Citrus Sinensis ID: 010437

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MENGESIRGPFCWSTYQTDSAEDTHTHISSLSLSLSLLLFLSSFLFFLGCVWGVGKREKIKENNAMAVTQRGICLCFAVVLMLFVGVLASVRNEQDVSVSRKMKAESSMNSTMAAKAEVVAEALSKHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPRDDDPVNPKPGTLRHAVIQDKPLWIVFKRDMVIQLKQELIVNSFKTIDGRGANVHIANGGCITIQFVTNVIIHGLHVHDCKPTGNAMVRSSPTHYGWRTVADGDAISIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITISNNHMTHHNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPSGAGASASYARASSLGAKSSSMVGSITSGAGALTCRKSRQCS
cccccccccccEECccccccccccccEEccHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccccHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccHHHHHHccccEEEEEEEcEEEEEccEEEEcccccccccccEEEEEECccEEEEEEcEEEEEEEEEEEcccccccccccccccccccccccccEEEEEccccEEEEcccccccccccEEEEEccEEEEEEEEEEcccccCEEcccccccccccccEEEEEccccccccccccccccccEEEEEccEECccccEEECcccccCEEECccEEEccccccccccccccccccccccccCEEccccEEcccccccccccccccccccccccccccccccccccccccccccccccccc
*****SI*GPFCWSTYQTDSAEDTHTHISSLSLSLSLLLFLSSFLFFLGCVWGVGKREKIKENNAMAVTQRGICLCFAVVLMLFVGVLASVRNEQDVSVSRKMKAESSMNSTMAAKAEVVAEALSKHAVDNPDEIA**************KLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPRDDDPVNPKPGTLRHAVIQDKPLWIVFKRDMVIQLKQELIVNSFKTIDGRGANVHIANGGCITIQFVTNVIIHGLHVHDCKPTGNAMVRSSPTHYGWRTVADGDAISIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITISNNHMTHHNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPSGAG*********S**********SITSGAGALTCRKSRQC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENGESIRGPFCWSTYQTDSAEDTHTHISSLSLSLSLLLFLSSFLFFLGCVWGVGKREKIKENNAMAVTQRGICLCFAVVLMLFVGVLASVRNEQDVSVSRKMKAESSMNSTMAAKAEVVAEALSKHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPRDDDPVNPKPGTLRHAVIQDKPLWIVFKRDMVIQLKQELIVNSFKTIDGRGANVHIANGGCITIQFVTNVIIHGLHVHDCKPTGNAMVRSSPTHYGWRTVADGDAISIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITISNNHMTHHNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAPLNAFAKEVTKRVDTAASQWKGWNWRSEGDLLLNGAYFTPSGAGASASYARASSLGAKSSSMVGSITSGAGALTCRKSRQCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable pectate lyase 15 confidentQ944R1
Probable pectate lyase 1 probableQ940Q1
Pectate lyase Involved in the degradation of pectin. May assist in the removal and modification of an existing pectin matrix in order to allow the deposition of newly synthesized walls polymers for a specialized function or to create an architecture that is extensible.probableO24554

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.2.-.-Carbon-oxygen lyases.probable
4.2.2.-Acting on polysaccharides.probable
4.2.2.2Pectate lyase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PXZ, chain A
Confidence level:very confident
Coverage over the Query: 160-502
View the alignment between query and template
View the model in PyMOL