonas sp., strain 101	97.64
d1pjqa1		113	Siroheme synthase CysG, domain 1 {Salmonella typhi	97.63
d1pzga1		154	Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5	97.63
d1dxya1		199	D-2-hydroxyisocaproate dehydrogenase {Lactobacillu	97.6
d1t2da1		150	Lactate dehydrogenase {Malaria parasite (Plasmodiu	97.58
d1txga2		180	Glycerol-3- phosphate dehydrogenase {Archaeoglobus	97.56
d1sc6a1		188	Phosphoglycerate dehydrogenase {Escherichia coli [	97.54
d2hmva1		134	Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	97.53
d1pgja2		178	6-phosphogluconate dehydrogenase {Trypanosoma bruc	97.53
d1hyha1		146	L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La	97.52
d1hdca_		254	3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre	97.52
d2cvza2		156	Hydroxyisobutyrate dehydrogenase {Thermus thermoph	97.51
d1i0za1		160	Lactate dehydrogenase {Human (Homo sapiens), heart	97.5
d1nffa_		244	Putative oxidoreductase Rv2002 {Mycobacterium tube	97.48
d2jfga1		93	UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase	97.47
d1vj1a2		187	Putative zinc-binding alcohol dehydrogenase {Mouse	97.46
d1q7ba_		243	beta-keto acyl carrier protein reductase {Escheric	97.43
d1qora2		179	Quinone oxidoreductase {Escherichia coli [TaxId: 5	97.42
d1c1da1		201	Phenylalanine dehydrogenase {Rhodococcus sp., M4 [	97.41
d1ulsa_		242	beta-keto acyl carrier protein reductase {Thermus	97.39
d1llda1		143	Lactate dehydrogenase {Bifidobacterium longum, str	97.38
d1ydea1		250	Retinal dehydrogenase/reductase 3 {Human (Homo sap	97.36
d1hdoa_		205	Biliverdin IX beta reductase {Human (Homo sapiens)	97.36
d2ldxa1		159	Lactate dehydrogenase {Mouse (Mus musculus) [TaxId	97.35
d1ks9a2		167	Ketopantoate reductase PanE {Escherichia coli [Tax	97.33
d1uxja1		142	Malate dehydrogenase {Chloroflexus aurantiacus [Ta	97.33
d1k2wa_		256	Sorbitol dehydrogenase {Rhodobacter sphaeroides [T	97.33
d1yb1a_		244	17-beta-hydroxysteroid dehydrogenase type XI {Huma	97.32
d1a4ia1		170	Methylenetetrahydrofolate dehydrogenase/cyclohydro	97.31
d1hxha_		253	3beta/17beta hydroxysteroid dehydrogenase {Comamon	97.29
d1v3va2		182	Leukotriene b4 12-hydroxydehydrogenase/prostagland	97.29
d1wdka3		186	Fatty oxidation complex alpha subunit, middle doma	97.28
d1a5za1		140	Lactate dehydrogenase {Thermotoga maritima [TaxId:	97.28
d2a4ka1		241	beta-keto acyl carrier protein reductase {Thermus	97.26
d2bgka1		268	Rhizome secoisolariciresinol dehydrogenase {Mayapp	97.25
d1jaya_		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae	97.25
d2pv7a2		152	Prephenate dehydrogenase TyrA {Haemophilus influen	97.24
d1ojua1		142	Malate dehydrogenase {Archaeon Archaeoglobus fulgi	97.22
d1ae1a_		258	Tropinone reductase {Jimsonweed (Datura stramonium	97.22
d1bdba_		276	Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps	97.22
d1vl6a1		222	Malate oxidoreductase (malic enzyme) {Thermotoga m	97.21
d1y6ja1		142	Lactate dehydrogenase {Clostridium thermocellum [T	97.2
d1guza1		142	Malate dehydrogenase {Chlorobium vibrioforme [TaxI	97.19
d1tt7a2		167	Hypothetical protein YhfP {Bacillus subtilis [TaxI	97.19
d1mlda1		144	Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982	97.17
d1xeaa1		167	Putative oxidoreductase VCA1048 {Vibrio cholerae [	97.16
d1vl8a_		251	Gluconate 5-dehydrogenase {Thermotoga maritima [Ta	97.15
d1o5ia_		234	beta-keto acyl carrier protein reductase {Thermoto	97.12
d1zk4a1		251	R-specific alcohol dehydrogenase {Lactobacillus br	97.11
d2ag5a1		245	Dehydrogenase/reductase SDR family member 6, DHRS6	97.11
d1zema1		260	Xylitol dehydrogenase {Gluconobacter oxydans [TaxI	97.1
d1leha1		230	Leucine dehydrogenase {Bacillus sphaericus [TaxId:	97.1
d1w6ua_		294	2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H	97.07
d1b0aa1		166	Methylenetetrahydrofolate dehydrogenase/cyclohydro	97.07
d1fmca_		255	7-alpha-hydroxysteroid dehydrogenase {Escherichia	97.03
d2d1ya1		248	Hypothetical protein TTHA0369 {Thermus thermophilu	97.03
d1tlta1		164	Virulence factor MviM {Escherichia coli [TaxId: 56	97.03
d2ae2a_		259	Tropinone reductase {Jimsonweed (Datura stramonium	97.03
d1ps9a3		179	2,4-dienoyl-CoA reductase, middle domain {Escheric	97.02
d2c07a1		251	beta-keto acyl carrier protein reductase {Malaria	97.01
d1gu7a2		189	2,4-dienoyl-CoA reductase {Yeast (Candida tropical	96.99
d1xg5a_		257	Putative dehydrogenase ARPG836 (MGC4172) {Human (H	96.98
d1xkqa_		272	Hypothetical protein R05D8.7 {Caenorhabditis elega	96.97
d1o89a2		177	Hypothetical protein YhdH {Escherichia coli [TaxId	96.96
d1yxma1		297	Peroxisomal trans 2-enoyl CoA reductase {Human (Ho	96.95
d1xq1a_		259	Tropinone reductase {Thale cress (Arabidopsis thal	96.94
d1xhla_		274	Hypothetical protein F25D1.5 {Caenorhabditis elega	96.91
d1hyea1		145	MJ0490, lactate/malate dehydrogenase {Archaeon Met	96.91
d1ydwa1		184	Probable oxidoreductase At4g09670 {Thale cress (Ar	96.9
d2gdza1		254	15-hydroxyprostaglandin dehydrogenase, PGDH {Human	96.86
d1nvmb1		157	Acetaldehyde dehydrogenase (acylating) {Pseudomona	96.82
d2rhca1		257	beta-keto acyl carrier protein reductase {Streptom	96.82
d1h5qa_		260	Mannitol dehydrogenase {Mushroom (Agaricus bisporu	96.82
d1iy8a_		258	Levodione reductase {Corynebacterium aquaticum [Ta	96.82
d1spxa_		264	Glucose dehydrogenase (5l265) {Nematode (Caenorhab	96.81
d2q46a1		252	Hypothetical protein At5g02240 (T7H20_290) {Thale	96.73
d1np3a2		182	Class I ketol-acid reductoisomerase (KARI) {Pseudo	96.72
d1geea_		261	Glucose dehydrogenase {Bacillus megaterium [TaxId:	96.68
d1gtea4		196	Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su	96.67
d1mv8a2		202	GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos	96.66
d1h6da1		221	Glucose-fructose oxidoreductase, N-terminal domain	96.64
d1zh8a1		181	Hypothetical protein TM0312 {Thermotoga maritima [	96.63
d1gega_		255	meso-2,3-butanediol dehydrogenase {Klebsiella pneu	96.54
d1jw9b_		247	Molybdenum cofactor biosynthesis protein MoeB {Esc	96.53
d2ew8a1		247	(s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb	96.51
d2pd4a1		274	Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2	96.5
d2o23a1		248	Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho	96.48
d1v9la1		242	Glutamate dehydrogenase {Pyrobaculum islandicum [T	96.41
d1x1ta1		260	D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas	96.38
d1obba1		171	Alpha-glucosidase AglA {Thermotoga maritima [TaxId	96.37
d1g0oa_		272	1,3,8-trihydroxynaphtalene reductase (THNR, naphto	96.33
d2cmda1		145	Malate dehydrogenase {Escherichia coli [TaxId: 562	96.3
d1d7ya2		121	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	96.3
d1o6za1		142	Malate dehydrogenase {Archaeon Haloarcula marismor	96.3
d1xu9a_		269	11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom	96.29
d1o8ca2		77	Hypothetical protein YhdH {Escherichia coli [TaxId	96.24
d1id1a_		153	Rck domain from putative potassium channel Kch {Es	96.23
d1vjta1		193	Putative alpha-glucosidase TM0752 {Thermotoga mari	96.22
d1ja9a_		259	1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl	96.22
d1u8xx1		167	Maltose-6'-phosphate glucosidase GlvA {Bacillus su	96.19
d2bkaa1		232	TAT-interacting protein TIP30 {Human (Homo sapiens	96.18
d1f06a1		170	Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb	96.15
d1yo6a1		250	Putative carbonyl reductase sniffer {Caenorhabditi	96.1
d1up7a1		162	6-phospho-beta-glucosidase {Thermotoga maritima [T	96.07
d1sbya1		254	Drosophila alcohol dehydrogenase {Fly (Drosophila	96.06
d2h7ma1		268	Enoyl-ACP reductase {Mycobacterium tuberculosis, T	96.04
d1yovb1		426	UBA3 {Human (Homo sapiens) [TaxId: 9606]}	95.98
d1gz6a_		302	(3R)-hydroxyacyl-CoA dehydrogenase domain of estra	95.95
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	95.95
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	95.92
d1ulua_		256	Enoyl-ACP reductase {Thermus thermophilus [TaxId:	95.9
d1wmaa1		275	Carbonyl reductase/20beta-hydroxysteroid dehydroge	95.89
d1xhca2		122	NADH oxidase /nitrite reductase {Pyrococcus furios	95.79
d1rjwa1		171	Alcohol dehydrogenase {Bacillus stearothermophilus	95.79
d1uzma1		237	beta-keto acyl carrier protein reductase {Mycobact	95.78
d1b7go1		178	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	95.77
d2bd0a1		240	Bacterial sepiapterin reductase {Chlorobium tepidu	95.74
d1pl8a1		185	Ketose reductase (sorbitol dehydrogenase) {Human (	95.71
d1y7ta1		154	Malate dehydrogenase {Thermus thermophilus [TaxId:	95.65
d1lvla2		115	Dihydrolipoamide dehydrogenase {Pseudomonas putida	95.65
d2czca2		172	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	95.64
d1b5qa1		347	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	95.56
d1y1pa1		342	Aldehyde reductase II {Sporobolomyces salmonicolor	95.43
d1dlja2		196	UDP-glucose dehydrogenase (UDPGDH) {Streptococcus	95.27
d2voua1		265	Dihydroxypyridine hydroxylase DhpH {Arthrobacter n	95.18
d1c0pa1		268	D-aminoacid oxidase, N-terminal domain {Rhodotorul	95.15
d1fcda1		186	Flavocytochrome c sulfide dehydrogenase, FCSD, fla	95.15
d1qmga2		226	Class II ketol-acid reductoisomerase (KARI) {Spina	95.08
d1p3da1		96	UDP-N-acetylmuramate-alanine ligase MurC {Haemophi	95.04
d5mdha1		154	Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982	95.02
d1b26a1		234	Glutamate dehydrogenase {Thermotoga maritima [TaxI	94.99
d1s6ya1		169	6-phospho-beta-glucosidase {Bacillus stearothermop	94.97
d2nvwa1		237	Galactose/lactose metabolism regulatory protein GA	94.92
d1j5pa4		132	Hypothetical protein TM1643 {Thermotoga maritima [	94.85
d1e3ja1		178	Ketose reductase (sorbitol dehydrogenase) {Silverl	94.82
d1j6ua1		89	UDP-N-acetylmuramate-alanine ligase MurC {Thermoto	94.81
d1gq2a1		298	Mitochondrial NAD(P)-dependent malic enzyme {Domes	94.8
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	94.8
d1kyqa1		150	Bifunctional dehydrogenase/ferrochelatase Met8p, N	94.8
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	94.68
d1cf2o1		171	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	94.68
d3c96a1		288	Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId:	94.63
d1oaaa_		259	Sepiapterin reductase {Mouse (Mus musculus) [TaxId	94.51
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	94.42
d1xgka_		350	Negative transcriptional regulator NmrA {Aspergill	94.33
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	94.32
d7mdha1		175	Malate dehydrogenase {Sorghum (Sorghum vulgare), c	94.24
d1h2ba1		171	Alcohol dehydrogenase {Archaeon Aeropyrum pernix [	94.16
d2ivda1		347	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	94.15
d1rkxa_		356	CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc	94.07
d1djqa3		233	Trimethylamine dehydrogenase, middle domain {Methy	94.03
d1onfa2		117	Glutathione reductase {Plasmodium falciparum [TaxI	94.02
d1pj5a2		305	N,N-dimethylglycine oxidase {Arthrobacter globifor	94.01
d1h6va2		122	Mammalian thioredoxin reductase {Rat (Rattus norve	93.75
d1bgva1		255	Glutamate dehydrogenase {Clostridium symbiosum [Ta	93.73
d1pj3a1		294	Mitochondrial NAD(P)-dependent malic enzyme {Human	93.73
d1mo9a2		121	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	93.73
d1zmta1		252	Halohydrin dehalogenase HheC {Agrobacterium tumefa	93.71
d1yova1		529	Amyloid beta precursor protein-binding protein 1,	93.68
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	93.68
d2fr1a1		259	Erythromycin synthase, eryAI, 1st ketoreductase mo	93.65
d1k0ia1		292	p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a	93.64
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	93.64
d1d7oa_		297	Enoyl-ACP reductase {Oil seed rape (Brassica napus	93.58
d1qyda_		312	Pinoresinol-lariciresinol reductase {Giant arborvi	93.57
d2gv8a1		335	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	93.46
d1edoa_		244	beta-keto acyl carrier protein reductase {Oil seed	93.46
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	93.45
d1o0sa1		308	Mitochondrial NAD(P)-dependent malic enzyme {Pig r	93.44
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	93.44
d2b69a1		312	UDP-glucuronate decarboxylase 1 {Human (Homo sapie	93.44
d1gtma1		239	Glutamate dehydrogenase {Archaeon Pyrococcus furio	93.43
d1snya_		248	Carbonyl reductase sniffer {Fruit fly (Drosophila	93.22
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	93.21
d1lqta2		239	Ferredoxin:NADP reductase FprA {Mycobacterium tube	93.16
d1mxha_		266	Dihydropteridin reductase (pteridine reductase) {T	93.13
d1qsga_		258	Enoyl-ACP reductase {Escherichia coli [TaxId: 562]	93.11
d2bi7a1		314	UDP-galactopyranose mutase, N-terminal domain {Kle	93.1
d2fy8a1		129	Potassium channel-related protein MthK {Archaeon M	92.93
d1t4ba1		146	Aspartate beta-semialdehyde dehydrogenase {Escheri	92.86
d1cjca2		230	Adrenodoxin reductase of mitochondrial p450 system	92.81
d2bcgg1		297	Guanine nucleotide dissociation inhibitor, GDI {Ba	92.79
d2dw4a2		449	Lysine-specific histone demethylase 1, LSD1 {Human	92.74
d1gtea3		153	Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su	92.67
d1hwxa1		293	Glutamate dehydrogenase {Cow (Bos taurus) [TaxId:	92.63
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	92.62
d1d5ta1		336	Guanine nucleotide dissociation inhibitor, GDI {Co	92.61
d1e7wa_		284	Dihydropteridin reductase (pteridine reductase) {L	92.58
d1ojta2		125	Dihydrolipoamide dehydrogenase {Neisseria meningit	92.54
d1kjqa2		111	Glycinamide ribonucleotide transformylase PurT, N-	92.44
d1qyca_		307	Phenylcoumaran benzylic ether reductase {Loblolly	92.22
d1udca_		338	Uridine diphosphogalactose-4-epimerase (UDP-galact	92.17
d1lqta1		216	Ferredoxin:NADP reductase FprA {Mycobacterium tube	92.11
d1uaya_		241	Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t	91.93
d1cjca1		225	Adrenodoxin reductase of mitochondrial p450 system	91.88
d1vkna1		176	N-acetyl-gamma-glutamyl-phosphate reductase ArgC {	91.86
d1dhra_		236	Dihydropteridin reductase (pteridine reductase) {R	91.86
d1m6ia2		137	Apoptosis-inducing factor (AIF) {Human (Homo sapie	91.75
d2blla1		342	Polymyxin resistance protein ArnA (PrmI) {Escheric	91.67
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	91.65
d2a35a1		212	Hypothetical protein PA4017 {Pseudomonas aeruginos	91.42
d2gqfa1		253	Hypothetical protein HI0933 {Haemophilus influenza	91.3
d1vl0a_		281	DTDP-4-dehydrorhamnose reductase RfbD {Clostridium	91.29
d2c5aa1		363	GDP-mannose-3', 5'-epimerase {Thale cress (Arabido	91.26
d3etja2		78	N5-carboxyaminoimidazole ribonucleotide synthetase	91.22
d1w4xa1		298	Phenylacetone monooxygenase {Thermobifida fusca [T	90.93
d2v5za1		383	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	90.84
d1db3a_		357	GDP-mannose 4,6-dehydratase {Escherichia coli [Tax	90.83
d1dxla1		221	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	90.56
d1vlva2		161	Ornithine transcarbamoylase {Thermotoga maritima [	90.54
d1i24a_		393	Sulfolipid biosynthesis protein SQD1 {Thale cress	90.41
d1ooea_		235	Dihydropteridin reductase (pteridine reductase) {N	90.39
d1q1ra1		185	Putidaredoxin reductase {Pseudomonas putida [TaxId	90.34
d1f8fa1		194	Benzyl alcohol dehydrogenase {Acinetobacter calcoa	90.32
d1i8ta1		298	UDP-galactopyranose mutase, N-terminal domain {Esc	90.27
d2gf3a1		281	Sarcosine oxidase {Bacillus sp., strain b0618 [Tax	90.19
d1vm6a3		128	Dihydrodipicolinate reductase {Thermotoga maritima	90.14
d1trba1		190	Thioredoxin reductase {Escherichia coli [TaxId: 56	90.13
d1jvba1		177	Alcohol dehydrogenase {Archaeon Sulfolobus solfata	90.06
d1gesa1		217	Glutathione reductase {Escherichia coli [TaxId: 56	90.01
d2cvoa1		183	Putative semialdehyde dehydrogenase {Rice (Oryza s	89.98
d1aoga2		117	Trypanothione reductase {Trypanosoma cruzi [TaxId:	89.93
d1llua1		175	Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax	89.84
d1ml4a2		157	Aspartate carbamoyltransferase catalytic subunit {	89.71
d2dt5a2		126	Transcriptional repressor Rex, C-terminal domain {	89.69
d1v59a1		233	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	89.54
d1ojta1		229	Dihydrolipoamide dehydrogenase {Neisseria meningit	89.34
d1fl2a1		184	Alkyl hydroperoxide reductase subunit F (AhpF), C-	89.26
d1kifa1		246	D-aminoacid oxidase, N-terminal domain {Pig (Sus s	89.2
d1ne2a_		197	Hypothetical protein Ta1320 {Archaeon Thermoplasma	89.17
d1vdca1		192	Thioredoxin reductase {Mouse-ear cress (Arabidopsi	89.05
d1ebda1		223	Dihydrolipoamide dehydrogenase {Bacillus stearothe	89.02
d1lvla1		220	Dihydrolipoamide dehydrogenase {Pseudomonas putida	88.94
d1orra_		338	CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId:	88.78
d3lada1		229	Dihydrolipoamide dehydrogenase {Azotobacter vinela	88.71
d1z45a2		347	Uridine diphosphogalactose-4-epimerase (UDP-galact	88.63
d1mb4a1		147	Aspartate beta-semialdehyde dehydrogenase {Vibrio	88.54
d1pn0a1		360	Phenol hydroxylase {Soil-living yeast (Trichosporo	88.48
d1h6va1		235	Mammalian thioredoxin reductase {Rat (Rattus norve	88.39
d1nhpa1		198	NADH peroxidase {Enterococcus faecalis [TaxId: 135	88.05
d1jtva_		285	Human estrogenic 17beta-hydroxysteroid dehydrogena	88.05
d1fjha_		257	3-alpha-hydroxysteroid dehydrogenase {Comamonas te	87.88
d1rp0a1		278	Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara	87.72
d1mv8a3		136	GDP-mannose 6-dehydrogenase, GDP-binding domain {P	87.52
d1y0pa2		308	Flavocytochrome c3 (respiratory fumarate reductase	87.43
d1wy7a1		201	Hypothetical protein PH1948 {Archaeon Pyrococcus h	87.38
d3grsa1		221	Glutathione reductase {Human (Homo sapiens) [TaxId	87.23
d2gv8a2		107	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	87.13
d2ax3a2		211	Hypothetical protein TM0922, N-terminal domain {Th	86.72
d1aoga1		238	Trypanothione reductase {Trypanosoma cruzi [TaxId:	86.53
d2gmha1		380	Electron transfer flavoprotein-ubiquinone oxidored	86.48
d1tuga1		310	Aspartate carbamoyltransferase catalytic subunit {	86.45
d1rpna_		321	GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos	86.39
d1pvva2		163	Ornithine transcarbamoylase {Archaeon Pyrococcus f	86.13
d1diha1		162	Dihydrodipicolinate reductase {Escherichia coli [T	86.09
d1ekxa2		160	Aspartate carbamoyltransferase catalytic subunit {	86.05
d2hjsa1		144	Usg-1 protein homolog PA3116 {Pseudomonas aerugino	85.8
d1dxha2		185	Ornithine transcarbamoylase {Pseudomonas aeruginos	85.79
d1dssg1		169	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	85.59
d1d4ca2		322	Flavocytochrome c3 (respiratory fumarate reductase	85.13
d1onfa1		259	Glutathione reductase {Plasmodium falciparum [TaxI	84.69
d1xhca1		167	NADH oxidase /nitrite reductase {Pyrococcus furios	84.68
d2bs2a2		336	Fumarate reductase {Wolinella succinogenes [TaxId:	84.51
d2g17a1		179	N-acetyl-gamma-glutamyl-phosphate reductase ArgC {	84.49
d2gz1a1		154	Aspartate beta-semialdehyde dehydrogenase {Strepto	84.19
d2csua1		129	Acetate-CoA ligase alpha chain, AcdA, N-terminal d	84.1
d1u8fo1		169	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	83.98
d1djqa2		156	Trimethylamine dehydrogenase, C-terminal domain {M	83.96
d1w4xa2		235	Phenylacetone monooxygenase {Thermobifida fusca [T	83.88
d1qo8a2		317	Flavocytochrome c3 (respiratory fumarate reductase	83.75
d2gjca1		311	Thiazole biosynthetic enzyme Thi4 {Baker's yeast (	82.91
d1feca1		240	Trypanothione reductase {Crithidia fasciculata [Ta	82.87
d1obfo1		173	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	82.74
d1lc0a1		172	Biliverdin reductase {Rat (Rattus norvegicus) [Tax	82.15
d1n2sa_		298	dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S	82.12
d1y81a1		116	Hypothetical protein PF0725 {Pyrococcus furiosus [	81.95
d2fyta1		311	Protein arginine N-methyltransferase 3, PRMT3 {Hum	81.58
d1vj0a1		184	Hypothetical protein TM0436 {Thermotoga maritima [	81.44
d1n7ha_		339	GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop	81.3
d2g82a1		168	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {	80.93
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	80.92
d1a9xa3		127	Carbamoyl phosphate synthetase (CPS), large subuni	80.9
d1duvg2		183	Ornithine transcarbamoylase {Escherichia coli [Tax	80.69
d1fl2a2		126	Alkyl hydroperoxide reductase subunit F (AhpF), C-	80.59
d1xdia1		233	Dihydrolipoamide dehydrogenase {Mycobacterium tube	80.57

>d1gpja3 d.58.39.1 (A:1-143) Glutamyl tRNA-reductase catalytic, N-terminal domain {Archaeon Methanopyrus kandleri [TaxId: 2320]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Glutamyl tRNA-reductase catalytic, N-terminal domain
family: Glutamyl tRNA-reductase catalytic, N-terminal domain
domain: Glutamyl tRNA-reductase catalytic, N-terminal domain
species: Archaeon Methanopyrus kandleri [TaxId: 2320]

Probab=100.00  E-value=1.7e-41  Score=304.92  Aligned_cols=142  Identities=28%  Similarity=0.468  Sum_probs=125.3

Q ss_pred             ceEEEEEeecCCCCHHHHhhhcCCCCChHHHHHHHhccCCCcceEEeeecCeeEEEEEeccccccHHHHHHHHHHhcCCC
Q 010322           63 SSIVVIGLSVHTAPVEMREKLAIPEAEWPRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSQHRGVKEVTEWMSKTSGIP  142 (513)
Q Consensus        63 ~~i~~igi~hk~apv~~RE~~a~~~~~~~~~l~~l~~~~~i~e~viLsTCNR~EiY~~~~~~~~~~~~~~~~l~~~~~~~  142 (513)
                      ++|.+||+|||++|+++||+|+|++++.   +..|.+.+++.|++|||||||||||+++...  ..    +++.+.    
T Consensus         2 ~~l~~igi~h~~a~~~~re~~~~~~~~~---~~~l~~~~~~~e~vvLsTCNRtEiY~~~~~~--~~----~~~~~~----   68 (143)
T d1gpja3           2 EDLVSVGITHKEAEVEELEKARFESDEA---VRDIVESFGLSGSVLLQTSNRVEVYASGARD--RA----EELGDL----   68 (143)
T ss_dssp             TTEEEEEEETTTSCHHHHHHHSCCCTTH---HHHHHHHHTCSEEEEEEETTEEEEEEESCTT--CH----HHHHHT----
T ss_pred             CcEEEEEEECCcCCHHHHHHhcCChHHH---HHHHHhccCCceEEEEEecCCeEEEEeccch--hH----HHHhhc----
Confidence            3689999999999999999999998764   4566667789999999999999999986532  22    233322    


Q ss_pred             hhhhhhHHHHhcCCceeeeeeeeccCCCCcccCcchhhchHHHHHHHhHhcCcccchhhHHHHHHHhhCccccccccc
Q 010322          143 VAELCEHRFLLYNKDATQHLFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVVGFGRNISGLFKHAISVGKRVRTETNI  220 (513)
Q Consensus       143 ~~~~~~~~~~~~G~eav~hlf~V~sGldS~vvGE~qIlgQvk~A~~~a~~~~~~g~~L~~lf~~ai~v~k~Vr~et~i  220 (513)
                         +.+++|.+.|.+|+.|||+|+|||||||+||+||+||||+||+.|++.|++|+.|+.+|+.|++++|+||++|+|
T Consensus        69 ---~~~~~~~~~g~~A~~HLfrVasGLdS~VvGE~qIlgQvK~A~~~a~~~g~~~~~L~~lf~~a~~~aKrVRteT~I  143 (143)
T d1gpja3          69 ---IHDDAWVKRGSEAVRHLFRVASGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKIVFRRAINLGKRAREETRI  143 (143)
T ss_dssp             ---TCTTCEEEEHHHHHHHHHHHHTTTTSSSTTCHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHSST
T ss_pred             ---cccceeeecHHHHHHHHHHHHHhhHhHhhCcHHHHHHHHHHHHHHHHcCCchHHHHHHHHHHHHHHHHHhcccCC
Confidence               346788999999999999999999999999999999999999999999999999999999999999999999986

PyMOL of d1gpja3

>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]}	Back information, alignment and structure

>d1gpja1 a.151.1.1 (A:303-404) Glutamyl tRNA-reductase dimerization domain {Archaeon Methanopyrus kandleri [TaxId: 2320]}	Back information, alignment and structure

>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}	Back information, alignment and structure

>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}	Back information, alignment and structure

>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}	Back information, alignment and structure

>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]}	Back information, alignment and structure

>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}	Back information, alignment and structure

>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}	Back information, alignment and structure

>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}	Back information, alignment and structure

>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}	Back information, alignment and structure

>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]}	Back information, alignment and structure

>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}	Back information, alignment and structure

>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}	Back information, alignment and structure

>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]}	Back information, alignment and structure

>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]}	Back information, alignment and structure

>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]}	Back information, alignment and structure

>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]}	Back information, alignment and structure

>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}	Back information, alignment and structure

>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}	Back information, alignment and structure

>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]}	Back information, alignment and structure

>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]}	Back information, alignment and structure

>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]}	Back information, alignment and structure

>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}	Back information, alignment and structure

>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]}	Back information, alignment and structure

>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}	Back information, alignment and structure

>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}	Back information, alignment and structure

>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}	Back information, alignment and structure

>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}	Back information, alignment and structure

>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}	Back information, alignment and structure

>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}	Back information, alignment and structure

>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]}	Back information, alignment and structure

>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]}	Back information, alignment and structure

>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]}	Back information, alignment and structure

>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]}	Back information, alignment and structure

>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]}	Back information, alignment and structure

>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]}	Back information, alignment and structure

>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}	Back information, alignment and structure

>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]}	Back information, alignment and structure

>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]}	Back information, alignment and structure

>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]}	Back information, alignment and structure

>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]}	Back information, alignment and structure

>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}	Back information, alignment and structure

>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]}	Back information, alignment and structure

>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]}	Back information, alignment and structure

>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]}	Back information, alignment and structure

>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]}	Back information, alignment and structure

>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}	Back information, alignment and structure

>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]}	Back information, alignment and structure

>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]}	Back information, alignment and structure

>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]}	Back information, alignment and structure

>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]}	Back information, alignment and structure

>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}	Back information, alignment and structure

>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}	Back information, alignment and structure

>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}	Back information, alignment and structure

>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]}	Back information, alignment and structure

>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]}	Back information, alignment and structure

>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]}	Back information, alignment and structure

>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]}	Back information, alignment and structure

>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}	Back information, alignment and structure

>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]}	Back information, alignment and structure

>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]}	Back information, alignment and structure

>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]}	Back information, alignment and structure

>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}	Back information, alignment and structure

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]}	Back information, alignment and structure

>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]}	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]}	Back information, alignment and structure

>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]}	Back information, alignment and structure

>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}	Back information, alignment and structure

>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]}	Back information, alignment and structure

>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}	Back information, alignment and structure

>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}	Back information, alignment and structure

>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}	Back information, alignment and structure

>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]}	Back information, alignment and structure

>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]}	Back information, alignment and structure

>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure