Citrus Sinensis ID: 010461

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MISNVASHQSPASVPERESCAEHRNHVAWTSVKQERWEGELVVEGEIPSWLNGTYLRNGPGVWHIGEFNFGHLFDGYAMLVKVHFEKNGRLIAGHRQIETEAYKAAKKNKKLCYREFSVSPKPDNFLAYVGELAKLFSGASLTDNANNGIYKLGDGRIICLTETQKGSVIVDPDTLDTLGKFEYSDPLGGFIQSSHPIVTDDEFLTLLPDLLNPGYLVVRMEPGTNERKVIGRVNCRGGPAPGWVHSFTMTEHYVVVPEMPLQYSVQSLLKAEPSALYQFEWRPERKAFLHVVCKASGKIAASVEVPLYMVFHFINAYEEKDKDGRVIAVIADCCEHNADTTIIETLSLKNLRSFHGQDVLPDARVGRFTIPFDGSQFGKLETVMDPEEHGRGVDMCSINPAYLGKKYRYAYAIGAKRPCNFPNSLTKLDLVKQKAKNWCEEGIVPSEPLFVARPGATDEDDGVVISMISEKNGGAYVVLLDGSTFEEIARARFPFGLPYGFHGCWVPEN
cccccccccccccccccccccccccccccccccccccccccEEEEEccccccCEEEECcccccccccccccccccccccEEEEEEccccEEEEEEEEcccHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccEEEEEccccEEEEEEcccccEEEccccccccccccccccccccccccccccccccccEEEccccccccEEEEEECcccccEEEEEEECcccccccccEEEECccccEEEECcccccccHHHHHcccccccccccccccccEEEEEEEcccccCEEEEEcccEEEEcccccECccccccEEEEEEEcccccccccHHHHHHHHHHcccccccccccccCEEEEEECcccccccccccccccccccccccccCEccccccccccEEEEEccccccccccCEEEEEcccccEEEEEcccccccccEEEccccccccccCEEEEEEEcccccEEEEEEEcccccEEEEEEccccccccccccccccc
**********************HRNHVAWTSVKQERWEGELVVEGEIPSWLNGTYLRNGPGVWHIGEFNFGHLFDGYAMLVKVHFEKNGRLIAGHRQIETEAYKAAKKNKKLCYREFSVSPKPDNFLAYVGELAKLFSGASLTDNANNGIYKLGDGRIICLTETQKGSVIVDPDTLDTLGKFEYSDPLGGFIQSSHPIVTDDEFLTLLPDLLNPGYLVVRMEPGTNERKVIGRVNCRGGPAPGWVHSFTMTEHYVVVPEMPLQYSVQSLLKAEPSALYQFEWRPERKAFLHVVCKASGKIAASVEVPLYMVFHFINAYEEKDKDGRVIAVIADCCEHNADTTIIETLSLKNLRSFHGQDVLPDARVGRFTIPFDGSQFGKLETVMDPEEHGRGVDMCSINPAYLGKKYRYAYAIGAKRPCNFPNSLTKLDLVKQKAKNWCEEGIVPSEPLFVARPGATDEDDGVVISMISEKNGGAYVVLLDGSTFEEIARARFPFGLPYGFHGCWV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISNVASHQSPASVPERESCAEHRNHVAWTSVKQERWEGELVVEGEIPSWLNGTYLRNGPGVWHIGEFNFGHLFDGYAMLVKVHFEKNGRLIAGHRQIETEAYKAAKKNKKLCYREFSVSPKPDNFLAYVGELAKLFSGASLTDNANNGIYKLGDGRIICLTETQKGSVIVDPDTLDTLGKFEYSDPLGGFIQSSHPIVTDDEFLTLLPDLLNPGYLVVRMEPGTNERKVIGRVNCRGGPAPGWVHSFTMTEHYVVVPEMPLQYSVQSLLKAEPSALYQFEWRPERKAFLHVVCKASGKIAASVEVPLYMVFHFINAYEEKDKDGRVIAVIADCCEHNADTTIIETLSLKNLRSFHGQDVLPDARVGRFTIPFDGSQFGKLETVMDPEEHGRGVDMCSINPAYLGKKYRYAYAIGAKRPCNFPNSLTKLDLVKQKAKNWCEEGIVPSEPLFVARPGATDEDDGVVISMISEKNGGAYVVLLDGSTFEEIARARFPFGLPYGFHGCWVPEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carotenoid cleavage dioxygenase 8, chloroplastic Cleaves the C(27) 10'-apo-beta-carotenal produced by CCD7. Produces one C(9) dialdehyde and the C(18) 13-apo-beta-carotenone required for production of a graft-transmissible inhibitor of axillary meristen development and shoot branching. Also active on other carotenoid substrates like licopene or zeaxanthin.probableQ8VY26

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.99.-Miscellaneous (requires further characterization).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NPE, chain A
Confidence level:very confident
Coverage over the Query: 23-348,359-509
View the alignment between query and template
View the model in PyMOL
Template: 3KVC, chain A
Confidence level:very confident
Coverage over the Query: 25-121,141-509
View the alignment between query and template
View the model in PyMOL