Citrus Sinensis ID: 010514

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
MVRIKCAMCSDFDLCVECFSVGAQIYPHESNHPYRVMDNLSFPLICPDWNADEEILLLEGIEMYGFGNWGEVSEHVGTKSKSQCIDHYNAIYMNSPCFPLPDLSHVMGKNREELLAMAKEHQQVKKELPTVAELALKEDAPFSTRMKPETRKEDTTRQSSSGLTTVEVNSIDPSNGNAFSFKKASNMTQVKESVKVEVLAEPQSDRSIGEKKLRTSGDERPSMKELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPFERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAEENGQRVKESGQAGPSGKVLQRPNSLKEVEVSPRGVVRGSTSLQPFGNDSYSTIASSLEDWDISGFVGADLLSETEKRLCGEIKILPAHYLKMLEILSVEIYKGNVSKKSDAHNLFKVEPNKVDRVYDMLVRKGIAQA
cEEEEccccccccccHHHHHccccccccccccccEEccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHcHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHcccccc
MVRIKCAMCSDFDLCVECFSVGAQIYPHESNHPYRVMDNLSFPLICPDWNADEEILLLEGIEMYGFGNWGEVSEHVGTKSKSQCIDHYNAIYMNSPCFPLPDLSHVM************************************************************************************ESVKVEVLAEPQSDRSI***************************FEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPFERNL*PEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAG***************************************************************************SLEDWDISGFVGADLLSETEKRLCGEIKILPAHYLKMLEILSVEIYKGNVSKKSDAHNLFKVEPNKVDRVYDMLVRKGIAQA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRIKCAMCSDFDLCVECFSVGAQIYPHESNHPYRVMDNLSFPLICPDWNADEEILLLEGIEMYGFGNWGEVSEHVGTKSKSQCIDHYNAIYMNSPCFPLPDLSHVMGKNREELLAMAKEHQQVKKELPTVAELALKEDAPFSTRMKPETRKEDTTRQSSSGLTTVEVNSIDPSNGNAFSFKKASNMTQVKESVKVEVLAEPQSDRSIGEKKLRTSGDERPSMKELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPFERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAEENGQRVKESGQAGPSGKVLQRPNSLKEVEVSPRGVVRGSTSLQPFGNDSYSTIASSLEDWDISGFVGADLLSETEKRLCGEIKILPAHYLKMLEILSVEIYKGNVSKKSDAHNLFKVEPNKVDRVYDMLVRKGIAQA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcriptional adapter ADA2 Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known. ADA2 and GCN5 function to acetylate nucleosomes, opening up the promoter region.probableQ75LL6
Transcriptional adapter ADA2a Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known (By similarity). ADA2 stimulates the acetyltransferase activity of GCN5 on free histones or nucleosomes, probably by opening up the promoter region.probableQ9SFD5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CUJ, chain A
Confidence level:very confident
Coverage over the Query: 424-508
View the alignment between query and template
View the model in PyMOL
Template: 2ELK, chain A
Confidence level:very confident
Coverage over the Query: 39-94
View the alignment between query and template
View the model in PyMOL
Template: 2DIP, chain A
Confidence level:confident
Coverage over the Query: 2-53
View the alignment between query and template
View the model in PyMOL