Citrus Sinensis ID: 010462


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MAQDYLSEKGPKEMGDIGEEYFNILASRSFFQDFYKGYGGEIYKCKMHDIVHDFAQYLCSNGCLTVEIHSGEQSTISSFGETKILHLMLTLHRGASVPIPIWDNVKGLRGLRSLLVESGEYSWSNEILPQLFDKLTCLRALKLEVREQGLYTNFIKKIPTNIEKLLHLKYLSLFGQKKIEKLPETLCELYNLERLNVDHCKNLRELPRGIGKLRKLMYLHNEGTDSLRYLPAGIGELIRLRSVRKFVVGGGYDRACSLGSLKKLNLLRDCRIRGLGDVSDAGEARRAELEKKKSLLKLGLHFGHSRDGDEERAGRRENEEDEDERLLEALGPPPNLKKLRIDEYRGRRNVVPISWFMSLTNLRFLFLFGWRNCEHLPPLGKLPSLEYLEIEGMKSVKRVGNEFLGVESDTDGSSVIAFPKLKHLTFWVMNALEELDFETAIKREIIIMPRLSSLTIWSCRKLKALPDHLLQKTTLQKLHIRRCPILEERCRKETGEDWPKIRHIPEISIG
cccccccccccccHHHHHHHHHHHHHHccccccccccccccCEEEEEcHHHHHHHHHHHcccEEEEECcccccccccccccccEEEEEEEECccccccccccccccccccccEEEcccccccccccccHHHHccccEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEccccccccccccHHHHccccccEEECccccccccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccHHHHHHccccccccccEEEECcccccccccccccccccccHHHHHHHHccccccccEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccEEEECcccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccHHHHHcccccccccccccccccEEEc
MAQDYLSEKGPKEMGDIGEEYFNILASRSFFQDFYKGYGGEIYKCKMHDIVHDFAQYLCSNGCLTVEIHSGEQSTISSFGETKILHLMLTLHRGASVPIPIWDNVKGLRGLRSLLVESGEYSWSNEILPQLFDKLTCLRALKLEVREQGLYTNFIKKIPTNIEKLLHLKYLSLFGQKKIEKLPETLCELYNLERLNVDHCKNLRELPRGIGKLRKLMYLHNEGTDSLRYLPAGIGELIRLRSVRKFVVGGGYDRACSLGSLKKLNLLRDCRIRGLGDVSDAGEARRAELEKKKSLLKLGLHFGHSRDGD***********DEDERLLEALGPPPNLKKLRIDEYRGRRNVVPISWFMSLTNLRFLFLFGWRNCEHLPPLGKLPSLEYLEIEGMKSVKRVGNEFLGVESDTDGSSVIAFPKLKHLTFWVMNALEELDFETAIKREIIIMPRLSSLTIWSCRKLKALPDHLLQKTTLQKLHIRRCPILEERCRKETGEDWPKIRHIPEISIG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQDYLSEKGPKEMGDIGEEYFNILASRSFFQDFYKGYGGEIYKCKMHDIVHDFAQYLCSNGCLTVEIHSGEQSTISSFGETKILHLMLTLHRGASVPIPIWDNVKGLRGLRSLLVESGEYSWSNEILPQLFDKLTCLRALKLEVREQGLYTNFIKKIPTNIEKLLHLKYLSLFGQKKIEKLPETLCELYNLERLNVDHCKNLRELPRGIGKLRKLMYLHNEGTDSLRYLPAGIGELIRLRSVRKFVVGGGYDRACSLGSLKKLNLLRDCRIRGLGDVSDAGEARRAELEKKKSLLKLGLHFGHSRDGDEERAGRRENEEDEDERLLEALGPPPNLKKLRIDEYRGRRNVVPISWFMSLTNLRFLFLFGWRNCEHLPPLGKLPSLEYLEIEGMKSVKRVGNEFLGVESDTDGSSVIAFPKLKHLTFWVMNALEELDFETAIKREIIIMPRLSSLTIWSCRKLKALPDHLLQKTTLQKLHIRRCPILEERCRKETGEDWPKIRHIPEISIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 82-307,326-401,417-472
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 82-306,325-402,415-485
View the alignment between query and template
View the model in PyMOL
Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 109-304,322-485
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 82-304,322-494
View the alignment between query and template
View the model in PyMOL
Template: 2A5Y, chain B
Confidence level:confident
Coverage over the Query: 1-64
View the alignment between query and template
View the model in PyMOL