Citrus Sinensis ID: 010380

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510--
MTPATLTKPHISLQTLHYYCFKDQQRGPCLRPASYRSGLGAYKRRYGLHMQPCRSFKTDDKGENEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIGTMVGANMVLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSTGSNTFPGT
ccccccccEEEccccccHHHcccccccccccccccccccccccccccEEEEEcccccccccccccHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHHcccHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccc
ccccEEEEEEEcccccccHHHHHHHccccccccccccccEEEccccEEEEEEcccccccccccccccccccccccccHHHHcccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEcccccHHHHHHHHHHHHHHHEEHHHHcHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEcccccccccccEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEHHccccccHcHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccEEcccHHHccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHccHHHcccEEEEccccHEcHHHHHHHHHHHHHcccccHHHHHHHcccccEEEEEEHHHHHHHEEEccccccccccc
mtpatltkphislqtlhyycfkdqqrgpclrpasyrsglgaykrryglhmqpcrsfktddkgenEAESELKLKKTSGFWSSLKDVIFrvngpgsqssdEYCKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGfqlsggdsqmNALIWYSWLGGIIIGTMVGANMVLEehckagprnvvitgstrgLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGmmaaggsskknLVHAKVAGiacdvcepadvqklsnfavnefgsidiwinnagtnkgfkpllqFTNEEIEQIVSTNLVGSILCTREAMRVmrdqpkgghifnmdgagsggsstpltavygstkcgLRQLQASLFkeskrskvgvhtaspgmVLTDLLLSGSTIQNKQMFNIICELPETVARTLVprirvvkgsgkainyltpPRILLALVTAWLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILsstgsntfpgt
mtpatltkphislQTLHYYCFKDQQRGPCLRPASYRSGLGAYKRRYGLHMQPcrsfktddkgeNEAESELklkktsgfwsSLKDVIFRVngpgsqssDEYCKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIGTMVGANMVLEEHCKAGPRNVVITGSTRGLGKALAREfllsgdrvvvasrssesvrmTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLfkeskrskvgvhtaspgmVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRVVkgsgkainyltpprILLALVTAWLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIlsstgsntfpgt
MTPATLTKPHISLQTLHYYCFKDQQRGPCLRPASYRSGLGAYKRRYGLHMQPCRSFKTDDKGENEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIGTMVGANMVLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDrvvvasrssesvrMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSTGSNTFPGT
*********HISLQTLHYYCFKDQQRGPCLRPASYRSGLGAYKRRYGLHMQP************************GFWSSLKDVIFRVNG******DEYCKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIGTMVGANMVLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVVA*******************************NLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVM********IF*************LTAVYGSTKCGLRQLQASLF*******VGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILS**********
****TLTKPHISLQTLHYYC****************SGLGAYKRRYGLHMQP*****************************LKDVIF***************AVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIGTMVGANMVL*EHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAA********************MEMYTENTWVSVFSLSVVCAFIILSST********
MTPATLTKPHISLQTLHYYCFKDQQRGPCLRPASYRSGLGAYKRRYGLHMQPCRSFKT************KLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIGTMVGANMVLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKE********HTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSTGSNTFPGT
*TPATLTKPHISLQTLHYYCFKDQQRGPCLRPASYRSGLGAYKRRYGLHMQPCRSFK********************************N*PGSQSSDEYCKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIGTMVGANMVLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSS*********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPATLTKPHISLQTLHYYCFKDQQRGPCLRPASYRSGLGAYKRRYGLHMQPCRSFKTDDKGENEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIGTMVGANMVLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSTGSNTFPGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query512 2.2.26 [Sep-21-2011]
Q5N800504 Probable chlorophyll(ide) yes no 0.921 0.936 0.722 0.0
Q93ZA0496 Probable chlorophyll(ide) yes no 0.958 0.989 0.698 0.0
Q84ST4343 Chlorophyll(ide) b reduct no no 0.441 0.658 0.471 1e-54
Q8LEU3348 Chlorophyll(ide) b reduct no no 0.447 0.658 0.464 9e-53
P39483261 Glucose 1-dehydrogenase 2 no no 0.361 0.708 0.307 5e-16
Q08632271 Short-chain type dehydrog N/A no 0.388 0.734 0.288 2e-15
P07999262 Glucose 1-dehydrogenase B no no 0.367 0.717 0.299 2e-15
Q59787256 Sorbitol dehydrogenase OS yes no 0.351 0.703 0.272 3e-14
Q6NUE2236 Carbonyl reductase family N/A no 0.347 0.754 0.297 3e-14
O31680248 Uncharacterized oxidoredu yes no 0.345 0.713 0.278 5e-14
>sp|Q5N800|NYC1_ORYSJ Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Oryza sativa subsp. japonica GN=NYC1 PE=1 SV=1 Back     alignment and function desciption
 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/493 (72%), Positives = 407/493 (82%), Gaps = 21/493 (4%)

Query: 40  GAYKRRYGLHMQP--------CRSFKTD-DKGENEAESELKLKKTS-------GFWSSLK 83
           G  +R   LH +P        CR+FK + D G  EA S      T+       G    LK
Sbjct: 13  GRLRRSPELHARPYHRPSLLRCRAFKQEADNGGEEASSSPPPPTTAEARRRRKGPLYKLK 72

Query: 84  DVIFRVNGPGSQSSD----EYCKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLS 139
             I  + G  S +++    EY +AV K E++F S+A Q+GR ++TMMS+GVVL VGFQLS
Sbjct: 73  AAIQGLAGSRSAAAEAYGGEYQRAVEKAEEIFFSVATQVGRYVITMMSSGVVLGVGFQLS 132

Query: 140 GGDSQMNALIWYSWLGGIIIGTMVGANMVLEEHCKAGPRNVVITGSTRGLGKALAREFLL 199
           GGDSQMN LIWYSWLGG+IIGTM+GAN VLEEHCKAGPRNVVITGSTRGLGKALAREFLL
Sbjct: 133 GGDSQMNTLIWYSWLGGVIIGTMIGANSVLEEHCKAGPRNVVITGSTRGLGKALAREFLL 192

Query: 200 SGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDVCEPADVQ 259
           SGDRVV+ASRS ESV  T+ ELEEN++EG+  A    ++ L+HAKV G +CDVC+P DV+
Sbjct: 193 SGDRVVIASRSPESVLQTINELEENIQEGLSVAKKKQREILLHAKVVGTSCDVCKPEDVK 252

Query: 260 KLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMR 319
           KL NFA +E GSIDIWINNAGTNKGF+PL+ F++E+I QIVSTNLVGS+LCTREAM VM+
Sbjct: 253 KLVNFAKDELGSIDIWINNAGTNKGFRPLVNFSDEDISQIVSTNLVGSLLCTREAMNVMQ 312

Query: 320 DQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMV 379
            Q KGGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ QASL KES+RSKVGVHTASPGMV
Sbjct: 313 HQQKGGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMV 372

Query: 380 LTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTA 439
           LTDLLLSGS+++NKQMFN+ICELPETVARTLVPR+RVVKGSGKAINYLTPPRILLALVTA
Sbjct: 373 LTDLLLSGSSLRNKQMFNLICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTA 432

Query: 440 WLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFI 499
           W+RRGRWFD++GRA+YAAEADRIRNWAE+RARFSFTDAMEMYTENTWVSVFSLSVVCAFI
Sbjct: 433 WVRRGRWFDEEGRAVYAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFI 492

Query: 500 ILSSTGSNTFPGT 512
           ILSS+G    PGT
Sbjct: 493 ILSSSG-GPLPGT 504
Required for proper chloroplast degradation. Involved in chlorophyll b degradation.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 9EC: 4
>sp|Q93ZA0|NYC1_ARATH Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Arabidopsis thaliana GN=NYC1 PE=1 SV=1 Back     alignment and function description
>sp|Q84ST4|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1 Back     alignment and function description
>sp|Q8LEU3|NOL_ARATH Chlorophyll(ide) b reductase NOL, chloroplastic OS=Arabidopsis thaliana GN=NOL PE=2 SV=1 Back     alignment and function description
>sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 Back     alignment and function description
>sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 Back     alignment and function description
>sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 Back     alignment and function description
>sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 Back     alignment and function description
>sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 Back     alignment and function description
>sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
356520529514 PREDICTED: probable chlorophyll(ide) b r 0.988 0.984 0.759 0.0
255546477517 short-chain dehydrogenase, putative [Ric 0.978 0.969 0.778 0.0
356531269515 PREDICTED: probable chlorophyll(ide) b r 0.990 0.984 0.744 0.0
225445234517 PREDICTED: probable chlorophyll(ide) b r 0.982 0.972 0.756 0.0
449506622521 PREDICTED: probable chlorophyll(ide) b r 0.988 0.971 0.737 0.0
449464672521 PREDICTED: probable chlorophyll(ide) b r 0.988 0.971 0.735 0.0
357500769514 Oxidoreductase [Medicago truncatula] gi| 0.908 0.904 0.769 0.0
224142147436 predicted protein [Populus trichocarpa] 0.851 1.0 0.856 0.0
357128420496 PREDICTED: probable chlorophyll(ide) b r 0.896 0.925 0.752 0.0
115435420504 Os01g0227100 [Oryza sativa Japonica Grou 0.921 0.936 0.722 0.0
>gi|356520529|ref|XP_003528914.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/516 (75%), Positives = 441/516 (85%), Gaps = 10/516 (1%)

Query: 4   ATLTKPHISLQTLHYYCFKDQQRGPCLRPASYRSGLGAYKRRYGLHMQPCRSFKTDDKGE 63
           AT+ K H+  + L+    +  +RG    P+    G G Y  R+ + +  CR+F+T+D G+
Sbjct: 2   ATVVKLHVVPECLNQQKTRSLRRGFGSCPSPGVLGFGHYCDRFSVKV--CRAFRTEDGGD 59

Query: 64  -------NEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAKVEKVFSSIAI 116
                  N  ++E K K+ SGFWSSLK ++ R    GS+S DEY +AVAKVE + SSIAI
Sbjct: 60  VKEKKLRNLKKNEEKTKRESGFWSSLKSILLRNFMVGSKSDDEYRQAVAKVEGLLSSIAI 119

Query: 117 QIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIGTMVGANMVLEEHCKAG 176
           QIGR IVTMMSTGV+L++GFQ+SGGDSQM+ALIWYSWLGG+IIGTM+GANMVLEEHC+AG
Sbjct: 120 QIGRYIVTMMSTGVILSIGFQMSGGDSQMDALIWYSWLGGVIIGTMIGANMVLEEHCRAG 179

Query: 177 PRNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSS 236
           PRNVVITGSTRGLGKALAREFLLSGDRV+V SRS ESV+ T+ ELEENLKEG+  A GSS
Sbjct: 180 PRNVVITGSTRGLGKALAREFLLSGDRVIVTSRSPESVQATIKELEENLKEGIANAVGSS 239

Query: 237 KKNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEI 296
              L HAKV GIACDVCEP DVQ+L+NFAV E G IDIWINNAGTNKGF+PLLQF++E+I
Sbjct: 240 LTKLSHAKVVGIACDVCEPHDVQRLANFAVKELGHIDIWINNAGTNKGFRPLLQFSDEDI 299

Query: 297 EQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQL 356
           +QIVSTNLVGSILCTREAMRVMR+Q   GHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQL
Sbjct: 300 KQIVSTNLVGSILCTREAMRVMRNQAIAGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQL 359

Query: 357 QASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPRIRV 416
           Q SL KE KRSKVGVHTASPGMVLTDLLLSGST+QN+QMFNIICELPETVARTLVPR+RV
Sbjct: 360 QGSLLKECKRSKVGVHTASPGMVLTDLLLSGSTVQNRQMFNIICELPETVARTLVPRMRV 419

Query: 417 VKGSGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEADRIRNWAENRARFSFTD 476
           VKG+GKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEADR+RNWAE+RARFSFTD
Sbjct: 420 VKGTGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEADRLRNWAEDRARFSFTD 479

Query: 477 AMEMYTENTWVSVFSLSVVCAFIILSSTGSNTFPGT 512
           AMEMYTENTW+SVFSLSVVCAFIILSSTGSN  PGT
Sbjct: 480 AMEMYTENTWLSVFSLSVVCAFIILSSTGSN-LPGT 514

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546477|ref|XP_002514298.1| short-chain dehydrogenase, putative [Ricinus communis] gi|223546754|gb|EEF48252.1| short-chain dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356531269|ref|XP_003534200.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225445234|ref|XP_002280953.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic [Vitis vinifera] gi|297738824|emb|CBI28069.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449506622|ref|XP_004162801.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449464672|ref|XP_004150053.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357500769|ref|XP_003620673.1| Oxidoreductase [Medicago truncatula] gi|355495688|gb|AES76891.1| Oxidoreductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224142147|ref|XP_002324420.1| predicted protein [Populus trichocarpa] gi|222865854|gb|EEF02985.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357128420|ref|XP_003565871.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|115435420|ref|NP_001042468.1| Os01g0227100 [Oryza sativa Japonica Group] gi|75285786|sp|Q5N800.1|NYC1_ORYSJ RecName: Full=Probable chlorophyll(ide) b reductase NYC1, chloroplastic; AltName: Full=Protein NON-YELLOW COLORING 1; Short=OsNYC1; Flags: Precursor gi|56784128|dbj|BAD81513.1| unknown protein [Oryza sativa Japonica Group] gi|56784368|dbj|BAD82407.1| unknown protein [Oryza sativa Japonica Group] gi|113531999|dbj|BAF04382.1| Os01g0227100 [Oryza sativa Japonica Group] gi|134254413|dbj|BAF49740.1| short-chain dehydrogenase/reductase NYC1 [Oryza sativa Japonica Group] gi|215687172|dbj|BAG90942.1| unnamed protein product [Oryza sativa Japonica Group] gi|222618022|gb|EEE54154.1| hypothetical protein OsJ_00960 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
UNIPROTKB|Q5N800504 NYC1 "Probable chlorophyll(ide 0.896 0.910 0.720 3.5e-178
TAIR|locus:2119330496 NYC1 "NON-YELLOW COLORING 1" [ 0.962 0.993 0.683 7.5e-176
UNIPROTKB|Q84ST4343 NOL "Chlorophyll(ide) b reduct 0.482 0.720 0.423 1.3e-45
TAIR|locus:2175254348 NOL "NYC1-like" [Arabidopsis t 0.445 0.655 0.438 5e-44
TIGR_CMR|CHY_1306249 CHY_1306 "oxidoreductase, shor 0.378 0.779 0.298 7.3e-16
UNIPROTKB|F1RIX8238 CBR4 "Uncharacterized protein" 0.261 0.563 0.323 4.3e-15
UNIPROTKB|Q8N4T8237 CBR4 "Carbonyl reductase famil 0.296 0.641 0.339 1.4e-14
TIGR_CMR|CHY_1447247 CHY_1447 "3-oxoacyl-(acyl-carr 0.359 0.744 0.282 1.9e-14
ZFIN|ZDB-GENE-040426-1796237 cbr4 "carbonyl reductase 4" [D 0.289 0.624 0.309 9.2e-14
TIGR_CMR|DET_1277247 DET_1277 "3-oxoacyl-acyl carri 0.279 0.578 0.287 1.4e-13
UNIPROTKB|Q5N800 NYC1 "Probable chlorophyll(ide) b reductase NYC1, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 1730 (614.0 bits), Expect = 3.5e-178, P = 3.5e-178
 Identities = 340/472 (72%), Positives = 390/472 (82%)

Query:    53 CRSFKTD-DKGENEAESELKLKKTSGFWSSLKDVIFR----VNG-PGSQSS------DEY 100
             CR+FK + D G  EA S      T+      K  +++    + G  GS+S+       EY
Sbjct:    34 CRAFKQEADNGGEEASSSPPPPTTAEARRRRKGPLYKLKAAIQGLAGSRSAAAEAYGGEY 93

Query:   101 CKAVAKVEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYSWLGGIIIG 160
              +AV K E++F S+A Q+GR ++TMMS+GVVL VGFQLSGGDSQMN LIWYSWLGG+IIG
Sbjct:    94 QRAVEKAEEIFFSVATQVGRYVITMMSSGVVLGVGFQLSGGDSQMNTLIWYSWLGGVIIG 153

Query:   161 TMVGANMVLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDXXXXXXXXXXXXXMTVTE 220
             TM+GAN VLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGD              T+ E
Sbjct:   154 TMIGANSVLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVIASRSPESVLQTINE 213

Query:   221 LEENLKEGMMAAGGSSKKNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAG 280
             LEEN++EG+  A    ++ L+HAKV G +CDVC+P DV+KL NFA +E GSIDIWINNAG
Sbjct:   214 LEENIQEGLSVAKKKQREILLHAKVVGTSCDVCKPEDVKKLVNFAKDELGSIDIWINNAG 273

Query:   281 TNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSST 340
             TNKGF+PL+ F++E+I QIVSTNLVGS+LCTREAM VM+ Q KGGH+FNMDGAGSGGSST
Sbjct:   274 TNKGFRPLVNFSDEDISQIVSTNLVGSLLCTREAMNVMQHQQKGGHVFNMDGAGSGGSST 333

Query:   341 PLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIIC 400
             PLTAVYGSTKCGLRQ QASL KES+RSKVGVHTASPGMVLTDLLLSGS+++NKQMFN+IC
Sbjct:   334 PLTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDLLLSGSSLRNKQMFNLIC 393

Query:   401 ELPETVARTLVPRIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWFDDQGRALYAAEAD 460
             ELPETVARTLVPR+RVVKGSGKAINYLTPPRILLALVTAW+RRGRWFD++GRA+YAAEAD
Sbjct:   394 ELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRRGRWFDEEGRAVYAAEAD 453

Query:   461 RIRNWAENRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSTGSNTFPGT 512
             RIRNWAE+RARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSS+G    PGT
Sbjct:   454 RIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSSGG-PLPGT 504
GO:0009536 "plastid" evidence=IDA
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=IMP
GO:0015996 "chlorophyll catabolic process" evidence=IMP
GO:0016491 "oxidoreductase activity" evidence=IDA
GO:0042170 "plastid membrane" evidence=RCA
TAIR|locus:2119330 NYC1 "NON-YELLOW COLORING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84ST4 NOL "Chlorophyll(ide) b reductase NOL, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2175254 NOL "NYC1-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1306 CHY_1306 "oxidoreductase, short chain dehydrogenase/reductase family" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIX8 CBR4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N4T8 CBR4 "Carbonyl reductase family member 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1447 CHY_1447 "3-oxoacyl-(acyl-carrier-protein) reductase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1796 cbr4 "carbonyl reductase 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1277 DET_1277 "3-oxoacyl-acyl carrier protein reductase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5N800NYC1_ORYSJ1, ., 1, ., 1, ., 2, 9, 40.72210.92180.9365yesno
Q93ZA0NYC1_ARATH1, ., 1, ., 1, ., 2, 9, 40.69860.95890.9899yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!
4th Layer1.1.1.294LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
cd05233234 cd05233, SDR_c, classical (c) SDRs 8e-50
COG1028251 COG1028, FabG, Dehydrogenases with different speci 1e-35
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-34
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 7e-33
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-30
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-29
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 1e-28
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 2e-28
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-28
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 1e-27
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Pro 2e-27
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 4e-27
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 1e-26
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 2e-26
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 2e-26
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 1e-25
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 6e-25
PRK07109334 PRK07109, PRK07109, short chain dehydrogenase; Pro 7e-25
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-25
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 8e-25
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 1e-24
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 4e-24
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 5e-24
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 6e-24
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 7e-24
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 1e-23
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 2e-23
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 5e-23
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 7e-23
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 9e-23
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-22
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 1e-22
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 2e-22
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 3e-22
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 4e-22
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 5e-22
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 7e-22
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-22
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 9e-22
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 2e-21
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 3e-21
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 3e-21
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Pro 7e-21
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 8e-21
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-21
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 1e-20
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 3e-20
cd05367241 cd05367, SPR-like_SDR_c, sepiapterin reductase (SP 4e-20
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 7e-20
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 8e-20
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 8e-20
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 1e-19
cd05363254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 1e-19
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provision 2e-19
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 2e-19
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 2e-19
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 4e-19
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 4e-19
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 8e-19
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Val 1e-18
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 1e-18
cd08943250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 2e-18
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 3e-18
cd08937256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 4e-18
cd08935271 cd08935, mannonate_red_SDR_c, putative D-mannonate 4e-18
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 6e-18
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 7e-18
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 9e-18
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-17
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 1e-17
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 1e-17
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 1e-17
cd05337255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 2e-17
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 2e-17
PRK06482276 PRK06482, PRK06482, short chain dehydrogenase; Pro 2e-17
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 2e-17
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 4e-17
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 4e-17
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 6e-17
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 7e-17
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 8e-17
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 1e-16
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 1e-16
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 2e-16
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 2e-16
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Pro 2e-16
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 3e-16
PRK06139330 PRK06139, PRK06139, short chain dehydrogenase; Pro 5e-16
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 6e-16
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 8e-16
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 8e-16
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 9e-16
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 2e-15
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 2e-15
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 2e-15
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 2e-15
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 3e-15
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 3e-15
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 5e-15
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 5e-15
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 6e-15
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 8e-15
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Pro 8e-15
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 9e-15
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 1e-14
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 2e-14
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 4e-14
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 4e-14
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 4e-14
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 5e-14
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 6e-14
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 7e-14
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 7e-14
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 1e-13
cd05322257 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy 2e-13
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 2e-13
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase 2e-13
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 2e-13
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Pro 2e-13
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Pro 3e-13
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 3e-13
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 4e-13
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Pro 5e-13
PRK05866293 PRK05866, PRK05866, short chain dehydrogenase; Pro 8e-13
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 9e-13
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 1e-12
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-12
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 2e-12
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Pro 3e-12
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 3e-12
PRK07677252 PRK07677, PRK07677, short chain dehydrogenase; Pro 3e-12
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 3e-12
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 3e-12
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Pro 4e-12
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 4e-12
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Pro 4e-12
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Pro 5e-12
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 5e-12
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 6e-12
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 8e-12
cd05331244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 8e-12
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 8e-12
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 9e-12
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 2e-11
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 3e-11
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 4e-11
PRK08278273 PRK08278, PRK08278, short chain dehydrogenase; Pro 5e-11
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Pro 6e-11
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 6e-11
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Pro 8e-11
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 1e-10
PRK09730247 PRK09730, PRK09730, putative NAD(P)-binding oxidor 1e-10
PRK06125259 PRK06125, PRK06125, short chain dehydrogenase; Pro 1e-10
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 1e-10
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 2e-10
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 2e-10
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 2e-10
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 3e-10
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 3e-10
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 4e-10
TIGR03325262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- 4e-10
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 4e-10
cd09763265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 5e-10
PRK06924251 PRK06924, PRK06924, short chain dehydrogenase; Pro 5e-10
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 6e-10
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 7e-10
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 2e-09
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 2e-09
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 2e-09
PRK12744257 PRK12744, PRK12744, short chain dehydrogenase; Pro 3e-09
cd05348257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 3e-09
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 3e-09
PRK07792306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-09
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 4e-09
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Pro 5e-09
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 5e-09
cd09761242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 5e-09
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-09
PRK09186256 PRK09186, PRK09186, flagellin modification protein 1e-08
PRK07791286 PRK07791, PRK07791, short chain dehydrogenase; Pro 1e-08
PRK12859256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-prote 1e-08
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Pro 1e-08
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Pro 2e-08
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 3e-08
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Val 3e-08
cd09762243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 3e-08
cd11730206 cd11730, Tthb094_like_SDR_c, Tthb094 and related p 4e-08
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 5e-08
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Pro 6e-08
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 7e-08
PRK07806248 PRK07806, PRK07806, short chain dehydrogenase; Pro 1e-07
PRK08340259 PRK08340, PRK08340, glucose-1-dehydrogenase; Provi 1e-07
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provision 1e-07
PRK05875276 PRK05875, PRK05875, short chain dehydrogenase; Pro 1e-07
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro 1e-07
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Pro 1e-07
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 2e-07
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Pro 2e-07
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 2e-07
PLN02780320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 3e-07
PRK07023243 PRK07023, PRK07023, short chain dehydrogenase; Pro 4e-07
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 5e-07
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 9e-07
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 1e-06
PRK07775274 PRK07775, PRK07775, short chain dehydrogenase; Pro 1e-06
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote 2e-06
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Val 2e-06
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 2e-06
cd08953436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2e-06
PRK07041230 PRK07041, PRK07041, short chain dehydrogenase; Pro 3e-06
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Pro 4e-06
cd08951260 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 4e-06
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 4e-06
cd09807274 cd09807, retinol-DH_like_SDR_c, retinol dehydrogen 8e-06
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-05
pfam13561239 pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote 2e-05
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro 2e-05
smart00822180 smart00822, PKS_KR, This enzymatic domain is part 3e-05
cd09806258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 4e-05
TIGR01500256 TIGR01500, sepiapter_red, sepiapterin reductase 4e-05
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 5e-05
PRK08703239 PRK08703, PRK08703, short chain dehydrogenase; Pro 7e-05
PRK08177225 PRK08177, PRK08177, short chain dehydrogenase; Pro 7e-05
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Pro 1e-04
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Pro 2e-04
PRK06197306 PRK06197, PRK06197, short chain dehydrogenase; Pro 2e-04
pfam08659181 pfam08659, KR, KR domain 3e-04
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-prote 3e-04
PRK08017256 PRK08017, PRK08017, oxidoreductase; Provisional 7e-04
cd05274375 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatt 8e-04
cd05361242 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de 0.001
cd05236320 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (F 0.001
cd11731198 cd11731, Lin1944_like_SDR_c, Lin1944 and related p 0.001
cd09810311 cd09810, LPOR_like_SDR_c_like, light-dependent pro 0.002
PRK08303305 PRK08303, PRK08303, short chain dehydrogenase; Pro 0.002
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 0.002
PRK08416260 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydro 0.003
PRK06101240 PRK06101, PRK06101, short chain dehydrogenase; Pro 0.004
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information 
 Score =  170 bits (433), Expect = 8e-50
 Identities = 68/237 (28%), Positives = 107/237 (45%), Gaps = 26/237 (10%)

Query: 180 VVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKN 239
            ++TG++ G+G+A+AR     G +VV+A R+ E++     EL      G           
Sbjct: 1   ALVTGASSGIGRAIARRLAREGAKVVLADRNEEALA----ELAAIEALG----------- 45

Query: 240 LVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQI 299
                   +  DV +  DV+ L   A+ EFG +DI +NNAG      PL + T+E+ +++
Sbjct: 46  ---GNAVAVQADVSDEEDVEALVEEALEEFGRLDILVNNAGIA-RPGPLEELTDEDWDRV 101

Query: 300 VSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQAS 359
           +  NL G  L TR A+  M+ Q  GG I N+          P  A Y ++K  L  L  S
Sbjct: 102 LDVNLTGVFLLTRAALPHMKKQ-GGGRIVNISSVAGLRPL-PGQAAYAASKAALEGLTRS 159

Query: 360 LFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMF-----NIICELPETVARTLV 411
           L  E     + V+  +PG+V T +L      + ++             PE VA  +V
Sbjct: 160 LALELAPYGIRVNAVAPGLVDTPMLAKLGPEEAEKELAAAIPLGRLGTPEEVAEAVV 216

SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 234
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235713 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235703 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|236099 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212496 cd11730, Tthb094_like_SDR_c, Tthb094 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181126 PRK07806, PRK07806, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169390 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
>gnl|CDD|180796 PRK07023, PRK07023, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181113 PRK07775, PRK07775, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|235914 PRK07041, PRK07041, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187654 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 ketoreductase (KR), classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|212495 cd09807, retinol-DH_like_SDR_c, retinol dehydrogenases (retinol-DHs), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|233441 TIGR01500, sepiapter_red, sepiapterin reductase Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236173 PRK08177, PRK08177, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235737 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|219957 pfam08659, KR, KR domain Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187582 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatty acid synthase (FAS), complex (x) SDRs Back     alignment and domain information
>gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|212497 cd11731, Lin1944_like_SDR_c, Lin1944 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187670 cd09810, LPOR_like_SDR_c_like, light-dependent protochlorophyllide reductase (LPOR)-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|236229 PRK08303, PRK08303, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180399 PRK06101, PRK06101, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 512
COG0300265 DltE Short-chain dehydrogenases of various substra 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 100.0
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
KOG0725270 consensus Reductases with broad range of substrate 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07063260 short chain dehydrogenase; Provisional 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06114254 short chain dehydrogenase; Provisional 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PLN02730303 enoyl-[acyl-carrier-protein] reductase 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK07791286 short chain dehydrogenase; Provisional 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PRK07985294 oxidoreductase; Provisional 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 100.0
PRK08643256 acetoin reductase; Validated 100.0
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
PRK06139330 short chain dehydrogenase; Provisional 100.0
PRK06398258 aldose dehydrogenase; Validated 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PRK06128300 oxidoreductase; Provisional 100.0
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07831262 short chain dehydrogenase; Provisional 100.0
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 100.0
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07523255 gluconate 5-dehydrogenase; Provisional 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
PRK08862227 short chain dehydrogenase; Provisional 100.0
PRK09242257 tropinone reductase; Provisional 100.0
PLN02253280 xanthoxin dehydrogenase 100.0
PLN00015308 protochlorophyllide reductase 100.0
PRK05876275 short chain dehydrogenase; Provisional 100.0
PRK07677252 short chain dehydrogenase; Provisional 100.0
PRK05599246 hypothetical protein; Provisional 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 100.0
PRK06484520 short chain dehydrogenase; Validated 100.0
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07067257 sorbitol dehydrogenase; Provisional 100.0
PRK05854313 short chain dehydrogenase; Provisional 100.0
PLN02780320 ketoreductase/ oxidoreductase 100.0
PRK06940275 short chain dehydrogenase; Provisional 100.0
PRK07856252 short chain dehydrogenase; Provisional 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
PRK05872296 short chain dehydrogenase; Provisional 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK06124256 gluconate 5-dehydrogenase; Provisional 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK12743256 oxidoreductase; Provisional 100.0
PRK06196315 oxidoreductase; Provisional 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
KOG1208314 consensus Dehydrogenases with different specificit 100.0
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK05717255 oxidoreductase; Validated 100.0
PRK07109334 short chain dehydrogenase; Provisional 100.0
PRK07825273 short chain dehydrogenase; Provisional 100.0
PRK07890258 short chain dehydrogenase; Provisional 100.0
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 100.0
TIGR02415254 23BDH acetoin reductases. One member of this famil 100.0
PRK05866293 short chain dehydrogenase; Provisional 100.0
PRK12938246 acetyacetyl-CoA reductase; Provisional 100.0
PRK08278273 short chain dehydrogenase; Provisional 100.0
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07814263 short chain dehydrogenase; Provisional 100.0
PRK06483236 dihydromonapterin reductase; Provisional 100.0
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK05855582 short chain dehydrogenase; Validated 100.0
PRK07576264 short chain dehydrogenase; Provisional 100.0
PRK08628258 short chain dehydrogenase; Provisional 100.0
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 100.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 100.0
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 100.0
PRK06484 520 short chain dehydrogenase; Validated 100.0
PRK06197306 short chain dehydrogenase; Provisional 100.0
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07453322 protochlorophyllide oxidoreductase; Validated 100.0
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 100.0
PRK12744257 short chain dehydrogenase; Provisional 100.0
PRK06180277 short chain dehydrogenase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PRK06500249 short chain dehydrogenase; Provisional 100.0
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 100.0
PRK06701290 short chain dehydrogenase; Provisional 99.98
PRK07024257 short chain dehydrogenase; Provisional 99.98
PRK12742237 oxidoreductase; Provisional 99.98
PRK06182273 short chain dehydrogenase; Validated 99.98
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.98
PRK05993277 short chain dehydrogenase; Provisional 99.98
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.98
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.98
PRK06138252 short chain dehydrogenase; Provisional 99.98
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.98
PRK05650270 short chain dehydrogenase; Provisional 99.98
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.98
PRK12939250 short chain dehydrogenase; Provisional 99.97
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.97
PRK07904253 short chain dehydrogenase; Provisional 99.97
PRK06057255 short chain dehydrogenase; Provisional 99.97
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.97
PRK09186256 flagellin modification protein A; Provisional 99.97
PRK07832272 short chain dehydrogenase; Provisional 99.97
PRK05875276 short chain dehydrogenase; Provisional 99.97
PRK05884223 short chain dehydrogenase; Provisional 99.97
PRK06947248 glucose-1-dehydrogenase; Provisional 99.97
PRK08703239 short chain dehydrogenase; Provisional 99.97
PRK09072263 short chain dehydrogenase; Provisional 99.97
PRK06194287 hypothetical protein; Provisional 99.97
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.97
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.97
PRK06123248 short chain dehydrogenase; Provisional 99.97
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.97
PRK06198260 short chain dehydrogenase; Provisional 99.97
PRK07454241 short chain dehydrogenase; Provisional 99.97
PRK06179270 short chain dehydrogenase; Provisional 99.97
PRK07069251 short chain dehydrogenase; Validated 99.97
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 99.97
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.97
PRK07774250 short chain dehydrogenase; Provisional 99.97
PRK08263275 short chain dehydrogenase; Provisional 99.97
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.97
PRK08251248 short chain dehydrogenase; Provisional 99.97
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK08267260 short chain dehydrogenase; Provisional 99.97
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.97
PRK05693274 short chain dehydrogenase; Provisional 99.97
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.97
PRK12746254 short chain dehydrogenase; Provisional 99.97
COG1028251 FabG Dehydrogenases with different specificities ( 99.97
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.97
PRK12827249 short chain dehydrogenase; Provisional 99.97
PRK07775274 short chain dehydrogenase; Provisional 99.97
PRK09134258 short chain dehydrogenase; Provisional 99.97
PRK06914280 short chain dehydrogenase; Provisional 99.97
PRK10538248 malonic semialdehyde reductase; Provisional 99.97
PRK07201657 short chain dehydrogenase; Provisional 99.97
PRK07060245 short chain dehydrogenase; Provisional 99.97
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.96
PRK07102243 short chain dehydrogenase; Provisional 99.96
PRK06924251 short chain dehydrogenase; Provisional 99.96
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.96
KOG1611249 consensus Predicted short chain-type dehydrogenase 99.96
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK07074257 short chain dehydrogenase; Provisional 99.96
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK06181263 short chain dehydrogenase; Provisional 99.96
PRK07577234 short chain dehydrogenase; Provisional 99.96
PRK06101240 short chain dehydrogenase; Provisional 99.96
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 99.96
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.96
PRK09009235 C factor cell-cell signaling protein; Provisional 99.96
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK06482276 short chain dehydrogenase; Provisional 99.96
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK08324681 short chain dehydrogenase; Validated 99.96
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.96
PRK12829264 short chain dehydrogenase; Provisional 99.96
PRK07326237 short chain dehydrogenase; Provisional 99.96
PRK07023243 short chain dehydrogenase; Provisional 99.96
PRK07041230 short chain dehydrogenase; Provisional 99.96
PRK07578199 short chain dehydrogenase; Provisional 99.96
PRK12828239 short chain dehydrogenase; Provisional 99.96
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.95
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 99.95
PRK09135249 pteridine reductase; Provisional 99.95
PRK07806248 short chain dehydrogenase; Provisional 99.95
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
PRK08177225 short chain dehydrogenase; Provisional 99.95
PRK09291257 short chain dehydrogenase; Provisional 99.95
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.95
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
PRK08264238 short chain dehydrogenase; Validated 99.95
PRK08017256 oxidoreductase; Provisional 99.94
PRK12367245 short chain dehydrogenase; Provisional 99.94
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.93
PRK06953222 short chain dehydrogenase; Provisional 99.92
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.92
PRK08219227 short chain dehydrogenase; Provisional 99.92
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.91
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 99.9
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.89
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.88
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 99.85
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.83
PLN03209 576 translocon at the inner envelope of chloroplast su 99.81
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.8
PRK06720169 hypothetical protein; Provisional 99.79
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.79
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.76
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.74
PLN02653340 GDP-mannose 4,6-dehydratase 99.69
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.68
PLN02650351 dihydroflavonol-4-reductase 99.65
PLN02583297 cinnamoyl-CoA reductase 99.65
PLN02896353 cinnamyl-alcohol dehydrogenase 99.65
PLN02572442 UDP-sulfoquinovose synthase 99.62
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.62
PLN00198338 anthocyanidin reductase; Provisional 99.62
PLN02240352 UDP-glucose 4-epimerase 99.61
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.61
PLN02214342 cinnamoyl-CoA reductase 99.6
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.59
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.57
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.56
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.52
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.52
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.51
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.5
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.5
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.49
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.49
PLN02686367 cinnamoyl-CoA reductase 99.49
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.46
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.41
PLN02427386 UDP-apiose/xylose synthase 99.38
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.36
PF08643299 DUF1776: Fungal family of unknown function (DUF177 99.36
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.35
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.33
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.31
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.31
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.29
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.28
PLN02260 668 probable rhamnose biosynthetic enzyme 99.27
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.25
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.24
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.24
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.21
PLN02206442 UDP-glucuronate decarboxylase 99.19
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.18
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.18
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.18
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.18
CHL00194317 ycf39 Ycf39; Provisional 99.15
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.14
PLN02166436 dTDP-glucose 4,6-dehydratase 99.13
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.09
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.06
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 99.04
PRK07201 657 short chain dehydrogenase; Provisional 99.03
PLN02996491 fatty acyl-CoA reductase 99.0
PRK05865 854 hypothetical protein; Provisional 99.0
PLN02778298 3,5-epimerase/4-reductase 98.9
COG3320382 Putative dehydrogenase domain of multifunctional n 98.88
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 98.88
PRK08309177 short chain dehydrogenase; Provisional 98.87
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.8
PLN02503 605 fatty acyl-CoA reductase 2 98.78
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 98.74
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.74
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 98.71
PLN02260668 probable rhamnose biosynthetic enzyme 98.67
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.63
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.63
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.63
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 98.56
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.55
COG4982 866 3-oxoacyl-[acyl-carrier protein] 98.45
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.4
PLN00016378 RNA-binding protein; Provisional 98.39
PRK06732229 phosphopantothenate--cysteine ligase; Validated 98.34
PRK12320 699 hypothetical protein; Provisional 98.31
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 98.3
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.26
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 98.23
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 98.2
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 98.18
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 98.13
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 98.08
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 97.78
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.76
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.71
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 97.69
PRK14982340 acyl-ACP reductase; Provisional 97.63
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.63
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.62
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 97.59
PLN00106323 malate dehydrogenase 97.58
PRK09620229 hypothetical protein; Provisional 97.54
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 97.35
KOG2733423 consensus Uncharacterized membrane protein [Functi 97.34
COG2910211 Putative NADH-flavin reductase [General function p 97.27
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 97.23
KOG2774366 consensus NAD dependent epimerase [General functio 97.2
PTZ00325321 malate dehydrogenase; Provisional 97.14
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.11
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 97.08
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.04
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.0
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 96.97
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 96.89
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 96.78
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.71
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.68
PRK06849389 hypothetical protein; Provisional 96.6
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.6
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.46
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 96.42
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 96.42
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.38
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 96.31
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 96.29
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 96.26
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.26
PRK05086312 malate dehydrogenase; Provisional 96.24
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.2
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 96.2
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 96.13
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.13
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.12
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.11
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 96.08
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.05
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 95.96
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 95.93
PRK14027283 quinate/shikimate dehydrogenase; Provisional 95.87
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 95.82
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 95.73
COG3268382 Uncharacterized conserved protein [Function unknow 95.69
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 95.68
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 95.65
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.59
PRK13940414 glutamyl-tRNA reductase; Provisional 95.52
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 95.51
PRK15116268 sulfur acceptor protein CsdL; Provisional 95.48
PRK14968188 putative methyltransferase; Provisional 95.42
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.42
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 95.36
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 95.34
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.32
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 95.25
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 95.24
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.23
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.22
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 95.18
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 95.14
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.05
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 95.04
PTZ00117319 malate dehydrogenase; Provisional 95.02
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 94.95
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 94.93
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 94.89
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.77
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 94.77
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 94.77
PTZ00082321 L-lactate dehydrogenase; Provisional 94.76
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 94.67
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 94.64
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 94.62
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 94.61
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.61
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.59
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 94.57
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.55
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 94.46
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.35
PLN00203519 glutamyl-tRNA reductase 94.29
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.28
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.21
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.17
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 94.16
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 94.13
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 94.11
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 93.95
PRK04148134 hypothetical protein; Provisional 93.94
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 93.93
PRK08223287 hypothetical protein; Validated 93.93
PRK05442326 malate dehydrogenase; Provisional 93.9
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 93.82
PLN00112444 malate dehydrogenase (NADP); Provisional 93.81
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 93.8
PRK09496 453 trkA potassium transporter peripheral membrane com 93.78
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 93.74
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 93.74
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 93.69
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.65
PLN02602350 lactate dehydrogenase 93.61
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 93.49
PRK05600370 thiamine biosynthesis protein ThiF; Validated 93.49
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 93.44
PRK08328231 hypothetical protein; Provisional 93.43
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 93.43
PLN02740381 Alcohol dehydrogenase-like 93.42
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 93.3
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 93.29
PRK09496453 trkA potassium transporter peripheral membrane com 93.17
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 93.11
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 93.07
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 93.02
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.99
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 92.86
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 92.81
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 92.8
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 92.73
PLN02586360 probable cinnamyl alcohol dehydrogenase 92.72
COG2085211 Predicted dinucleotide-binding enzymes [General fu 92.67
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 92.66
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 92.46
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 92.45
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 92.45
PLN02178375 cinnamyl-alcohol dehydrogenase 92.43
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 92.43
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.38
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 92.36
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 92.33
PRK13771334 putative alcohol dehydrogenase; Provisional 92.26
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 92.25
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 92.22
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.2
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 92.08
PTZ00354334 alcohol dehydrogenase; Provisional 92.05
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 92.04
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 92.04
PRK12550272 shikimate 5-dehydrogenase; Reviewed 92.04
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 92.02
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 91.94
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 91.92
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 91.91
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 91.91
PRK06718202 precorrin-2 dehydrogenase; Reviewed 91.85
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 91.83
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 91.8
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 91.75
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 91.6
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 91.58
PRK06223307 malate dehydrogenase; Reviewed 91.54
COG2130340 Putative NADP-dependent oxidoreductases [General f 91.54
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 91.5
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 91.48
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 91.37
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 91.32
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 91.21
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 91.14
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.12
PRK12480330 D-lactate dehydrogenase; Provisional 91.1
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 91.09
PRK14851 679 hypothetical protein; Provisional 90.99
PLN02827378 Alcohol dehydrogenase-like 90.95
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 90.91
PRK07877 722 hypothetical protein; Provisional 90.82
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.78
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 90.76
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 90.73
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 90.71
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.7
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 90.66
PLN02928347 oxidoreductase family protein 90.59
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 90.49
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.49
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 90.38
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 90.36
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.34
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 90.31
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 90.29
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 90.29
PRK07411390 hypothetical protein; Validated 90.27
PRK08655 437 prephenate dehydrogenase; Provisional 90.23
COG3007398 Uncharacterized paraquat-inducible protein B [Func 90.01
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 89.89
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 89.88
PRK14030445 glutamate dehydrogenase; Provisional 89.84
PRK13243333 glyoxylate reductase; Reviewed 89.66
PRK10669558 putative cation:proton antiport protein; Provision 89.65
COG2263198 Predicted RNA methylase [Translation, ribosomal st 89.63
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 89.63
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 89.62
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 89.55
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 89.4
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-40  Score=327.43  Aligned_cols=224  Identities=25%  Similarity=0.400  Sum_probs=201.3

Q ss_pred             CCCCCEEEEECCCChHHHHHHHHHHHCCCEEEEEEcChhhHHHHHHHHHHHHhhhhhhcCCCCcccccCceEEEEEccCC
Q 010380          174 KAGPRNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDVC  253 (512)
Q Consensus       174 ~l~gk~vLVTGassGIG~aiA~~La~~Ga~Vvl~~R~~~~l~~~~~el~~~~~~~~~~~g~~~~~~~~g~~v~~v~~Dlt  253 (512)
                      .+.++++||||||+|||+++|++|+++|++|++++|++++++++.+++++.                .+.++.++++|++
T Consensus         3 ~~~~~~~lITGASsGIG~~~A~~lA~~g~~liLvaR~~~kL~~la~~l~~~----------------~~v~v~vi~~DLs   66 (265)
T COG0300           3 PMKGKTALITGASSGIGAELAKQLARRGYNLILVARREDKLEALAKELEDK----------------TGVEVEVIPADLS   66 (265)
T ss_pred             CCCCcEEEEECCCchHHHHHHHHHHHCCCEEEEEeCcHHHHHHHHHHHHHh----------------hCceEEEEECcCC
Confidence            567899999999999999999999999999999999999999999999875                4578999999999


Q ss_pred             ChhhHHHHHHHHHHHcCCCcccccccccCCCCCCCcCCCHHHHHHHHHhhhhhHHHHHHHHHHHHHhCCCCCeEEeecCC
Q 010380          254 EPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGA  333 (512)
Q Consensus       254 d~~sv~~~~~~i~~~~g~IDvLInnAG~~~~~~~~~~~s~e~~~~~~~vNv~g~~~l~k~~lp~m~~~~~~g~IV~vSS~  333 (512)
                      +++++.++.+++.+..+.||+||||||... ++++.+.+.++.++++++|+.+...|+++++|.|.++ +.|+||||+|.
T Consensus        67 ~~~~~~~l~~~l~~~~~~IdvLVNNAG~g~-~g~f~~~~~~~~~~mi~lN~~a~~~LT~~~lp~m~~~-~~G~IiNI~S~  144 (265)
T COG0300          67 DPEALERLEDELKERGGPIDVLVNNAGFGT-FGPFLELSLDEEEEMIQLNILALTRLTKAVLPGMVER-GAGHIINIGSA  144 (265)
T ss_pred             ChhHHHHHHHHHHhcCCcccEEEECCCcCC-ccchhhCChHHHHHHHHHHHHHHHHHHHHHHHHHHhc-CCceEEEEech
Confidence            999999999999999899999999999998 7899999999999999999999999999999999998 78999999998


Q ss_pred             CCCCCCCCCcchhhHHHHHHHHHHHHHHHHhCCCCeEEEEEeCCcccCCcccCCcchhhhhhhhhhcCCHHHHHHHhccc
Q 010380          334 GSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVPR  413 (512)
Q Consensus       334 ~a~~~~~p~~~~Y~aSKaAl~~l~~sLa~El~~~GIrVn~V~PG~V~T~~~~~~~~~~~~~~~~~~~~~pe~vA~~~l~r  413 (512)
                       ++..+.|..+.|++||+++.+|+++|+.|+.++||+|.+|+||+|.|+++.................+|+++|+..+..
T Consensus       145 -ag~~p~p~~avY~ATKa~v~~fSeaL~~EL~~~gV~V~~v~PG~~~T~f~~~~~~~~~~~~~~~~~~~~~~va~~~~~~  223 (265)
T COG0300         145 -AGLIPTPYMAVYSATKAFVLSFSEALREELKGTGVKVTAVCPGPTRTEFFDAKGSDVYLLSPGELVLSPEDVAEAALKA  223 (265)
T ss_pred             -hhcCCCcchHHHHHHHHHHHHHHHHHHHHhcCCCeEEEEEecCccccccccccccccccccchhhccCHHHHHHHHHHH
Confidence             7899999999999999999999999999999999999999999999999962111111111233445899999988866


Q ss_pred             ccc
Q 010380          414 IRV  416 (512)
Q Consensus       414 ~~~  416 (512)
                      +..
T Consensus       224 l~~  226 (265)
T COG0300         224 LEK  226 (265)
T ss_pred             Hhc
Confidence            554

>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG3007 Uncharacterized paraquat-inducible protein B [Function unknown] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
4dyv_A272 Crystal Structure Of A Short-Chain DehydrogenaseRED 8e-15
2hq1_A247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 3e-14
4dry_A281 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 1e-13
2nm0_A253 Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl 5e-13
2uvd_A246 The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier 1e-12
1vl8_A267 Crystal Structure Of Gluconate 5-dehydrogenase (tm0 3e-12
2bd0_A244 Chlorobium Tepidum Sepiapterin Reductase Complexed 4e-12
4g81_D255 Crystal Structure Of A Hexonate Dehydrogenase Ortho 6e-12
3tfo_A264 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Car 7e-12
1i01_A244 Crystal Structure Of Beta-Ketoacyl [acyl Carrier Pr 7e-12
3u5t_A267 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 9e-12
3rku_A287 Substrate Fingerprint And The Structure Of Nadp+ De 2e-11
1k2w_A256 Crystal Structure Of Sorbitol Dehydrogenase From R. 2e-11
3ay7_A269 Crystal Structure Of Bacillus Megaterium Glucose De 2e-11
3ay6_A269 Crystal Structure Of Bacillus Megaterium Glucose De 2e-11
1q7c_A244 The Structure Of Betaketoacyl-[acp] Reductase Y151f 2e-11
3aus_A269 Crystal Structure Of Bacillus Megaterium Glucose De 2e-11
1edo_A244 The X-Ray Structure Of Beta-Keto Acyl Carrier Prote 4e-11
3sj7_A252 Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) F 5e-11
3v2h_A281 The Crystal Structure Of D-Beta-Hydroxybutyrate Deh 9e-11
4ibo_A271 Crystal Structure Of A Putative Gluconate Dehydroge 1e-10
3asu_A248 Crystal Structure Of Serine Dehydrogenase From Esch 1e-10
3r1i_A276 Crystal Structure Of A Short-Chain Type Dehydrogena 1e-10
4dml_A269 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Syn 1e-10
1rwb_A261 Cooperative Effect Of Two Surface Amino Acid Mutati 2e-10
1gee_A261 Crystal Structure Of Glucose Dehydrogenase Mutant Q 2e-10
1gco_A261 Crystal Structure Of Glucose Dehydrogenase Complexe 2e-10
3rsh_A251 Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc 3e-10
2cf2_E226 Architecture Of Mammalian Fatty Acid Synthase Lengt 3e-10
1g6k_A261 Crystal Structure Of Glucose Dehydrogenase Mutant E 3e-10
3tzh_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-10
3qiv_A253 Crystal Structure Of A Putative Short-Chain Dehydro 5e-10
3oec_A317 Crystal Structure Of Carveol Dehydrogenase From Myc 6e-10
2hsd_A253 The Refined Three-Dimensional Structure Of 3alpha,2 7e-10
1hdc_A254 Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste 8e-10
4fn4_A254 Short-chain Nad(h)-dependent Dehydrogenase/reductas 8e-10
2pnf_A248 Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- 9e-10
3tzc_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-09
1iy8_A267 Crystal Structure Of Levodione Reductase Length = 2 1e-09
3tzk_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-09
3u09_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-09
1uzl_A247 Maba From Mycobacterium Tuberculosis Length = 247 2e-09
3ftp_A270 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-09
3pk0_A262 Crystal Structure Of Short-Chain DehydrogenaseREDUC 3e-09
3rkr_A262 Crystal Structure Of A Metagenomic Short-Chain Oxid 4e-09
1ipe_A259 Tropinone Reductase-Ii Complexed With Nadph Length 4e-09
2ae2_A260 Tropinone Reductase-Ii Complexed With Nadp+ And Pse 4e-09
2zat_A260 Crystal Structure Of A Mammalian Reductase Length = 6e-09
1yxm_A303 Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa 7e-09
4e3z_A272 Crystal Structure Of A Oxidoreductase From Rhizobiu 9e-09
3osu_A246 Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Pro 1e-08
3is3_A270 Crystal Structure Of 17beta-Hydroxysteroid Dehydrog 1e-08
3i4f_A264 Structure Of Putative 3-oxoacyl-reductase From Baci 2e-08
1xq1_A266 X-Ray Structure Of Putative Tropinone Reducatse Fro 2e-08
3tjr_A301 Crystal Structure Of A Rv0851c Ortholog Short Chain 2e-08
3un1_A260 Crystal Structure Of An Oxidoreductase From Sinorhi 2e-08
3itd_A270 Crystal Structure Of An Inactive 17beta-Hydroxyster 3e-08
3oic_A258 Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl 4e-08
4fgs_A273 Crystal Structure Of A Probable Dehydrogenase Prote 4e-08
3op4_A248 Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carr 5e-08
3ctm_A279 Crystal Structure Of A Carbonyl Reductase From Cand 8e-08
1uzm_A247 Maba From Mycobacterium Tuberculosis Length = 247 8e-08
2ntn_A267 Crystal Structure Of Maba-c60v/g139a/s144l Length = 9e-08
4e6p_A259 Crystal Structure Of A Probable Sorbitol Dehydrogen 9e-08
3ioy_A319 Structure Of Putative Short-Chain Dehydrogenase (Sa 1e-07
2q2q_A255 Structure Of D-3-Hydroxybutyrate Dehydrogenase From 1e-07
3nug_A247 Crystal Structure Of Wild Type Tetrameric Pyridoxal 1e-07
3o38_A266 Crystal Structure Of A Short Chain Dehydrogenase Fr 1e-07
1ae1_A273 Tropinone Reductase-I Complex With Nadp Length = 27 2e-07
2ehd_A234 Crystal Structure Analysis Of Oxidoreductase Length 2e-07
4iqg_C271 Crystal Structure Of Bpro0239 Oxidoreductase From P 2e-07
3enn_A249 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 3e-07
3emk_A246 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 3e-07
1zem_A262 Crystal Structure Of Nad+-Bound Xylitol Dehydrogena 3e-07
1xg5_A279 Structure Of Human Putative Dehydrogenase Mgc4172 I 3e-07
3ai1_A263 The Crystal Structure Of L-Sorbose Reductase From G 4e-07
2rh4_A277 Actinorhodin Ketoreductase, Actkr, With Nadph And I 4e-07
1x7g_A261 Actinorhodin Polyketide Ketoreductase, Act Kr, With 4e-07
3sju_A279 Hedamycin Polyketide Ketoreductase Bound To Nadph L 4e-07
1w4z_A281 Structure Of Actinorhodin Polyketide (Actiii) Reduc 4e-07
3gvc_A277 Crystal Structure Of Probable Short-Chain Dehydroge 4e-07
3f9i_A249 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 5e-07
2cfc_A250 Structural Basis For Stereo Selectivity In The (R)- 5e-07
4dc1_A281 Crystal Structure Of Y202f Actinorhodin Polyketide 5e-07
1zbq_A327 Crystal Structure Of Human 17-beta-hydroxysteroid D 5e-07
4dc0_A281 Crystal Structure Of F189w Actinorhodin Polyketide 6e-07
4dbz_A281 Crystal Structure Of V151l Actinorhodin Polyketide 6e-07
2rhr_B277 P94l Actinorhodin Ketordeuctase Mutant, With Nadph 6e-07
1geg_A256 Cryatal Structure Analysis Of Meso-2,3-Butanediol D 7e-07
3ndr_A247 Crystal Structure Of Tetrameric Pyridoxal 4-Dehydro 7e-07
3csd_B281 Actinorhodin Polyketide Ketoreductase Mutant P94l B 7e-07
2c07_A285 Oxoacyl-Acp Reductase Of Plasmodium Falciparum Leng 8e-07
1spx_A278 Crystal Structure Of Glucose Dehydrogenase Of Caeno 8e-07
2gdz_A267 Crystal Structure Of 15-Hydroxyprostaglandin Dehydr 9e-07
3ai3_A263 The Crystal Structure Of L-Sorbose Reductase From G 1e-06
3o4r_A261 Crystal Structure Of Human DehydrogenaseREDUCTASE ( 1e-06
2ph3_A245 Crystal Structure Of 3-oxoacyl-[acyl Carrier Protei 1e-06
3gk3_A269 Crystal Structure Of Acetoacetyl-Coa Reductase From 2e-06
3cxr_A291 Crystal Structure Of Gluconate 5-Dehydrogase From S 2e-06
2nwq_A272 Short Chain Dehydrogenase From Pseudomonas Aerugino 2e-06
1doh_A283 Structure Of Trihydroxynaphthalene Reductase In Com 4e-06
1ybv_A283 Structure Of Trihydroxynaphthalene Reductase In Com 4e-06
1nff_A260 Crystal Structure Of Rv2002 Gene Product From Mycob 4e-06
3qlj_A322 Crystal Structure Of A Short Chain Dehydrogenase Fr 5e-06
3a28_C258 Crystal Structure Of L-2,3-Butanediol Dehydrogenase 6e-06
1yde_A270 Crystal Structure Of Human Retinal Short-Chain Dehy 6e-06
2ew8_A249 Crystal Structure Of The (s)-specific 1-phenylethan 7e-06
3ksu_A262 Crystal Structure Of Short-Chain Dehydrogenase From 9e-06
3ged_A247 Fingerprint And Structural Analysis Of A Apo Scor E 9e-06
3pgx_A280 Crystal Structure Of A Putative Carveol Dehydrogena 1e-05
3grp_A266 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- 1e-05
1gz6_A319 (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat 2e-05
3r3s_A294 Structure Of The Ygha Oxidoreductase From Salmonell 3e-05
3rih_A293 Crystal Structure Of A Putative Short Chain Dehydro 3e-05
1nfr_A260 Rv2002 Gene Product From Mycobacterium Tuberculosis 3e-05
3ezl_A256 Crystal Structure Of Acetyacetyl-Coa Reductase From 3e-05
4b79_A242 The Aeropath Project And Pseudomonas Aeruginosa Hig 4e-05
1zjy_A251 Structure Of R-Specific Alcohol Dehydrogenase (Muta 4e-05
4iin_A271 Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car 4e-05
4afn_A269 Crystal Structure Of 3-ketoacyl-(acyl-carrier-prote 6e-05
2jap_A247 Clavulanic Acid Dehydrogenase: Structural And Bioch 6e-05
3afm_A258 Crystal Structure Of Aldose Reductase A1-R Responsi 7e-05
1xkq_A280 Crystal Structure Of Short-Chain DehydrogenaseREDUC 7e-05
3ak4_A263 Crystal Structure Of Nadh-Dependent Quinuclidinone 7e-05
2et6_A604 (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candid 7e-05
1ja9_A274 Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalen 7e-05
1uls_A245 Crystal Structure Of Tt0140 From Thermus Thermophil 9e-05
4dqx_A277 Crystal Structure Of A Short Chain Dehydrogenase Fr 1e-04
4da9_A280 Crystal Structure Of Putative Short-Chain Dehydroge 1e-04
2zk7_A257 Structure Of A C-Terminal Deletion Mutant Of Thermo 1e-04
2dtd_A264 Structure Of Thermoplasma Acidophilum Aldohexose De 1e-04
1xhl_A297 Crystal Structure Of Putative Tropinone Reductase-I 1e-04
3l6e_A235 Crystal Structure Of Putative Short Chain Dehydroge 2e-04
3tzq_B271 Crystal Structure Of A Short-Chain Type Dehydrogena 2e-04
3v2g_A271 Crystal Structure Of A DehydrogenaseREDUCTASE FROM 2e-04
3gaf_A256 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid De 2e-04
2b4q_A276 Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex 3e-04
2d1y_A256 Crystal Structure Of Tt0321 From Thermus Thermophil 3e-04
2fwm_X250 Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodih 3e-04
1cyd_A244 Carbonyl Reductase Complexed With Nadph And 2-Propa 3e-04
3m1a_A281 The Crystal Structure Of A Short-Chain Dehydrogenas 5e-04
3oml_A 613 Structure Of Full-Length Peroxisomal Multifunctiona 8e-04
>pdb|4DYV|A Chain A, Crystal Structure Of A Short-Chain DehydrogenaseREDUCTASE SDR FROM Xanthobacter Autotrophicus Py2 Length = 272 Back     alignment and structure 
Iteration: 1

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 62/113 (54%), Gaps = 2/113 (1%)
Query: 248 IACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGS 307
           +  DV +P  V+ L    V +FG +D+  NNAGT     P    T  + +Q+V TNL G 
Sbjct: 79  VPTDVTDPDSVRALFTATVEKFGRVDVLFNNAGTGAPAIPXEDLTFAQWKQVVDTNLTGP 138
Query: 308 ILCTREAMRVMRDQ-PKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQAS 359
            LCT+EA RV + Q P+GG I N +G+ S  S  P +A Y +TK  +  L  S
Sbjct: 139 FLCTQEAFRVXKAQEPRGGRIIN-NGSISATSPRPYSAPYTATKHAITGLTKS 190
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|4DRY|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Rhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|2NM0|A Chain A, Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl Carrier Protein Reductase From Streptomyces Coelicolor A3(2) Length = 253 Back     alignment and structure
>pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 Back     alignment and structure
>pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 Back     alignment and structure
>pdb|2BD0|A Chain A, Chlorobium Tepidum Sepiapterin Reductase Complexed With Nadp And Sepiapterin Length = 244 Back     alignment and structure
>pdb|4G81|D Chain D, Crystal Structure Of A Hexonate Dehydrogenase Ortholog (Target Efi- 506402 From Salmonella Enterica, Unliganded Structure Length = 255 Back     alignment and structure
>pdb|3TFO|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Carrier-Protein) Reductase From Sinorhizobium Meliloti Length = 264 Back     alignment and structure
>pdb|1I01|A Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. Length = 244 Back     alignment and structure
>pdb|3U5T|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Sinorhizobium Meliloti Length = 267 Back     alignment and structure
>pdb|3RKU|A Chain A, Substrate Fingerprint And The Structure Of Nadp+ Dependent Serine Dehydrogenase From Saccharomyces Cerevisiae Complexed With Nadp+ Length = 287 Back     alignment and structure
>pdb|1K2W|A Chain A, Crystal Structure Of Sorbitol Dehydrogenase From R. Sphaeroides Length = 256 Back     alignment and structure
>pdb|3AY7|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 G259a Mutant Length = 269 Back     alignment and structure
>pdb|3AY6|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 A258f Mutant In Complex With Nadh And D-Glucose Length = 269 Back     alignment and structure
>pdb|1Q7C|A Chain A, The Structure Of Betaketoacyl-[acp] Reductase Y151f Mutant In Complex With Nadph Fragment Length = 244 Back     alignment and structure
>pdb|3AUS|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 In Ligand-Free Form Length = 269 Back     alignment and structure
>pdb|1EDO|A Chain A, The X-Ray Structure Of Beta-Keto Acyl Carrier Protein Reductase From Brassica Napus Complexed With Nadp+ Length = 244 Back     alignment and structure
>pdb|3SJ7|A Chain A, Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) From Staphylococcus Aureus Complex With Nadph Length = 252 Back     alignment and structure
>pdb|3V2H|A Chain A, The Crystal Structure Of D-Beta-Hydroxybutyrate Dehydrogenase From Sinorhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|4IBO|A Chain A, Crystal Structure Of A Putative Gluconate Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506446) Length = 271 Back     alignment and structure
>pdb|3ASU|A Chain A, Crystal Structure Of Serine Dehydrogenase From Escherichia Coli Length = 248 Back     alignment and structure
>pdb|3R1I|A Chain A, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 276 Back     alignment and structure
>pdb|4DML|A Chain A, 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Synechococcus Elongatus Pcc 7942 Length = 269 Back     alignment and structure
>pdb|1RWB|A Chain A, Cooperative Effect Of Two Surface Amino Acid Mutations (Q252l And E170k) Of Glucose Dehydrogenase From Bacillus Megaterium Iwg3 For The Stabilization Of Oligomeric State Length = 261 Back     alignment and structure
>pdb|1GEE|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant Q252l Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1GCO|A Chain A, Crystal Structure Of Glucose Dehydrogenase Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 Back     alignment and structure
>pdb|2CF2|E Chain E, Architecture Of Mammalian Fatty Acid Synthase Length = 226 Back     alignment and structure
>pdb|1G6K|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant E96a Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3QIV|A Chain A, Crystal Structure Of A Putative Short-Chain Dehydrogenase Or 3- Oxoacyl-[acyl-Carrier-Protein] Reductase From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 Back     alignment and structure
>pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 Back     alignment and structure
>pdb|4FN4|A Chain A, Short-chain Nad(h)-dependent Dehydrogenase/reductase From Sulfolobus Acidocaldarius Length = 254 Back     alignment and structure
>pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 Back     alignment and structure
>pdb|3TZC|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(Y155f) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|1IY8|A Chain A, Crystal Structure Of Levodione Reductase Length = 267 Back     alignment and structure
>pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|1UZL|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 Back     alignment and structure
>pdb|3FTP|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Burkholderia Pseudomallei At 2.05 A Resolution Length = 270 Back     alignment and structure
>pdb|3PK0|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE SDR FROM Mycobacterium Smegmatis Length = 262 Back     alignment and structure
>pdb|3RKR|A Chain A, Crystal Structure Of A Metagenomic Short-Chain Oxidoreductase (Sdr) In Complex With Nadp Length = 262 Back     alignment and structure
>pdb|1IPE|A Chain A, Tropinone Reductase-Ii Complexed With Nadph Length = 259 Back     alignment and structure
>pdb|2AE2|A Chain A, Tropinone Reductase-Ii Complexed With Nadp+ And Pseudotropine Length = 260 Back     alignment and structure
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure
>pdb|1YXM|A Chain A, Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa Reductase Length = 303 Back     alignment and structure
>pdb|4E3Z|A Chain A, Crystal Structure Of A Oxidoreductase From Rhizobium Etli Cfn 42 Length = 272 Back     alignment and structure
>pdb|3OSU|A Chain A, Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Protein Reductase, Fabg, From Staphylococcus Aureus Length = 246 Back     alignment and structure
>pdb|3IS3|A Chain A, Crystal Structure Of 17beta-Hydroxysteroid Dehydrogenase (Apo Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|3I4F|A Chain A, Structure Of Putative 3-oxoacyl-reductase From Bacillus Thuringiensis Length = 264 Back     alignment and structure
>pdb|1XQ1|A Chain A, X-Ray Structure Of Putative Tropinone Reducatse From Arabidopsis Thaliana Gene At1g07440 Length = 266 Back     alignment and structure
>pdb|3TJR|A Chain A, Crystal Structure Of A Rv0851c Ortholog Short Chain Dehydrogenase From Mycobacterium Paratuberculosis Length = 301 Back     alignment and structure
>pdb|3UN1|A Chain A, Crystal Structure Of An Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 260 Back     alignment and structure
>pdb|3ITD|A Chain A, Crystal Structure Of An Inactive 17beta-Hydroxysteroid Dehydrogenase (Y167f Mutated Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|3OIC|A Chain A, Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl) From B. Subtilis (Apo Form) Length = 258 Back     alignment and structure
>pdb|4FGS|A Chain A, Crystal Structure Of A Probable Dehydrogenase Protein Length = 273 Back     alignment and structure
>pdb|3OP4|A Chain A, Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Nadp+ Length = 248 Back     alignment and structure
>pdb|3CTM|A Chain A, Crystal Structure Of A Carbonyl Reductase From Candida Parapsilosis With Anti-Prelog Stereo-Specificity Length = 279 Back     alignment and structure
>pdb|1UZM|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 Back     alignment and structure
>pdb|2NTN|A Chain A, Crystal Structure Of Maba-c60v/g139a/s144l Length = 267 Back     alignment and structure
>pdb|4E6P|A Chain A, Crystal Structure Of A Probable Sorbitol Dehydrogenase (Target Psi- 012078) From Sinorhizobium Meliloti 1021 Length = 259 Back     alignment and structure
>pdb|3IOY|A Chain A, Structure Of Putative Short-Chain Dehydrogenase (Saro_0793) From Novosphingobium Aromaticivorans Length = 319 Back     alignment and structure
>pdb|2Q2Q|A Chain A, Structure Of D-3-Hydroxybutyrate Dehydrogenase From Pseudomonas Putida Length = 255 Back     alignment and structure
>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|3O38|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 266 Back     alignment and structure
>pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp Length = 273 Back     alignment and structure
>pdb|2EHD|A Chain A, Crystal Structure Analysis Of Oxidoreductase Length = 234 Back     alignment and structure
>pdb|4IQG|C Chain C, Crystal Structure Of Bpro0239 Oxidoreductase From Polaromonas Sp. Js666 In Nadp Bound Form Length = 271 Back     alignment and structure
>pdb|3ENN|A Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE FROM BRUCELLA Melitensis (P43212) Length = 249 Back     alignment and structure
>pdb|3EMK|A Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis Length = 246 Back     alignment and structure
>pdb|1ZEM|A Chain A, Crystal Structure Of Nad+-Bound Xylitol Dehydrogenase Length = 262 Back     alignment and structure
>pdb|1XG5|A Chain A, Structure Of Human Putative Dehydrogenase Mgc4172 In Complex With Nadp Length = 279 Back     alignment and structure
>pdb|3AI1|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Reveals The Structure Bases Of Its Catalytic Mechanism And High Substrate Selectivity Length = 263 Back     alignment and structure
>pdb|2RH4|A Chain A, Actinorhodin Ketoreductase, Actkr, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|1X7G|A Chain A, Actinorhodin Polyketide Ketoreductase, Act Kr, With Nadp Bound Length = 261 Back     alignment and structure
>pdb|3SJU|A Chain A, Hedamycin Polyketide Ketoreductase Bound To Nadph Length = 279 Back     alignment and structure
>pdb|1W4Z|A Chain A, Structure Of Actinorhodin Polyketide (Actiii) Reductase Length = 281 Back     alignment and structure
>pdb|3GVC|A Chain A, Crystal Structure Of Probable Short-Chain Dehydrogenase- Reductase From Mycobacterium Tuberculosis Length = 277 Back     alignment and structure
>pdb|3F9I|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase Rickettsia Prowazekii Length = 249 Back     alignment and structure
>pdb|2CFC|A Chain A, Structural Basis For Stereo Selectivity In The (R)- And (S)- Hydroxypropylethane Thiosulfonate Dehydrogenases Length = 250 Back     alignment and structure
>pdb|4DC1|A Chain A, Crystal Structure Of Y202f Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1ZBQ|A Chain A, Crystal Structure Of Human 17-beta-hydroxysteroid Dehydrogenase Type 4 In Complex With Nad Length = 327 Back     alignment and structure
>pdb|4DC0|A Chain A, Crystal Structure Of F189w Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|4DBZ|A Chain A, Crystal Structure Of V151l Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|2RHR|B Chain B, P94l Actinorhodin Ketordeuctase Mutant, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|1GEG|A Chain A, Cryatal Structure Analysis Of Meso-2,3-Butanediol Dehydrogenase Length = 256 Back     alignment and structure
>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|3CSD|B Chain B, Actinorhodin Polyketide Ketoreductase Mutant P94l Bound To Nadph And The Inhibitor Emodin Length = 281 Back     alignment and structure
>pdb|2C07|A Chain A, Oxoacyl-Acp Reductase Of Plasmodium Falciparum Length = 285 Back     alignment and structure
>pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 Back     alignment and structure
>pdb|2GDZ|A Chain A, Crystal Structure Of 15-Hydroxyprostaglandin Dehydrogenase Type1, Complexed With Nad+ Length = 267 Back     alignment and structure
>pdb|3AI3|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Length = 263 Back     alignment and structure
>pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 Back     alignment and structure
>pdb|2PH3|A Chain A, Crystal Structure Of 3-oxoacyl-[acyl Carrier Protein] Reductase Ttha0415 From Thermus Thermophilus Length = 245 Back     alignment and structure
>pdb|3GK3|A Chain A, Crystal Structure Of Acetoacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 269 Back     alignment and structure
>pdb|3CXR|A Chain A, Crystal Structure Of Gluconate 5-Dehydrogase From Streptococcus Suis Type 2 Length = 291 Back     alignment and structure
>pdb|2NWQ|A Chain A, Short Chain Dehydrogenase From Pseudomonas Aeruginosa Length = 272 Back     alignment and structure
>pdb|1DOH|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And 4-nitro-inden-1-one Length = 283 Back     alignment and structure
>pdb|1YBV|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And An Active Site Inhibitor Length = 283 Back     alignment and structure
>pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3QLJ|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Avium Length = 322 Back     alignment and structure
>pdb|3A28|C Chain C, Crystal Structure Of L-2,3-Butanediol Dehydrogenase Length = 258 Back     alignment and structure
>pdb|1YDE|A Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 Length = 270 Back     alignment and structure
>pdb|2EW8|A Chain A, Crystal Structure Of The (s)-specific 1-phenylethanol Dehydrogenase Of The Denitrifying Bacterium Strain Ebn1 Length = 249 Back     alignment and structure
>pdb|3KSU|A Chain A, Crystal Structure Of Short-Chain Dehydrogenase From Oenococcus Oeni Psu-1 Length = 262 Back     alignment and structure
>pdb|3GED|A Chain A, Fingerprint And Structural Analysis Of A Apo Scor Enzyme From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From Mycobacterium Paratuberculosis Bound To Nicotinamide Adenine Dinucleotide Length = 280 Back     alignment and structure
>pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 Back     alignment and structure
>pdb|1GZ6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 Length = 319 Back     alignment and structure
>pdb|3R3S|A Chain A, Structure Of The Ygha Oxidoreductase From Salmonella Enterica Length = 294 Back     alignment and structure
>pdb|3RIH|A Chain A, Crystal Structure Of A Putative Short Chain Dehydrogenase Or Reductase From Mycobacterium Abscessus Length = 293 Back     alignment and structure
>pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3EZL|A Chain A, Crystal Structure Of Acetyacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 256 Back     alignment and structure
>pdb|4B79|A Chain A, The Aeropath Project And Pseudomonas Aeruginosa High-throughput Crystallographic Studies For Assessment Of Potential Targets In Early Stage Drug Discovery. Length = 242 Back     alignment and structure
>pdb|1ZJY|A Chain A, Structure Of R-Specific Alcohol Dehydrogenase (Mutant G37d) From Lactobacillus Brevis In Complex With Phenylethanol And Nadh Length = 251 Back     alignment and structure
>pdb|4IIN|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Helicobacter Pylori 26695 Complexed With Nad+ Length = 271 Back     alignment and structure
>pdb|4AFN|A Chain A, Crystal Structure Of 3-ketoacyl-(acyl-carrier-protein) Reductase (fabg) From Pseudomonas Aeruginosa At 2.3a Resolution Length = 269 Back     alignment and structure
>pdb|2JAP|A Chain A, Clavulanic Acid Dehydrogenase: Structural And Biochemical Analysis Of The Final Step In The Biosynthesis Of The Beta- Lactamase Inhibitor Clavulanic Acid Length = 247 Back     alignment and structure
>pdb|3AFM|A Chain A, Crystal Structure Of Aldose Reductase A1-R Responsible For Alginate Metabolism Length = 258 Back     alignment and structure
>pdb|1XKQ|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE OF Unknown Function From Caenorhabditis Elegans With Cofactor Length = 280 Back     alignment and structure
>pdb|3AK4|A Chain A, Crystal Structure Of Nadh-Dependent Quinuclidinone Reductase From Agrobacterium Tumefaciens Length = 263 Back     alignment and structure
>pdb|2ET6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candida Tropicalis Peroxisomal Multifunctional Enzyme Type 2 Length = 604 Back     alignment and structure
>pdb|1JA9|A Chain A, Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalene Reductase In Complex With Nadph And Pyroquilon Length = 274 Back     alignment and structure
>pdb|1ULS|A Chain A, Crystal Structure Of Tt0140 From Thermus Thermophilus Hb8 Length = 245 Back     alignment and structure
>pdb|4DQX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Rhizobium Etli Cfn 42 Length = 277 Back     alignment and structure
>pdb|4DA9|A Chain A, Crystal Structure Of Putative Short-Chain DehydrogenaseREDUCTASE FROM Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|2ZK7|A Chain A, Structure Of A C-Terminal Deletion Mutant Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (Aldt) Length = 257 Back     alignment and structure
>pdb|2DTD|A Chain A, Structure Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (aldt) In Ligand-free Form Length = 264 Back     alignment and structure
>pdb|1XHL|A Chain A, Crystal Structure Of Putative Tropinone Reductase-Ii From Caenorhabditis Elegans With Cofactor And Substrate Length = 297 Back     alignment and structure
>pdb|3L6E|A Chain A, Crystal Structure Of Putative Short Chain DehydrogenaseREDUCTASE Family Oxidoreductase From Aeromonas Hydrophila Subsp. Hydrophila Atcc 7966 Length = 235 Back     alignment and structure
>pdb|3TZQ|B Chain B, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 271 Back     alignment and structure
>pdb|3V2G|A Chain A, Crystal Structure Of A DehydrogenaseREDUCTASE FROM SINORHIZOBIUM Meliloti 1021 Length = 271 Back     alignment and structure
>pdb|3GAF|A Chain A, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid Dehydrogenase From Brucella Melitensis Length = 256 Back     alignment and structure
>pdb|2B4Q|A Chain A, Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex Length = 276 Back     alignment and structure
>pdb|2D1Y|A Chain A, Crystal Structure Of Tt0321 From Thermus Thermophilus Hb8 Length = 256 Back     alignment and structure
>pdb|2FWM|X Chain X, Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodihydroxy Benzoate Dehydrogenase Length = 250 Back     alignment and structure
>pdb|1CYD|A Chain A, Carbonyl Reductase Complexed With Nadph And 2-Propanol Length = 244 Back     alignment and structure
>pdb|3M1A|A Chain A, The Crystal Structure Of A Short-Chain Dehydrogenase From Streptomyces Avermitilis To 2a Length = 281 Back     alignment and structure
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 7e-46
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 4e-41
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 6e-41
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-40
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 3e-40
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 7e-40
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 2e-39
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 3e-39
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 2e-38
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 6e-38
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 6e-38
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 1e-37
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 2e-37
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 3e-37
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 3e-37
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 3e-37
3imf_A257 Short chain dehydrogenase; structural genomics, in 4e-37
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 4e-37
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 6e-37
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 7e-37
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 9e-37
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 1e-36
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 1e-36
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 1e-36
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 2e-36
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 6e-36
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 6e-36
3tjr_A301 Short chain dehydrogenase; structural genomics, se 6e-36
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 7e-36
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 9e-36
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 2e-35
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 3e-35
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 3e-35
1spx_A278 Short-chain reductase family member (5L265); paral 4e-35
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 5e-35
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 5e-35
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 5e-35
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 8e-35
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 1e-34
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 1e-34
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 2e-34
1xq1_A266 Putative tropinone reducatse; structural genomics, 2e-34
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 2e-34
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 2e-34
4eso_A255 Putative oxidoreductase; NADP, structural genomics 3e-34
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 3e-34
3tox_A280 Short chain dehydrogenase; structural genomics, PS 4e-34
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 5e-34
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 5e-34
1xhl_A297 Short-chain dehydrogenase/reductase family member 6e-34
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 8e-34
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 1e-33
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 1e-33
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 2e-33
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 2e-33
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 3e-33
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 4e-33
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 4e-33
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 5e-33
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 5e-33
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 5e-33
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 6e-33
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 8e-33
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 8e-33
3edm_A259 Short chain dehydrogenase; structural genomics, ox 9e-33
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 9e-33
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 1e-32
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 1e-32
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-32
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 1e-32
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 1e-32
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 2e-32
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 2e-32
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 2e-32
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 2e-32
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 3e-32
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 3e-32
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 4e-32
1xkq_A280 Short-chain reductase family member (5D234); parra 6e-32
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 6e-32
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 8e-32
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 1e-31
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-31
3e03_A274 Short chain dehydrogenase; structural genomics, PS 1e-31
1nff_A260 Putative oxidoreductase RV2002; directed evolution 1e-31
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 2e-31
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 2e-31
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 2e-31
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 2e-31
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 2e-31
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 2e-31
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 3e-31
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 3e-31
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 4e-31
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 4e-31
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 4e-31
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 4e-31
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 5e-31
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 6e-31
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 7e-31
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 9e-31
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 1e-30
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 1e-30
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 1e-30
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 2e-30
3gem_A260 Short chain dehydrogenase; structural genomics, AP 2e-30
4e4y_A244 Short chain dehydrogenase family protein; structur 3e-30
4dqx_A277 Probable oxidoreductase protein; structural genomi 5e-30
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 7e-30
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 8e-30
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 9e-30
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 1e-29
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 1e-29
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 1e-29
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 3e-29
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 6e-29
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 6e-29
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 7e-29
3cxt_A291 Dehydrogenase with different specificities; rossma 1e-28
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 1e-28
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 2e-28
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 2e-28
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 6e-28
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 1e-27
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 1e-27
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 2e-27
3rih_A293 Short chain dehydrogenase or reductase; structural 4e-27
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 5e-27
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 9e-27
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 1e-26
3tsc_A277 Putative oxidoreductase; structural genomics, seat 7e-26
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 8e-26
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 1e-25
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 1e-25
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 2e-25
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 3e-25
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 6e-25
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 6e-25
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 7e-25
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 1e-24
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 2e-24
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 2e-24
1ooe_A236 Dihydropteridine reductase; structural genomics, P 2e-24
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 6e-24
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 7e-24
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 7e-24
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 8e-24
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 8e-24
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 9e-24
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 1e-23
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 3e-23
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 3e-23
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 4e-23
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 4e-23
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 4e-23
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 5e-23
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 7e-23
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 8e-23
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 1e-22
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 1e-22
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 2e-22
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 2e-22
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 2e-22
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 3e-22
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 4e-22
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 8e-22
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 1e-21
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 2e-21
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 2e-21
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 4e-21
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 1e-18
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 5e-21
3qlj_A322 Short chain dehydrogenase; structural genomics, se 7e-21
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 8e-21
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 1e-20
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 2e-20
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 2e-20
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 3e-20
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 4e-20
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 9e-20
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 3e-19
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 5e-17
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 5e-17
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 9e-17
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 3e-15
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 1e-10
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 2e-06
3slk_A795 Polyketide synthase extender module 2; rossmann fo 3e-05
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
 Score =  159 bits (404), Expect = 7e-46
 Identities = 51/234 (21%), Positives = 102/234 (43%), Gaps = 29/234 (12%)

Query: 178 RNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSK 237
            ++++TG+  GLG+AL    +  G +V +  R  + ++     L           G    
Sbjct: 4   GHIIVTGAGSGLGRALTIGLVERGHQVSMMGRRYQRLQQQELLL-----------GN--- 49

Query: 238 KNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIE 297
                  V GI  D+    DV      AV   G  ++ ++ AGT + F P+  +T E+I 
Sbjct: 50  ------AVIGIVADLAHHEDVDVAFAAAVEWGGLPELVLHCAGTGE-FGPVGVYTAEQIR 102

Query: 298 QIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQ 357
           +++ +NLV +IL  ++ +R++ ++  GG + N+  + +        ++Y ++K G+R   
Sbjct: 103 RVMESNLVSTILVAQQTVRLIGER--GGVLANV-LSSAAQVGKANESLYCASKWGMRGFL 159

Query: 358 ASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLV 411
            SL  E K S + +    P  + ++   +   +            PE  A  ++
Sbjct: 160 ESLRAELKDSPLRLVNLYPSGIRSEFWDNTDHVDPSGFMT-----PEDAAAYML 208
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Length = 287 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 100.0
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 100.0
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 100.0
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 100.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 100.0
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 100.0
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 100.0
3tsc_A277 Putative oxidoreductase; structural genomics, seat 100.0
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 100.0
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 100.0
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 100.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 100.0
3imf_A257 Short chain dehydrogenase; structural genomics, in 100.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 100.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 100.0
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 100.0
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 100.0
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 100.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 100.0
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 100.0
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 100.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 100.0
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 100.0
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 100.0
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 100.0
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 100.0
3rih_A293 Short chain dehydrogenase or reductase; structural 100.0
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 100.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 100.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 100.0
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 100.0
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 100.0
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 100.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 100.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 100.0
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 100.0
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 100.0
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 100.0
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 100.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 100.0
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 100.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 100.0
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 100.0
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 100.0
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 100.0
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 100.0
3edm_A259 Short chain dehydrogenase; structural genomics, ox 100.0
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 100.0
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 100.0
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 100.0
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 100.0
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 100.0
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 100.0
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 100.0
3cxt_A291 Dehydrogenase with different specificities; rossma 100.0
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 100.0
3e03_A274 Short chain dehydrogenase; structural genomics, PS 100.0
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 100.0
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 100.0
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 100.0
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 100.0
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 100.0
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 100.0
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 100.0
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 100.0
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 100.0
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 100.0
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 100.0
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 100.0
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 100.0
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 100.0
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 100.0
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 100.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 100.0
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 100.0
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 100.0
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 100.0
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 100.0
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 100.0
1xhl_A297 Short-chain dehydrogenase/reductase family member 100.0
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 100.0
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 100.0
1xkq_A280 Short-chain reductase family member (5D234); parra 100.0
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 100.0
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 100.0
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 100.0
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 100.0
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 100.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 100.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 100.0
3gem_A260 Short chain dehydrogenase; structural genomics, AP 100.0
1spx_A278 Short-chain reductase family member (5L265); paral 100.0
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 100.0
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 100.0
3tjr_A301 Short chain dehydrogenase; structural genomics, se 100.0
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 100.0
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 100.0
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 100.0
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 100.0
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 100.0
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 100.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 100.0
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 100.0
3qlj_A322 Short chain dehydrogenase; structural genomics, se 100.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 100.0
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 100.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 100.0
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 100.0
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 100.0
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 100.0
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 100.0
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 100.0
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 100.0
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 100.0
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 100.0
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 100.0
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 100.0
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 100.0
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 100.0
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 100.0
1xq1_A266 Putative tropinone reducatse; structural genomics, 100.0
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 100.0
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 100.0
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 100.0
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 100.0
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 100.0
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 100.0
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 100.0
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 100.0
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 100.0
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 100.0
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 100.0
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 100.0
4e4y_A244 Short chain dehydrogenase family protein; structur 100.0
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 100.0
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 100.0
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 100.0
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 100.0
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 100.0
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 100.0
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 100.0
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 100.0
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 100.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 100.0
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 100.0
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 100.0
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 100.0
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 100.0
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 100.0
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 100.0
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 100.0
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 100.0
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 100.0
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 100.0
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 100.0
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 100.0
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 100.0
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 100.0
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 100.0
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 100.0
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 100.0
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 100.0
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 100.0
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 100.0
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 100.0
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 100.0
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 100.0
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 100.0
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 100.0
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 100.0
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 100.0
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 100.0
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 100.0
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 100.0
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 100.0
1ooe_A236 Dihydropteridine reductase; structural genomics, P 100.0
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 100.0
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 100.0
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 100.0
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 100.0
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 100.0
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.97
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.97
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.97
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.97
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.96
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.96
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.96
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.96
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.95
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.94
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.94
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.94
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.94
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.92
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.92
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.9
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.87
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.84
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.84
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.84
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.83
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.83
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.81
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.81
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.81
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.8
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.8
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.79
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.79
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.78
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.78
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.78
1xq6_A253 Unknown protein; structural genomics, protein stru 99.77
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.77
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.77
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.77
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.77
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.76
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.76
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.76
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.76
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.75
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.75
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.74
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.74
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.74
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.73
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.73
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.73
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.73
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.73
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.72
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.72
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.72
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.72
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.72
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.72
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.71
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.71
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.71
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.71
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.71
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.71
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.7
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.7
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.69
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.69
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.69
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.68
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.67
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.66
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.66
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.66
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.66
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.66
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.63
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.62
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.61
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.61
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.6
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.59
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.59
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.58
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.58
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.56
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.51
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.51
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.51
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.51
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.5
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.5
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.49
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.47
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.47
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.45
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.45
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.37
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.36
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.34
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.34
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.33
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.33
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.28
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.27
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 99.25
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.25
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 99.15
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 98.83
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.79
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 98.76
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 98.51
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.46
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 98.45
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.41
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 98.4
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.33
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.29
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 98.29
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.21
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.13
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.07
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.04
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.03
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 98.0
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.98
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.98
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.95
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 97.93
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 97.92
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 97.91
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.87
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 97.87
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.84
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 97.77
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.74
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 97.71
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.66
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.64
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.63
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 97.57
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 97.56
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 97.54
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 97.53
3gms_A340 Putative NADPH:quinone reductase; structural genom 97.47
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 97.33
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.32
4eye_A342 Probable oxidoreductase; structural genomics, niai 97.31
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.29
3krt_A456 Crotonyl COA reductase; structural genomics, prote 97.28
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.27
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.26
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 97.24
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.23
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.22
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.18
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 97.14
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 97.1
3fbg_A346 Putative arginate lyase; structural genomics, unkn 97.08
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.99
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 96.99
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 96.99
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 96.94
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.92
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 96.9
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.89
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.88
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.82
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 96.79
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.78
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.77
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.76
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.69
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.67
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.61
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.6
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 96.57
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 96.56
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 96.53
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 96.47
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 96.47
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 96.4
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.38
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.35
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 96.34
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 96.34
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.34
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 96.27
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 96.27
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 96.18
3tl2_A315 Malate dehydrogenase; center for structural genomi 96.16
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 96.16
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 96.1
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 96.09
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 96.08
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 96.06
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 96.05
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 95.97
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.95
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 95.91
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.91
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 95.89
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 95.89
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 95.88
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 95.82
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 95.81
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 95.8
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 95.79
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 95.76
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 95.73
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.7
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 95.7
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 95.7
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 95.69
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 95.68
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 95.67
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 95.65
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 95.61
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 95.56
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.5
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.43
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 95.42
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.42
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.4
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 95.32
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 95.28
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 95.27
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 95.19
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 95.16
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 95.13
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 95.03
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 95.0
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 94.98
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 94.87
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 94.86
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.8
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 94.75
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 94.71
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 94.69
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 94.64
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 94.63
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 94.48
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 94.39
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.34
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 94.32
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 94.31
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 94.26
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 94.18
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.13
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 94.04
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 94.03
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 93.99
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 93.98
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.75
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 93.73
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 93.55
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 93.54
3p2o_A285 Bifunctional protein fold; structural genomics, ce 93.5
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 93.49
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 93.46
2rir_A300 Dipicolinate synthase, A chain; structural genomic 93.43
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 93.43
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 93.41
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 93.33
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 93.32
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 93.2
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 93.17
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 93.1
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 93.0
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 92.99
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 92.95
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 92.95
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 92.95
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 92.88
4g65_A 461 TRK system potassium uptake protein TRKA; structur 92.83
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 92.54
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 92.51
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 92.4
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 92.32
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 92.3
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 92.15
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 92.1
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 91.92
1lnq_A336 MTHK channels, potassium channel related protein; 91.87
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 91.78
3l07_A285 Bifunctional protein fold; structural genomics, ID 91.69
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 91.65
3qha_A296 Putative oxidoreductase; seattle structural genomi 91.65
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 91.59
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 91.51
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 91.48
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 91.42
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=100.00  E-value=1.8e-50  Score=399.84  Aligned_cols=251  Identities=24%  Similarity=0.320  Sum_probs=224.2

Q ss_pred             cCCCCCCEEEEECCCChHHHHHHHHHHHCCCEEEEEEcChhhHHHHHHHHHHHHhhhhhhcCCCCcccccCceEEEEEcc
Q 010380          172 HCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACD  251 (512)
Q Consensus       172 ~~~l~gk~vLVTGassGIG~aiA~~La~~Ga~Vvl~~R~~~~l~~~~~el~~~~~~~~~~~g~~~~~~~~g~~v~~v~~D  251 (512)
                      +++|+||++|||||++|||+++|+.|+++|++|++++|++++++++.+++++                 .+.++.+++||
T Consensus         2 y~sL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~~~~~~~~~~~~~~i~~-----------------~g~~~~~~~~D   64 (254)
T 4fn4_A            2 YQSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRG-----------------MGKEVLGVKAD   64 (254)
T ss_dssp             CGGGTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHH-----------------TTCCEEEEECC
T ss_pred             CCCCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEECCHHHHHHHHHHHHh-----------------cCCcEEEEEcc
Confidence            3578999999999999999999999999999999999999999999999876                 46789999999


Q ss_pred             CCChhhHHHHHHHHHHHcCCCcccccccccCCCCCCCcCCCHHHHHHHHHhhhhhHHHHHHHHHHHHHhCCCCCeEEeec
Q 010380          252 VCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMD  331 (512)
Q Consensus       252 ltd~~sv~~~~~~i~~~~g~IDvLInnAG~~~~~~~~~~~s~e~~~~~~~vNv~g~~~l~k~~lp~m~~~~~~g~IV~vS  331 (512)
                      ++|+++++++++++.++||+||+||||||+..+..++.++++|+|++++++|+.|+|+++|+++|+|+++ ++|+|||+|
T Consensus        65 vt~~~~v~~~~~~~~~~~G~iDiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~-~~G~IVnis  143 (254)
T 4fn4_A           65 VSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQ-GKGVIVNTA  143 (254)
T ss_dssp             TTSHHHHHHHHHHHHHHHSCCCEEEECCCCCCTTCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHH-TCEEEEEEC
T ss_pred             CCCHHHHHHHHHHHHHHcCCCCEEEECCcccCCCCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHHHHHc-CCcEEEEEe
Confidence            9999999999999999999999999999987656789999999999999999999999999999999987 679999999


Q ss_pred             CCCCCCCCCCCcchhhHHHHHHHHHHHHHHHHhCCCCeEEEEEeCCcccCCcccCCcchhhhhhhhhhcCCHHHHHHHhc
Q 010380          332 GAGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLV  411 (512)
Q Consensus       332 S~~a~~~~~p~~~~Y~aSKaAl~~l~~sLa~El~~~GIrVn~V~PG~V~T~~~~~~~~~~~~~~~~~~~~~pe~vA~~~l  411 (512)
                      |. ++..+.|+..+|++||+|+.+|+++||.|++++|||||+|+||+|+|||..............      ......++
T Consensus       144 S~-~g~~~~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~------~~~~~~~~  216 (254)
T 4fn4_A          144 SI-AGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQGIRAVAVLPGTVKTNIGLGSSKPSELGMRT------LTKLMSLS  216 (254)
T ss_dssp             CG-GGTCSSSSCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEECSBCSSCTTSCSSCCHHHHHH------HHHHHTTC
T ss_pred             ch-hhcCCCCCChHHHHHHHHHHHHHHHHHHHhhhhCeEEEEEEeCCCCCcccccccCCcHHHHHH------HHhcCCCC
Confidence            98 788889999999999999999999999999999999999999999999975543222111110      11122467


Q ss_pred             cccccchhhhhhhhhcCChHHHHHHHHHHhccCccc
Q 010380          412 PRIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWF  447 (512)
Q Consensus       412 ~r~~~~~~va~~v~~L~s~~~~~~~~~~~~~~g~~~  447 (512)
                      +|+..|+|+++++.||+|+...+.++..+..||+|.
T Consensus       217 ~R~g~pediA~~v~fLaSd~a~~iTG~~i~VDGG~t  252 (254)
T 4fn4_A          217 SRLAEPEDIANVIVFLASDEASFVNGDAVVVDGGLT  252 (254)
T ss_dssp             CCCBCHHHHHHHHHHHHSGGGTTCCSCEEEESTTGG
T ss_pred             CCCcCHHHHHHHHHHHhCchhcCCcCCEEEeCCCcc
Confidence            999999999999999999999999999999999874
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 512
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 9e-37
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 1e-35
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 1e-34
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 5e-34
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 2e-32
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 3e-32
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 4e-32
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 6e-32
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 1e-31
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 1e-31
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 2e-31
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 3e-31
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 4e-31
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 5e-31
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 8e-31
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 1e-30
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 5e-30
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 3e-29
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 5e-29
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 5e-29
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 6e-29
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 1e-28
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 1e-28
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 2e-28
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 2e-28
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 2e-28
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 4e-28
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-28
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 2e-27
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 3e-27
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 5e-27
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 5e-26
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 4e-25
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 6e-25
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 1e-24
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 2e-24
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 3e-24
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 6e-24
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 7e-24
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 3e-23
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 3e-23
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-23
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 2e-22
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 2e-22
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-22
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 7e-22
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 1e-21
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 4e-21
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 4e-21
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 5e-21
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 2e-20
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 5e-20
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 8e-18
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 8e-16
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-15
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 3e-15
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 5e-15
d1e7wa_284 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 7e-14
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 8e-14
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 1e-10
d1uh5a_329 c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite 2e-10
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 8e-10
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 2e-09
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 2e-08
d2pd4a1274 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacte 6e-08
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 1e-07
d1d7oa_297 c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (B 2e-06
d2h7ma1268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 2e-04
d1xgka_350 c.2.1.2 (A:) Negative transcriptional regulator Nm 4e-04
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 0.002
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 0.003
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Putative dehydrogenase ARPG836 (MGC4172)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  134 bits (339), Expect = 9e-37
 Identities = 54/242 (22%), Positives = 103/242 (42%), Gaps = 24/242 (9%)

Query: 178 RNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSK 237
           R  ++TG++ G+G A+AR  +  G +VV  +R+  ++     E +     G         
Sbjct: 11  RLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPG--------- 61

Query: 238 KNLVHAKVAGIACDVCEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIE 297
                  +    CD+    D+  + +   ++   +DI INNAG  +    LL  +    +
Sbjct: 62  ------TLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGLAR-PDTLLSGSTSGWK 114

Query: 298 QIVSTNLVGSILCTREAMRVMRDQ-PKGGHIFNM-DGAGSGGSSTPLTAVYGSTKCGLRQ 355
            + + N++   +CTREA + M+++    GHI N+   +G       +T  Y +TK  +  
Sbjct: 115 DMFNVNVLALSICTREAYQSMKERNVDDGHIININSMSGHRVLPLSVTHFYSATKYAVTA 174

Query: 356 LQASLFKESKRSKVG--VHTASPGMVLTDLLLSGSTIQNKQMFNIICEL----PETVART 409
           L   L +E + ++        SPG+V T           ++      ++    PE VA  
Sbjct: 175 LTEGLRQELREAQTHIRATCISPGVVETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEA 234

Query: 410 LV 411
           ++
Sbjct: 235 VI 236
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Length = 284 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Length = 274 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 100.0
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 100.0
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 100.0
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 100.0
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 100.0
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 100.0
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 100.0
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 100.0
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 100.0
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 100.0
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 100.0
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 100.0
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 100.0
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 100.0
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 100.0
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 100.0
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 100.0
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.98
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.97
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.96
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.74
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.62
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.54
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.51
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.49
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.49
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.48
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.44
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.44
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.43
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.39
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.36
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.35
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.34
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.33
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.32
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.3
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.27
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.26
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.24
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.24
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.23
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.21
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.07
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.94
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.9
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.84
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.75
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.74
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.74
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.59
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.47
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.58
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.57
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.49
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.37
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.31
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.24
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.19
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.18
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.17
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.13
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.06
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.98
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 96.94
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.92
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.91
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.9
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.81
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.78
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.76
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 96.6
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.6
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.5
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.31
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.29
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.28
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.26
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.18
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.16
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.11
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 96.1
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 96.1
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.03
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.03
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.02
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.94
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.9
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.9
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.88
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.87
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.75
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.75
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.69
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.67
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 95.63
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.62
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.6
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.36
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.35
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.33
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.28
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.26
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.19
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.13
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 95.05
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.97
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.95
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 94.95
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.87
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.81
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.73
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.72
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.62
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.6
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.55
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 94.48
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.46
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.15
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.47
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 93.17
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 92.89
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 92.4
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 92.3
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 92.14
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 91.85
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 91.77
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 91.04
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.8
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 90.68
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.48
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.16
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 90.1
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 90.03
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 89.8
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 89.78
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 89.44
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 89.38
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 89.29
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 89.01
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 88.99
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 88.64
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 88.05
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 87.86
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 87.75
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 87.73
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 87.72
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 87.7
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 87.65
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 87.59
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 87.56
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 87.52
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 87.43
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 87.34
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.19
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.62
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 86.6
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 86.48
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 86.46
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 86.43
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 86.35
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 86.3
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 86.1
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 86.04
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 85.83
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 85.57
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 84.97
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 84.92
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 84.81
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 84.18
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 84.16
d2fr1a2209 Erythromycin synthase, eryAI, 1st ketoreductase mo 83.99
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 83.62
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 83.51
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 82.92
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 82.78
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 82.7
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 82.64
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 82.47
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 82.4
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 81.13
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 81.11
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 81.07
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 80.38
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Gluconate 5-dehydrogenase
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=2.2e-48  Score=382.42  Aligned_cols=249  Identities=26%  Similarity=0.369  Sum_probs=221.9

Q ss_pred             CCCCCCEEEEECCCChHHHHHHHHHHHCCCEEEEEEcChhhHHHHHHHHHHHHhhhhhhcCCCCcccccCceEEEEEccC
Q 010380          173 CKAGPRNVVITGSTRGLGKALAREFLLSGDRVVVASRSSESVRMTVTELEENLKEGMMAAGGSSKKNLVHAKVAGIACDV  252 (512)
Q Consensus       173 ~~l~gk~vLVTGassGIG~aiA~~La~~Ga~Vvl~~R~~~~l~~~~~el~~~~~~~~~~~g~~~~~~~~g~~v~~v~~Dl  252 (512)
                      ++++||++|||||++|||+++|++|+++|++|++++|+.++++++.+++.+.                .+.++.+++||+
T Consensus         1 f~l~gK~~lITGas~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~----------------~g~~~~~~~~Dv   64 (251)
T d1vl8a_           1 FDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRNLEEASEAAQKLTEK----------------YGVETMAFRCDV   64 (251)
T ss_dssp             CCCTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHH----------------HCCCEEEEECCT
T ss_pred             CCCCCCEEEEeCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH----------------hCCcEEEEEccC
Confidence            4789999999999999999999999999999999999999999998888664                356889999999


Q ss_pred             CChhhHHHHHHHHHHHcCCCcccccccccCCCCCCCcCCCHHHHHHHHHhhhhhHHHHHHHHHHHHHhCCCCCeEEeecC
Q 010380          253 CEPADVQKLSNFAVNEFGSIDIWINNAGTNKGFKPLLQFTNEEIEQIVSTNLVGSILCTREAMRVMRDQPKGGHIFNMDG  332 (512)
Q Consensus       253 td~~sv~~~~~~i~~~~g~IDvLInnAG~~~~~~~~~~~s~e~~~~~~~vNv~g~~~l~k~~lp~m~~~~~~g~IV~vSS  332 (512)
                      +|+++++++++++.+++|+||+||||||+.. ..++.+++.|+|++++++|+.++++++|+++|+|+++ +.|+||+++|
T Consensus        65 ~~~~~v~~~~~~~~~~~g~iDiLVnnAG~~~-~~~~~~~~~e~~~~~~~vNl~~~~~~~~~~~~~m~~~-~~G~Ii~i~S  142 (251)
T d1vl8a_          65 SNYEEVKKLLEAVKEKFGKLDTVVNAAGINR-RHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRES-DNPSIINIGS  142 (251)
T ss_dssp             TCHHHHHHHHHHHHHHHSCCCEEEECCCCCC-CCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHTTC-SSCEEEEECC
T ss_pred             CCHHHHHHHHHHHHHHcCCCCEEEECCCCCC-CCChhhCCHHHHHHHHHhhhhhhhhhhhhhhhccccc-cccccccccc
Confidence            9999999999999999999999999999876 7899999999999999999999999999999999987 6789999998


Q ss_pred             CCCCCCCCCCcchhhHHHHHHHHHHHHHHHHhCCCCeEEEEEeCCcccCCcccCCcchhhhhhhhhhcCCHHHHHHHhcc
Q 010380          333 AGSGGSSTPLTAVYGSTKCGLRQLQASLFKESKRSKVGVHTASPGMVLTDLLLSGSTIQNKQMFNIICELPETVARTLVP  412 (512)
Q Consensus       333 ~~a~~~~~p~~~~Y~aSKaAl~~l~~sLa~El~~~GIrVn~V~PG~V~T~~~~~~~~~~~~~~~~~~~~~pe~vA~~~l~  412 (512)
                      ..+...+.++..+|++||+|+++|+++|+.|++++|||||+|+||+|+|+|........  +.      ..+...+.+++
T Consensus       143 ~~~~~~~~~~~~~Y~asKaal~~lt~~lA~e~~~~gIrVN~I~PG~i~T~~~~~~~~~~--~~------~~~~~~~~pl~  214 (251)
T d1vl8a_         143 LTVEEVTMPNISAYAASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKMTEAVFSDP--EK------LDYMLKRIPLG  214 (251)
T ss_dssp             GGGTCCCSSSCHHHHHHHHHHHHHHHHHHHHHGGGTCEEEEEEECCBCSTTTHHHHTCH--HH------HHHHHHTCTTS
T ss_pred             chhccccCccccchHHHHHhHHHHHHHHHHHhcccCeEEEEEeeCcccCHHHHhccCCH--HH------HHHHHhcCCCC
Confidence            74456677889999999999999999999999999999999999999999974321110  00      12234456789


Q ss_pred             ccccchhhhhhhhhcCChHHHHHHHHHHhccCccc
Q 010380          413 RIRVVKGSGKAINYLTPPRILLALVTAWLRRGRWF  447 (512)
Q Consensus       413 r~~~~~~va~~v~~L~s~~~~~~~~~~~~~~g~~~  447 (512)
                      |+..|+|+++++.||++++..+.++..+..||+|.
T Consensus       215 R~~~pedvA~~v~fL~S~~a~~itG~~i~vDGG~t  249 (251)
T d1vl8a_         215 RTGVPEDLKGVAVFLASEEAKYVTGQIIFVDGGWT  249 (251)
T ss_dssp             SCBCGGGGHHHHHHHHSGGGTTCCSCEEEESTTGG
T ss_pred             CCCCHHHHHHHHHHHhCchhCCCcCcEEEeCcCee
Confidence            99999999999999999999999999999999884
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fr1a2 c.2.1.2 (A:1448-1656) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure