Citrus Sinensis ID: 010530

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
MTIHLRRSSPSIHQLAQIQRLHSRQLSAPPESPSASLPVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTLTNDTTDDDDDDRQSSSSSLFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
cEEEEccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHcHHccccccccHHcHHHHHHHHHHHHHccccccccc
cEEEEccccccHHHHHHHHHHHHHcccccccccccccccEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccHHHHHEEEEEEcccccEEEcHHHHHHHHccccccccccccHHHHHccccccccccccccccEEEEEcccccEEEHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHEHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHEEEHHHHHcccccccEEHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccHccc
mtihlrrsspsiHQLAQIQRLHsrqlsappespsaslpvlskasnantdhlkDCIFDSLARWFSGIVVGSSLGLLYwssnsdsistksslfpvsflsfadwsmstltndttddddddrqssssslfrklslpdyssnflfgeaYRRKIFFNYEkrirlrsppEKVFEYFASlrspegellmrpaDLMRaivpvfppseshlvrdgylrgerrpgelrcapseffmlfdmnndglisfKEYIFFVTLLsipessfsVAFKmfdidnngeisKEEFKQVMALMRShnrqgafhrdglrtglnvkgpvengglveyffgedgrarLQHEKFVQFMRNLYEEMLRLEFAhydykqrgtisaEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSygkvnglltrddFQRAAYRVCGILLTDNVIDIIFQVfdsnrdgnlsLEEFVRVLHNRerdiaqpvetGILGFLNCcwnftnnssigkflc
mtihlrrsspsihQLAQIQRLHSRQLSAPPESPSASLPVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTltndttddddddrqssssslfrklslpdyssnflfgeaYRRKIFFNyekrirlrsppEKVFEYFASLRSPEGELLMRPADLMRAIVpvfppseshlvrdgYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVfdsnrdgnlSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFtnnssigkflc
MTIHLRRSSPSIHQLAQIQRLHSRQlsappespsaslpvlsKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWssnsdsistkssLFPVSFLSFADWsmstltndttddddddrqsssssLFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
************************************************DHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSM*************************LSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMR***RQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIG****
*********PSIH*LA****************************************DSLARWFSGIVVGSSLGLLYWSSNS************************************************************EAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSES*LVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNR**************VKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRV*****************GFLNCCWNFTNNSSIGKFLC
*************************************PVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTLTNDT**************LFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
MTIHLRRSSPSIHQLAQIQRLHSRQL************************LKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSM*********************************NFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHN***************VKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIHLRRSSPSIHQLAQIQRLHSRQLSAPPESPSASLPVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTLTNDTTDDDDDDRQSSSSSLFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHxxxxxxxxxxxxxxxxxxxxxITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query508 2.2.26 [Sep-21-2011]
B1H2N3473 Calcium uptake protein 1, yes no 0.877 0.942 0.295 2e-48
Q8VCX5477 Calcium uptake protein 1, yes no 0.838 0.893 0.298 4e-48
Q6P6Q9477 Calcium uptake protein 1, yes no 0.830 0.884 0.301 5e-48
Q0IIL1478 Calcium uptake protein 1, yes no 0.696 0.740 0.327 7e-47
Q9BPX6476 Calcium uptake protein 1, yes no 0.696 0.743 0.327 8e-47
Q4R518476 Calcium uptake protein 1, N/A no 0.696 0.743 0.327 9e-47
D2HZB0481 Calcium uptake protein 1, yes no 0.696 0.735 0.321 3e-44
A4IG32489 Calcium uptake protein 1, yes no 0.692 0.719 0.310 1e-43
A2VEI2525 Calcium uptake protein 1 yes no 0.687 0.664 0.319 9e-42
A8WQT4533 Calcium uptake protein 1 N/A no 0.671 0.639 0.317 1e-41
>sp|B1H2N3|MICU1_XENTR Calcium uptake protein 1, mitochondrial OS=Xenopus tropicalis GN=micu1 PE=2 SV=2 Back     alignment and function desciption
 Score =  194 bits (492), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 141/477 (29%), Positives = 229/477 (48%), Gaps = 31/477 (6%)

Query: 35  ASLPVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVS 94
           A L  +S+  +   +H +      +A +     V +S GLL+  +N+++ S+        
Sbjct: 11  AGLAAVSRRYHGVANHARSRRRLMMAAFVGATAVSASAGLLWKRANAEAQSS-------- 62

Query: 95  FLSFADWSMSTLTNDTTDDDDDDRQSSSSSLFRKLSLPDYSSNFLFGEAYRRKIFFNYEK 154
                  SM   T++   +D D    SS         P           +R +    YE 
Sbjct: 63  ----VKHSMREETSEKEKEDADQAVESSDE-----DQPQEGKKKKARVGFRDRKVMEYEN 113

Query: 155 RIRLRSPPEKVFEYFASLR----SPEGELLMRPADLMRAIVPVFPPSESHLVRDGYL--- 207
           RIR  S P+K+F YFA+L+    S E E+ M P D +R+I P     E +L  D ++   
Sbjct: 114 RIRAYSTPDKIFRYFATLKVIHESGESEVFMTPQDFVRSITPNEKQPE-NLGLDQFIIKR 172

Query: 208 -RGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNN 266
             G++   E      E  + + +   GLISF +YIF  T+LS P+ +F +AFKMFD++ +
Sbjct: 173 YDGKKISQEREKFADEDSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGD 232

Query: 267 GEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHE 326
           GE+  EEF+QV +++RS    G  HRD   TG  +K    +  L  YFFG D + +L  +
Sbjct: 233 GEVDMEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGF-SSALTTYFFGADLKGKLTIK 291

Query: 327 KFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNE 386
            F++F R L  ++L+LEF  +D    G I+   F  SM+ +       KL + + QLK +
Sbjct: 292 NFLEFQRKLQHDVLKLEFERHD-PVDGHITERQFG-SMLLAYSGVQSKKLTHMLKQLK-K 348

Query: 387 RHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDN 446
           R      +TFEE +NF    + +     AL  Y      L +   Q+ A  V  + L+D+
Sbjct: 349 RFKDAEGLTFEEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDH 408

Query: 447 VIDIIFQVFDSNRDGNLSLEEFVRVLHNR-ERDIAQPVETGILGFLNCCWNFTNNSS 502
           V D++F +FD + +G LS +EF+ ++  R  R + +P + G    +   W     ++
Sbjct: 409 VCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLMRAMWKCAQETA 465
Key regulator of mitochondrial calcium uptake required for calcium entry into mitochondrion. May act as a calcium sensor via its EF-hand domains, gating the activity of a calcium channel partner.
Xenopus tropicalis (taxid: 8364)
>sp|Q8VCX5|MICU1_MOUSE Calcium uptake protein 1, mitochondrial OS=Mus musculus GN=Micu1 PE=2 SV=1 Back     alignment and function description
>sp|Q6P6Q9|MICU1_RAT Calcium uptake protein 1, mitochondrial OS=Rattus norvegicus GN=Micu1 PE=2 SV=1 Back     alignment and function description
>sp|Q0IIL1|MICU1_BOVIN Calcium uptake protein 1, mitochondrial OS=Bos taurus GN=MICU1 PE=2 SV=1 Back     alignment and function description
>sp|Q9BPX6|MICU1_HUMAN Calcium uptake protein 1, mitochondrial OS=Homo sapiens GN=MICU1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R518|MICU1_MACFA Calcium uptake protein 1, mitochondrial OS=Macaca fascicularis GN=MICU1 PE=2 SV=2 Back     alignment and function description
>sp|D2HZB0|MICU1_AILME Calcium uptake protein 1, mitochondrial OS=Ailuropoda melanoleuca GN=MICU1 PE=3 SV=1 Back     alignment and function description
>sp|A4IG32|MICU1_DANRE Calcium uptake protein 1, mitochondrial OS=Danio rerio GN=micu1 PE=2 SV=1 Back     alignment and function description
>sp|A2VEI2|MICU1_DROME Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster GN=CG4495 PE=2 SV=1 Back     alignment and function description
>sp|A8WQT4|MICU1_CAEBR Calcium uptake protein 1 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG01795 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query508
255548828540 calcium ion binding protein, putative [R 0.938 0.883 0.684 0.0
224143217488 predicted protein [Populus trichocarpa] 0.944 0.983 0.685 0.0
359475867474 PREDICTED: calcium uptake protein 1, mit 0.915 0.981 0.647 1e-179
297802820496 calcium-binding EF hand family protein [ 0.883 0.905 0.668 1e-172
15236653498 EF-hand, calcium binding motif-containin 0.860 0.877 0.677 1e-171
449455563476 PREDICTED: calcium uptake protein 1, mit 0.913 0.974 0.626 1e-166
356562068487 PREDICTED: calcium uptake protein 1, mit 0.755 0.788 0.742 1e-165
307136299476 calcium ion binding protein [Cucumis mel 0.834 0.890 0.658 1e-163
225463065488 PREDICTED: calcium uptake protein 1, mit 0.935 0.973 0.602 1e-160
356518234518 PREDICTED: calcium uptake protein 1, mit 0.816 0.801 0.644 1e-160
>gi|255548828|ref|XP_002515470.1| calcium ion binding protein, putative [Ricinus communis] gi|223545414|gb|EEF46919.1| calcium ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/504 (68%), Positives = 396/504 (78%), Gaps = 27/504 (5%)

Query: 5   LRRSSPSIHQLAQIQRLHSRQLSAPPESPSASLPVLSKASNANTDHLKDCIFDSLARWFS 64
           LRRS PSIH+   IQRL +RQ S P +SP+ S         A+  H       S  RW S
Sbjct: 7   LRRSQPSIHRFYLIQRLQTRQYSTPAQSPTLS---------ASLIHENHSYHQSFTRWLS 57

Query: 65  GIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTLTNDTTDDDDDDRQSSSSS 124
           GI   SSLG +YW  +SDS  +    F  S  SF +  +              +    +S
Sbjct: 58  GITFASSLGFIYWYIDSDSGDS----FKKSLFSFNEKRV--------------KDPFPTS 99

Query: 125 LFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPA 184
            F KLSLPDYSS F+FG+AYRRKIFFNYEKRIRLRSPPEKVFEYFAS     GELLM+PA
Sbjct: 100 TFGKLSLPDYSSKFIFGDAYRRKIFFNYEKRIRLRSPPEKVFEYFASFEGRNGELLMKPA 159

Query: 185 DLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFV 244
           DLMRA+VPVFPPSESHLVR+GYL GER+PG+LRCAPSEFFMLFD++NDGLISFKEYIFFV
Sbjct: 160 DLMRAVVPVFPPSESHLVREGYLSGERKPGDLRCAPSEFFMLFDVDNDGLISFKEYIFFV 219

Query: 245 TLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGP 304
           TLLSIPESSFSVAFKMFDIDNNGEI  EEFK+VMALMRSHNRQGA HRDGLRTGL V G 
Sbjct: 220 TLLSIPESSFSVAFKMFDIDNNGEIDMEEFKKVMALMRSHNRQGAVHRDGLRTGLKVSGS 279

Query: 305 VENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSM 364
           VE+GGL+EYFFG+ G+ RL H+KFVQF+R+L++E+LRLEFAHYDYK R TISA+DFALSM
Sbjct: 280 VEDGGLMEYFFGKYGKGRLHHDKFVQFLRDLHDEILRLEFAHYDYKLRKTISAKDFALSM 339

Query: 365 VASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNG 424
           VASAD+ HL+KLL RVD+L NE  L D++ITFEEFKNFAELR+KL PF LALFSYGKVNG
Sbjct: 340 VASADLSHLDKLLVRVDELNNEADLSDIQITFEEFKNFAELRKKLLPFSLALFSYGKVNG 399

Query: 425 LLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVE 484
           LLT++DFQRAA  VCG+ LTD V+DIIF VFDSNRDG+LSL EF+RVLH RERDIAQPVE
Sbjct: 400 LLTKEDFQRAASHVCGVSLTDKVVDIIFHVFDSNRDGHLSLNEFIRVLHKRERDIAQPVE 459

Query: 485 TGILGFLNCCWNFTNNSSIGKFLC 508
           +GI+GFL+CC+N  N  S G+F+ 
Sbjct: 460 SGIIGFLSCCFNCANGHSFGRFVT 483

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224143217|ref|XP_002324884.1| predicted protein [Populus trichocarpa] gi|222866318|gb|EEF03449.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359475867|ref|XP_003631765.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Vitis vinifera] gi|296082107|emb|CBI21112.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297802820|ref|XP_002869294.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297315130|gb|EFH45553.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15236653|ref|NP_194934.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] gi|2827631|emb|CAA16584.1| putative protein [Arabidopsis thaliana] gi|7270110|emb|CAB79924.1| putative protein [Arabidopsis thaliana] gi|18176110|gb|AAL59985.1| unknown protein [Arabidopsis thaliana] gi|21689743|gb|AAM67515.1| unknown protein [Arabidopsis thaliana] gi|332660599|gb|AEE85999.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449455563|ref|XP_004145522.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis sativus] gi|449485161|ref|XP_004157086.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356562068|ref|XP_003549296.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|307136299|gb|ADN34123.1| calcium ion binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|225463065|ref|XP_002266120.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356518234|ref|XP_003527784.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query508
TAIR|locus:2116662498 AT4G32060 [Arabidopsis thalian 0.883 0.901 0.649 1.9e-154
MGI|MGI:2384909477 Micu1 "mitochondrial calcium u 0.675 0.719 0.35 9.8e-48
RGD|735033477 Micu1 "mitochondrial calcium u 0.675 0.719 0.35 1.2e-47
UNIPROTKB|Q9BPX6476 MICU1 "Calcium uptake protein 0.675 0.720 0.344 4.2e-47
UNIPROTKB|B1H2N3473 micu1 "Calcium uptake protein 0.675 0.725 0.338 4.2e-47
UNIPROTKB|Q4R518476 MICU1 "Calcium uptake protein 0.675 0.720 0.344 4.2e-47
UNIPROTKB|E1BWC6480 MICU1 "Uncharacterized protein 0.675 0.714 0.344 6.9e-47
UNIPROTKB|Q0IIL1478 MICU1 "Calcium uptake protein 0.675 0.717 0.338 8.8e-47
UNIPROTKB|H9KVB8476 MICU1 "Calcium uptake protein 0.675 0.720 0.341 8.8e-47
UNIPROTKB|F1SU87479 MICU1 "Uncharacterized protein 0.675 0.716 0.338 1.4e-46
TAIR|locus:2116662 AT4G32060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1506 (535.2 bits), Expect = 1.9e-154, P = 1.9e-154
 Identities = 298/459 (64%), Positives = 354/459 (77%)

Query:    46 ANTDHLKDCIFD-SLARWFSGIVVGSSLGLLYWXXXXXXXXXXXXLFPVS-FLSFADWXX 103
             +  D LK  +   SLA+W +GI  GS+LG LYW            LF  S  LSFAD   
Sbjct:    46 SGADPLKCTVSGGSLAKWITGISAGSALGFLYWSSGSSDSISG--LFGGSNLLSFAD--- 100

Query:   104 XXXXXXXXXXXXXXXXXXXXXLFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPE 163
                                     KLSLP YSS F+FG+AYRRKIFFNYEKR+RL+SPPE
Sbjct:   101 ---SSTPSVCGVKVGDLKPRSFIPKLSLPGYSSGFIFGDAYRRKIFFNYEKRLRLQSPPE 157

Query:   164 KVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEF 223
             KVFEYFAS+R+ +GE+LM+PADLMRAIVPVFPPSESHLVR+GYL GER PGELRC+PSEF
Sbjct:   158 KVFEYFASVRTDKGEILMKPADLMRAIVPVFPPSESHLVREGYLTGERNPGELRCSPSEF 217

Query:   224 FMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRS 283
             FMLFD++NDGLISFKEYIFFVTLLSIPESSF+VAFKMFD DNNGEI KEEFK VM+LMRS
Sbjct:   218 FMLFDVDNDGLISFKEYIFFVTLLSIPESSFAVAFKMFDTDNNGEIDKEEFKTVMSLMRS 277

Query:   284 HNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLE 343
              +RQG  HRDGLRTGL++ G VE+GGLVEYFFG+DG  +L+H+KF +FM++L EEMLRLE
Sbjct:   278 QHRQGVGHRDGLRTGLHMTGSVEDGGLVEYFFGKDGSQKLKHDKFTKFMKDLTEEMLRLE 337

Query:   344 FAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFA 403
             FAHYDYK+RG+ISA+DFALSMVA+AD  HL+KLL+RV+ L    HL D+RI+ +EFK F 
Sbjct:   338 FAHYDYKRRGSISAKDFALSMVAAADASHLSKLLDRVESLSEHPHLRDMRISLKEFKQFD 397

Query:   404 ELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNL 463
             ELR KL PF LALF+YGK NGLLT  DF+RAA +VCGI L+DNVI+I F VFDSN+DGNL
Sbjct:   398 ELRSKLGPFSLALFAYGKANGLLTMKDFKRAASQVCGITLSDNVIEIAFHVFDSNQDGNL 457

Query:   464 SLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSS 502
             S++EF+RVLH RERD+AQP+  G+  + +  W  + N S
Sbjct:   458 SVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWKGSKNCS 496
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
MGI|MGI:2384909 Micu1 "mitochondrial calcium uptake 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|735033 Micu1 "mitochondrial calcium uptake 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BPX6 MICU1 "Calcium uptake protein 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B1H2N3 micu1 "Calcium uptake protein 1, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R518 MICU1 "Calcium uptake protein 1, mitochondrial" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWC6 MICU1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IIL1 MICU1 "Calcium uptake protein 1, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H9KVB8 MICU1 "Calcium uptake protein 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SU87 MICU1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6P6Q9MICU1_RATNo assigned EC number0.30190.83070.8846yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XVIII.1745.1
hypothetical protein (417 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query508
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-10
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 8e-10
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-05
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 2e-05
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 4e-05
pfam0003629 pfam00036, efhand, EF hand 5e-05
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 1e-04
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 2e-04
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-04
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 3e-04
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 3e-04
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 0.001
pfam1320225 pfam13202, EF_hand_3, EF hand 0.001
pfam1320225 pfam13202, EF_hand_3, EF hand 0.002
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information 
 Score = 55.6 bits (135), Expect = 3e-10
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 222 EFFMLFDMNNDGLISFKEYIFFVTLLSIPESS--FSVAFKMFDIDNNGEISKEEFKQVMA 279
           E F LFD + DG IS  E    +  L    S        +  D D +G+I  EEF ++MA
Sbjct: 4   EAFRLFDKDGDGTISADELKAALKSLGEGLSEEEIDEMIREVDKDGDGKIDFEEFLELMA 63

Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers. Length = 63
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 508
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.88
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 99.85
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.81
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.79
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.74
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 99.74
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.73
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.72
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.67
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.64
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.6
PTZ00183158 centrin; Provisional 99.6
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 99.6
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.59
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.56
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.56
PTZ00184149 calmodulin; Provisional 99.55
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.54
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.54
KOG0575592 consensus Polo-like serine/threonine protein kinas 99.53
PTZ00183158 centrin; Provisional 99.43
PTZ00184149 calmodulin; Provisional 99.41
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.41
KOG0583370 consensus Serine/threonine protein kinase [Signal 99.39
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.37
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 99.37
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.37
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.37
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.36
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.33
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 99.3
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.29
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.28
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.28
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.27
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.26
PTZ00284467 protein kinase; Provisional 99.26
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.25
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 99.24
PTZ00036440 glycogen synthase kinase; Provisional 99.24
KOG0036 463 consensus Predicted mitochondrial carrier protein 99.23
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 99.23
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.21
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.2
KOG0610459 consensus Putative serine/threonine protein kinase 99.19
KOG0581364 consensus Mitogen-activated protein kinase kinase 99.19
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.18
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.17
KOG0605550 consensus NDR and related serine/threonine kinases 99.16
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.16
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.14
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.14
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.14
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.14
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.14
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.14
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.13
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.13
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.13
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.13
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.12
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.12
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.12
KOG4251362 consensus Calcium binding protein [General functio 99.12
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.12
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.11
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.11
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.11
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.1
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.1
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.09
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.09
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.09
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.08
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.08
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.08
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.08
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.08
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.07
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.07
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.07
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.07
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.06
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.06
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.06
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.06
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.05
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.05
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.05
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.05
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.05
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.04
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.04
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.03
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.03
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 99.02
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.01
PHA03207392 serine/threonine kinase US3; Provisional 99.01
PTZ00283496 serine/threonine protein kinase; Provisional 99.01
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 98.99
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 98.99
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 98.98
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 98.98
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 98.98
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 98.98
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.97
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 98.97
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 98.96
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 98.96
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 98.96
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 98.95
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 98.95
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 98.95
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 98.95
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 98.95
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 98.95
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 98.94
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 98.94
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 98.94
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 98.94
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 98.94
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 98.94
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 98.93
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.93
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 98.93
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 98.93
PHA03212391 serine/threonine kinase US3; Provisional 98.92
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.92
KOG0694694 consensus Serine/threonine protein kinase [Signal 98.92
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 98.92
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 98.91
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 98.91
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 98.91
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 98.91
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 98.9
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 98.9
KOG0036 463 consensus Predicted mitochondrial carrier protein 98.9
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 98.89
PLN03224507 probable serine/threonine protein kinase; Provisio 98.89
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 98.89
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.89
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 98.89
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 98.89
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.88
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 98.88
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 98.88
PHA03211461 serine/threonine kinase US3; Provisional 98.87
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 98.87
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 98.87
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 98.86
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 98.86
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 98.86
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 98.86
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 98.86
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 98.86
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 98.86
PTZ00267478 NIMA-related protein kinase; Provisional 98.86
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 98.85
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 98.85
KOG0198313 consensus MEKK and related serine/threonine protei 98.85
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 98.85
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 98.85
PHA03209357 serine/threonine kinase US3; Provisional 98.85
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 98.85
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 98.84
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 98.84
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 98.84
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 98.84
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 98.84
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 98.83
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 98.83
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 98.83
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 98.83
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.82
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 98.82
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 98.82
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 98.81
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 98.81
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.81
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 98.81
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 98.81
KOG0586596 consensus Serine/threonine protein kinase [General 98.8
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.8
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 98.8
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 98.8
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 98.8
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 98.8
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 98.8
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 98.79
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 98.79
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 98.79
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.79
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 98.79
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 98.79
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 98.79
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 98.79
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 98.78
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 98.78
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 98.78
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 98.78
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 98.78
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 98.78
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 98.77
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 98.77
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 98.77
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 98.77
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 98.77
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 98.77
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 98.77
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 98.77
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 98.77
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 98.77
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 98.76
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.76
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.76
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 98.76
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 98.76
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 98.76
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 98.76
KOG1989738 consensus ARK protein kinase family [Signal transd 98.75
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 98.75
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 98.75
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 98.75
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 98.74
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 98.74
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.74
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 98.74
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 98.74
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 98.73
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.73
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 98.73
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 98.73
PTZ00024335 cyclin-dependent protein kinase; Provisional 98.72
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 98.72
PHA02988283 hypothetical protein; Provisional 98.72
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 98.72
KOG0611668 consensus Predicted serine/threonine protein kinas 98.71
PHA03210501 serine/threonine kinase US3; Provisional 98.7
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 98.7
KOG0690516 consensus Serine/threonine protein kinase [Signal 98.7
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 98.7
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 98.7
PTZ00266 1021 NIMA-related protein kinase; Provisional 98.7
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 98.7
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 98.7
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 98.69
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 98.69
KOG0578550 consensus p21-activated serine/threonine protein k 98.69
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 98.69
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 98.69
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 98.69
PLN00009294 cyclin-dependent kinase A; Provisional 98.68
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 98.68
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 98.67
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 98.66
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 98.66
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.65
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 98.65
KOG0038189 consensus Ca2+-binding kinase interacting protein 98.65
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.65
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 98.65
KOG4251362 consensus Calcium binding protein [General functio 98.64
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 98.64
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 98.64
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 98.64
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 98.63
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.63
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 98.63
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 98.63
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 98.62
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 98.62
KOG0377631 consensus Protein serine/threonine phosphatase RDG 98.62
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 98.62
PLN02964 644 phosphatidylserine decarboxylase 98.62
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.61
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 98.61
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 98.61
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.61
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 98.6
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 98.59
KOG0201467 consensus Serine/threonine protein kinase [Signal 98.59
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.58
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.58
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 98.58
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 98.56
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 98.56
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 98.56
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 98.56
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 98.56
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 98.55
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 98.54
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 98.54
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 98.54
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.54
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 98.53
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 98.53
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 98.53
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 98.52
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 98.52
KOG0582516 consensus Ste20-like serine/threonine protein kina 98.52
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 98.52
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 98.52
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 98.51
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 98.51
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 98.5
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 98.5
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 98.5
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 98.49
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 98.48
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.47
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 98.47
cd0005267 EH Eps15 homology domain; found in proteins implic 98.47
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 98.47
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 98.47
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.47
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 98.46
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 98.46
KOG0038189 consensus Ca2+-binding kinase interacting protein 98.46
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 98.46
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 98.46
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 98.45
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 98.45
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 98.45
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 98.45
KOG0595429 consensus Serine/threonine-protein kinase involved 98.44
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 98.43
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 98.43
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 98.43
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 98.43
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 98.42
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 98.42
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 98.42
PLN00181 793 protein SPA1-RELATED; Provisional 98.42
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 98.41
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 98.41
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 98.41
PLN02964 644 phosphatidylserine decarboxylase 98.41
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 98.4
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 98.4
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 98.4
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 98.4
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.4
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.39
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 98.39
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 98.39
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 98.39
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.39
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 98.39
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 98.39
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 98.38
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.38
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 98.37
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 98.36
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.36
cd0005267 EH Eps15 homology domain; found in proteins implic 98.36
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 98.35
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 98.35
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 98.35
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 98.35
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 98.35
PHA02882294 putative serine/threonine kinase; Provisional 98.34
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 98.34
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 98.34
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 98.33
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 98.33
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 98.33
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 98.33
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 98.33
KOG1167418 consensus Serine/threonine protein kinase of the C 98.32
KOG0696683 consensus Serine/threonine protein kinase [Signal 98.32
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 98.32
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 98.31
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 98.31
KOG0671415 consensus LAMMER dual specificity kinases [Signal 98.31
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.3
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 98.3
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 98.29
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 98.28
KOG0596677 consensus Dual specificity; serine/threonine and t 98.28
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 98.28
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 98.27
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 98.27
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.27
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 98.26
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 98.25
KOG0661538 consensus MAPK related serine/threonine protein ki 98.25
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 98.25
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 98.25
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 98.24
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 98.24
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 98.24
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 98.23
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.2
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 98.18
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.18
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 98.18
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 98.18
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 98.18
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 98.16
KOG4721 904 consensus Serine/threonine protein kinase, contain 98.15
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 98.15
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 98.14
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 98.13
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 98.12
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 98.12
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.11
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 98.09
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 98.09
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 98.08
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 98.08
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.07
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.06
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 98.04
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.04
KOG42791226 consensus Serine/threonine protein kinase [Signal 98.02
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 98.01
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 98.01
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 97.99
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.99
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 97.97
PF1465866 EF-hand_9: EF-hand domain 97.95
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 97.95
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 97.95
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.94
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.9
KOG0589426 consensus Serine/threonine protein kinase [General 97.88
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 97.85
KOG0590601 consensus Checkpoint kinase and related serine/thr 97.84
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 97.83
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.81
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 97.79
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 97.79
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 97.73
KOG06081034 consensus Warts/lats-like serine threonine kinases 97.71
KOG0606 1205 consensus Microtubule-associated serine/threonine 97.7
KOG4666412 consensus Predicted phosphate acyltransferase, con 97.66
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.65
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 97.64
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.58
KOG1027903 consensus Serine/threonine protein kinase and endo 97.57
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 97.56
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 97.52
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 97.51
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 97.48
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.48
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.48
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.48
KOG1290590 consensus Serine/threonine protein kinase [Signal 97.47
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.46
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.45
PF1465866 EF-hand_9: EF-hand domain 97.41
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 97.37
KOG1151775 consensus Tousled-like protein kinase [Signal tran 97.35
KOG0986591 consensus G protein-coupled receptor kinase [Signa 97.31
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.25
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.21
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.18
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.09
KOG0577 948 consensus Serine/threonine protein kinase [Signal 97.08
KOG4666412 consensus Predicted phosphate acyltransferase, con 97.08
PLN00113968 leucine-rich repeat receptor-like protein kinase; 97.01
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 97.0
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.89
KOG1026774 consensus Nerve growth factor receptor TRKA and re 96.88
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 96.88
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 96.8
KOG06061205 consensus Microtubule-associated serine/threonine 96.71
KOG1345378 consensus Serine/threonine kinase [Signal transduc 96.68
KOG0695593 consensus Serine/threonine protein kinase [Signal 96.56
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 96.5
KOG0192362 consensus Tyrosine kinase specific for activated ( 96.45
KOG0590601 consensus Checkpoint kinase and related serine/thr 96.39
KOG0584632 consensus Serine/threonine protein kinase [General 96.38
KOG0197468 consensus Tyrosine kinases [Signal transduction me 96.26
KOG0169 746 consensus Phosphoinositide-specific phospholipase 96.09
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.08
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 96.06
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.06
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 95.61
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 95.61
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.42
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 95.39
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 95.38
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.22
KOG4065144 consensus Uncharacterized conserved protein [Funct 95.2
KOG4065144 consensus Uncharacterized conserved protein [Funct 95.16
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 95.1
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 94.48
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 94.41
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 93.85
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 93.82
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 93.66
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 93.59
KOG0169 746 consensus Phosphoinositide-specific phospholipase 93.26
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.5e-49  Score=376.60  Aligned_cols=378  Identities=37%  Similarity=0.595  Sum_probs=326.2

Q ss_pred             HHhhhcCCCCCCccchhhhhhhhHHHHHHHhhhcCCChHHHHHHHhccc----CCCCccccCHHHHHHhhcCCCCCCCcc
Q 010530          125 LFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLR----SPEGELLMRPADLMRAIVPVFPPSESH  200 (508)
Q Consensus       125 li~klL~~d~~~R~s~~~al~h~w~~~~~~~~~~~~~~~~~f~~f~~~~----~~~g~~~m~~~e~~~~l~~~~~~~e~~  200 (508)
                      .|-+.+...+.+-..-+.+++..-+.+|+++++..++|.++|.+|++++    ..+|++||+|++|++++.+..++.+..
T Consensus       102 ~~~~~~~~~~~~~~~~~~~~r~r~~~~yE~rlr~~s~P~kiFryFAtvk~~~~~~~~evyMTP~DFlrSi~p~~~qpe~~  181 (489)
T KOG2643|consen  102 GIGADLHPHQSKKKRKGSGFRERKIMEYENRLRLYSTPDKIFRYFATVKYKNDSGKGEVYMTPEDFLRSITPGAKQPERL  181 (489)
T ss_pred             ccccccccccccchhhccchhhhHhhhhhhhhhhcCCHHHHHHHhheeeeeccCCCceEEeCHHHHHHhcCCCCCCchhh
Confidence            6667777777776666778888888999999999999999999999998    246899999999999999988887654


Q ss_pred             ccccccccCccCCCccCCCHHHHHhHHcCCCCcceeHHHHHHHHHHcCCCHHHHHHHhhhcCCCCCCcccHHHHHHHHHH
Q 010530          201 LVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNNGEISKEEFKQVMAL  280 (508)
Q Consensus       201 ~~~~~~l~~~~~~~e~~~~~~~lf~~~D~d~dG~Is~~EF~~~l~~l~~~~~~l~~~F~~~D~d~dG~Is~~Ef~~~l~~  280 (508)
                      .+..-..-+...+.++.+.+..-.-.++.+.+|.|+|.||+.+++.++.++..++.+|++||.||||.|+.+||..+...
T Consensus       182 gld~~k~~~~~~~~~~~~~~~~~siF~~lg~~GLIsfSdYiFLlTlLS~p~~~F~IAFKMFD~dgnG~IdkeEF~~v~~l  261 (489)
T KOG2643|consen  182 GLDKLKDIDEKLKKELPKFSDGDSIFYKLGESGLISFSDYIFLLTLLSIPERNFRIAFKMFDLDGNGEIDKEEFETVQQL  261 (489)
T ss_pred             hhHHHhhhchhccccCccCCCCCeeEEEcCCCCeeeHHHHHHHHHHHccCcccceeeeeeeecCCCCcccHHHHHHHHHH
Confidence            43322222233334555444444445688899999999999999999999999999999999999999999999999988


Q ss_pred             HHhccccCcccccccccccCCCCCCCchhHHHHHhccCCCccccHHHHHHHHHHHhHHHHHHHHhcccCCCCccccHHHH
Q 010530          281 MRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDF  360 (508)
Q Consensus       281 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~d~dG~I~~~EF~~~~~~l~~e~l~~~F~~~D~d~~G~Is~~Ef  360 (508)
                      +..+...+..|++..+.+...... .+..+...+|+++++++++++||.+++.+++.|.++..|..+|+..+|.|+..+|
T Consensus       262 i~sQ~~~g~~hrd~~tt~~s~~~~-~nsaL~~yFFG~rg~~kLs~deF~~F~e~Lq~Eil~lEF~~~~~~~~g~Ise~DF  340 (489)
T KOG2643|consen  262 IRSQTSVGVRHRDHFTTGNSFKVE-VNSALLTYFFGKRGNGKLSIDEFLKFQENLQEEILELEFERFDKGDSGAISEVDF  340 (489)
T ss_pred             HHhccccceecccCccccceehhh-hhhhHHHHhhccCCCccccHHHHHHHHHHHHHHHHHHHHHHhCcccccccCHHHH
Confidence            888888888888877766554332 2334777889999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhc--CccHHHHHHHHHHhhhcccccCCcccCHHHHHHHHHHHhhhhhHHHHhhhcccCCCccCHHHHHHHHHHH
Q 010530          361 ALSMVASA--DMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRV  438 (508)
Q Consensus       361 ~~~l~~~~--~~~~~~~~l~~~~~~~~~~~~~~~~Is~~eF~~~~~l~~~~~~~~~a~~~~~d~~G~Is~~Ef~~~l~~~  438 (508)
                      ..++..+.  .......+++++......   .+..||++||++|..++.++.+++.|+.+|...++.|+..+|++++..+
T Consensus       341 A~~lL~~a~~n~~~k~~~lkrvk~kf~~---~~~gISl~Ef~~Ff~Fl~~l~dfd~Al~fy~~Ag~~i~~~~f~raa~~v  417 (489)
T KOG2643|consen  341 AELLLAYAGVNSKKKHKYLKRVKEKFKD---DGKGISLQEFKAFFRFLNNLNDFDIALRFYHMAGASIDEKTFQRAAKVV  417 (489)
T ss_pred             HHHHHHHcccchHhHHHHHHHHHHhccC---CCCCcCHHHHHHHHHHHhhhhHHHHHHHHHHHcCCCCCHHHHHHHHHHh
Confidence            99998876  455566788888876432   2568999999999999999999999999999999999999999999999


Q ss_pred             hCCCCCHHHHHHHHHHHcCCCCCCccHHHHHHHHhhhccC-CCCchhhhhhHHHHHHhhhcccCCcccc
Q 010530          439 CGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERD-IAQPVETGILGFLNCCWNFTNNSSIGKF  506 (508)
Q Consensus       439 ~g~~ls~~ei~~lf~~~D~d~dG~Is~~EF~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~  506 (508)
                      +|+.|++..++.+|..||.|+||.||++||+++|++|+++ ++.|...|..++|+|+|+|.|+++..|-
T Consensus       418 tGveLSdhVvdvvF~IFD~N~Dg~LS~~EFl~Vmk~Rmhrgl~~p~~~gl~~~~~~v~kc~k~~~~a~~  486 (489)
T KOG2643|consen  418 TGVELSDHVVDVVFTIFDENNDGTLSHKEFLAVMKRRMHRGLELPKDTGLLRYMKAVKKCIKEVSSAWP  486 (489)
T ss_pred             cCcccccceeeeEEEEEccCCCCcccHHHHHHHHHHHhhccccCCcccchHHHHHHHHHHHHhhhhhcc
Confidence            9999999999999999999999999999999999999976 9999999999999999999999887663

>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query508
2het_A189 Non-Myristoylated Bovine Recoverin (Truncated At C- 5e-05
1jsa_A201 Myristoylated Recoverin With Two Calciums Bound, Nm 5e-05
1omr_A201 Non-Myristoylated Wild-Type Bovine Recoverin With C 5e-05
2i94_A202 Nmr Structure Of Recoverin Bound To Rhodopsin Kinas 6e-05
1la3_A201 Solution Structure Of Recoverin Mutant, E85q Length 1e-04
1omv_A201 Non-Myristoylated Bovine Recoverin (E85q Mutant) Wi 1e-04
1bjf_A193 Crystal Structure Of Recombinant Bovine Neurocalcin 1e-04
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 2e-04
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 2e-04
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-04
2r2i_A198 Myristoylated Guanylate Cyclase Activating Protein- 6e-04
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 7e-04
>pdb|2HET|A Chain A, Non-Myristoylated Bovine Recoverin (Truncated At C-Terminus) With Calcium Bound To Ef-Hand 3 Length = 189 Back     alignment and structure 
Iteration: 1

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 11/123 (8%)
Query: 224 FMLFDMNNDGLISFKEYIFFVTLLSIPESS--FSVAFKMFDIDNNGEISKEEFKQ-VMAL 280
           F  FD N+DG + FKEY+  + + S  +++     AF ++D+D NG ISK E  + V A+
Sbjct: 69  FRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAI 128
Query: 281 MRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQ-FMRNLYEEM 339
            +  + +   H   L    N   P +    +  FFG+    +L  ++F++  + N  +E+
Sbjct: 129 FKMISPEDTKH---LPEDENT--PEKRAEKIWGFFGKKDDDKLTEKEFIEGTLAN--KEI 181
Query: 340 LRL 342
           LRL
Sbjct: 182 LRL 184
>pdb|1JSA|A Chain A, Myristoylated Recoverin With Two Calciums Bound, Nmr, 24 Structures Length = 201 Back     alignment and structure
>pdb|1OMR|A Chain A, Non-Myristoylated Wild-Type Bovine Recoverin With Calcium Bound To Ef- Hand 3 Length = 201 Back     alignment and structure
>pdb|2I94|A Chain A, Nmr Structure Of Recoverin Bound To Rhodopsin Kinase Length = 202 Back     alignment and structure
>pdb|1LA3|A Chain A, Solution Structure Of Recoverin Mutant, E85q Length = 201 Back     alignment and structure
>pdb|1OMV|A Chain A, Non-Myristoylated Bovine Recoverin (E85q Mutant) With Calcium Bound To Ef-Hand 3 Length = 201 Back     alignment and structure
>pdb|1BJF|A Chain A, Crystal Structure Of Recombinant Bovine Neurocalcin Delta At 2.4 Angstroms Length = 193 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure
>pdb|2R2I|A Chain A, Myristoylated Guanylate Cyclase Activating Protein-1 With Calcium Bound Length = 198 Back     alignment and structure
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query508
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-18
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-13
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-09
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 9e-13
3li6_A66 Calcium-binding protein; calcium signaling protein 1e-12
3li6_A66 Calcium-binding protein; calcium signaling protein 7e-06
3li6_A66 Calcium-binding protein; calcium signaling protein 2e-04
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-12
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 8e-11
2hps_A186 Coelenterazine-binding protein with bound coelent; 8e-12
2hps_A186 Coelenterazine-binding protein with bound coelent; 1e-09
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-08
2hps_A186 Coelenterazine-binding protein with bound coelent; 5e-05
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 1e-11
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-08
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 2e-04
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-04
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 5e-11
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 1e-07
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 1e-04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 5e-11
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 4e-07
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 6e-05
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 7e-11
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 2e-10
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 8e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 6e-06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 9e-11
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-09
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-07
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 3e-07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-10
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-10
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-05
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-10
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 4e-10
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-09
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-07
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 3e-10
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 3e-05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 4e-05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 6e-10
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-07
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-05
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 2e-05
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 6e-10
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-08
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 1e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-06
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 7e-10
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-09
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-08
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 1e-06
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 1e-09
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 8e-08
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 4e-07
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 4e-06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-09
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-07
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 6e-05
1y1x_A191 Leishmania major homolog of programmed cell death 3e-09
1y1x_A191 Leishmania major homolog of programmed cell death 1e-06
1y1x_A191 Leishmania major homolog of programmed cell death 4e-05
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 4e-09
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 7e-09
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 6e-08
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 3e-06
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 5e-09
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 4e-05
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 9e-09
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 8e-04
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-08
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 6e-07
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 9e-05
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 2e-04
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 1e-08
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-06
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-05
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 1e-08
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 8e-05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-08
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 3e-08
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 4e-04
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 1e-08
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 2e-07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 1e-05
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 2e-04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-08
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 7e-08
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 5e-06
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-04
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 2e-08
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 2e-05
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-08
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 4e-08
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 9e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 5e-04
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 2e-08
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 6e-06
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 2e-05
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-08
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 1e-04
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 3e-04
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-08
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-06
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 8e-05
3lij_A494 Calcium/calmodulin dependent protein kinase with A 4e-08
3lij_A494 Calcium/calmodulin dependent protein kinase with A 6e-08
3lij_A494 Calcium/calmodulin dependent protein kinase with A 3e-06
3lij_A494 Calcium/calmodulin dependent protein kinase with A 6e-05
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 4e-08
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 6e-07
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 2e-04
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 6e-04
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 4e-08
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 9e-08
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 9e-06
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 5e-08
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 2e-05
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 6e-08
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 6e-08
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 1e-04
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 6e-08
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 3e-07
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 1e-06
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 4e-05
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 7e-08
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 8e-08
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-05
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 8e-05
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 8e-08
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 8e-08
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 2e-05
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 8e-08
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 4e-07
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 8e-06
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 1e-04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 9e-08
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 5e-05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 1e-04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 3e-04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 8e-04
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 9e-08
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 9e-06
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 9e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 8e-04
1exr_A148 Calmodulin; high resolution, disorder, metal trans 1e-07
1exr_A148 Calmodulin; high resolution, disorder, metal trans 6e-05
1exr_A148 Calmodulin; high resolution, disorder, metal trans 2e-04
1exr_A148 Calmodulin; high resolution, disorder, metal trans 8e-04
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 1e-07
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 1e-05
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 5e-04
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 7e-04
3fwb_A161 Cell division control protein 31; gene gating, com 1e-07
3fwb_A161 Cell division control protein 31; gene gating, com 4e-06
3fwb_A161 Cell division control protein 31; gene gating, com 4e-05
3fwb_A161 Cell division control protein 31; gene gating, com 1e-04
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 1e-07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 4e-06
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 4e-04
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 1e-07
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 9e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 2e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 8e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 2e-04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 2e-04
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-07
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 6e-07
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 8e-06
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 2e-07
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 7e-05
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 3e-05
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 2e-07
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 4e-05
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-07
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 6e-07
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-07
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 6e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 3e-04
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-07
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-04
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 3e-07
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 3e-07
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 3e-06
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 4e-06
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 1e-04
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 3e-07
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 6e-04
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 8e-04
2jnf_A158 Troponin C; stretch activated muscle contraction, 3e-07
2jnf_A158 Troponin C; stretch activated muscle contraction, 2e-05
2jnf_A158 Troponin C; stretch activated muscle contraction, 8e-05
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 3e-07
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 4e-07
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 3e-05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 4e-07
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 6e-05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 1e-04
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 4e-07
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-06
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-06
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 8e-05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-04
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 5e-07
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 4e-04
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 5e-07
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 5e-07
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 3e-04
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 5e-07
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 5e-04
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 5e-04
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 6e-07
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-04
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 7e-04
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 6e-07
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 7e-07
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 2e-05
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 3e-05
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 4e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 7e-07
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 3e-05
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 7e-05
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 8e-07
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 2e-05
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 1e-04
1c07_A95 Protein (epidermal growth factor receptor pathway 8e-07
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 9e-07
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 1e-06
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 2e-06
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 2e-05
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 2e-05
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 2e-06
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 2e-06
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 2e-06
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 1e-05
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 2e-06
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 5e-06
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 8e-06
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 3e-06
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 7e-06
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 2e-05
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 3e-06
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 3e-06
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 4e-06
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 9e-06
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 4e-06
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 3e-05
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 5e-06
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 3e-05
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 6e-06
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 6e-06
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 9e-06
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 8e-06
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 5e-04
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 8e-06
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 9e-05
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-05
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-04
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 1e-05
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 2e-04
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 2e-05
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 6e-05
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 2e-05
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 2e-05
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 4e-05
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 6e-05
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 6e-05
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 7e-05
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 7e-05
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 3e-04
1qjt_A99 EH1, epidermal growth factor receptor substrate su 8e-05
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 8e-05
1avs_A90 Troponin C; muscle contraction, calcium-activated, 2e-04
1avs_A90 Troponin C; muscle contraction, calcium-activated, 6e-04
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 5e-04
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 7e-04
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 9e-04
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
 Score = 84.5 bits (209), Expect = 4e-18
 Identities = 40/256 (15%), Positives = 79/256 (30%), Gaps = 48/256 (18%)

Query: 227 FDMNNDGLISFKEYIFFVTLLSIPE-SSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHN 285
            + +  G    +       +LS  + +     F    +  +G+ S ++ KQV+A      
Sbjct: 99  LEDDASGYNRLRP---SKPMLSEEDTNILRQLFLSSAVSGSGKFSFQDLKQVLAKYADTI 155

Query: 286 RQG-------AFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEE 338
            +G           D               G + Y               V         
Sbjct: 156 PEGPLKKLFVMVENDT-------------KGRMSY------------ITLVAVA--NDLA 188

Query: 339 MLRLEFAHYDYKQRGTISAEDF--ALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITF 396
            L  +F   D    GT+S ++F      +        + L    D+ +         + F
Sbjct: 189 ALVADFRKIDTNSNGTLSRKEFREHFVRLGFDKKSVQDALFRYADEDE------SDDVGF 242

Query: 397 EEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFD 456
            E+ +       L+    A   + K +G L++++ Q+               +  F V D
Sbjct: 243 SEYVHLGLCLLVLR-ILYAFADFDK-SGQLSKEEVQKVLEDAHIPESARKKFEHQFSVVD 300

Query: 457 SNRDGNLSLEEFVRVL 472
            +   +LS +EFV ++
Sbjct: 301 VDDSKSLSYQEFVMLV 316
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query508
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.94
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.93
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.89
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.87
1y1x_A191 Leishmania major homolog of programmed cell death 99.82
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.81
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.8
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.8
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.79
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.79
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.79
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.78
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.77
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.77
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.76
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.76
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.76
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.75
1y1x_A191 Leishmania major homolog of programmed cell death 99.75
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.75
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.74
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.74
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.74
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.74
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.74
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.74
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.74
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.73
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.73
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.73
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.73
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.72
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.72
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.71
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.71
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.7
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.7
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.7
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.7
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.7
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.7
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.7
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.7
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.7
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.69
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.69
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.69
3fwb_A161 Cell division control protein 31; gene gating, com 99.69
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.69
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.69
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.69
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.68
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.68
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.68
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.68
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.68
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.68
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.68
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.67
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.67
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.67
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.67
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.67
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.66
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.66
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.66
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.66
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.65
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.65
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.65
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.65
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.65
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.65
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.65
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.65
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.64
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.64
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.64
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.64
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.63
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.63
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.62
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.62
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.62
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.62
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.62
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.62
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.62
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.62
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.62
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.61
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.61
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.61
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.61
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.61
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.6
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.6
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.6
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.6
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.6
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.6
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.6
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.59
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.59
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.59
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.59
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.59
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.59
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.59
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.59
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.59
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.58
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.58
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.58
3fwb_A161 Cell division control protein 31; gene gating, com 99.58
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.58
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.57
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.57
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.57
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.57
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.57
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.57
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.57
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.57
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.56
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.56
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.56
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.56
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.56
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.56
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.56
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.56
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.55
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.55
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.55
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.54
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.54
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.54
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.54
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.54
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.54
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.53
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.53
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.53
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.53
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.53
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.53
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.53
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.51
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.51
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.51
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.51
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.5
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.5
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.5
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.5
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.49
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.49
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.48
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.48
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.48
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.48
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.47
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.47
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.47
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.46
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.46
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.46
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.45
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.45
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.45
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.45
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.44
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.44
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.44
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.44
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.44
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.44
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.43
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.43
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 99.43
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.43
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.43
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.42
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.42
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.41
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.41
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.41
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.41
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.41
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.4
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.4
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.4
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.4
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.4
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.4
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.39
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.39
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.39
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.39
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.38
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.38
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.38
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.38
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.37
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.37
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.37
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.37
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.36
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.36
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.36
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.35
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.35
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.35
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.35
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.34
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.34
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.34
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.33
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.33
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.33
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.33
3bhy_A283 Death-associated protein kinase 3; death associate 99.33
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.33
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.32
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.32
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.32
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.31
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.31
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.31
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.31
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.31
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.3
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.3
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.29
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.29
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.29
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.28
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.28
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.28
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.28
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.28
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.27
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.27
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.27
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.27
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.27
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.27
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.26
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.26
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.26
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.26
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.26
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.26
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.25
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.25
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.25
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.25
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.25
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.25
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.24
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.24
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.24
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.23
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.23
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.23
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.22
3niz_A311 Rhodanese family protein; structural genomics, str 99.21
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.21
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.21
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.21
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.21
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.21
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.2
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.2
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.2
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.2
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.2
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.19
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.19
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.18
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.18
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.18
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.18
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.18
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.18
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.18
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.17
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.17
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.16
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.16
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.16
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.16
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.16
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.16
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.16
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.16
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.16
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.15
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.15
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.15
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.15
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.14
3ork_A311 Serine/threonine protein kinase; structural genomi 99.14
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.14
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.14
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.14
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.13
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.12
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.12
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.12
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.11
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.11
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.11
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.11
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.1
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.1
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.1
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.09
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.09
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.09
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.09
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.08
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.08
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.08
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.08
4aoj_A329 High affinity nerve growth factor receptor; transf 99.08
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.07
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.07
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.07
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.06
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.06
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.05
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.05
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.05
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.04
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.03
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.03
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.02
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.01
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.01
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.0
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.99
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 98.99
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 98.99
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.97
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.97
3dls_A335 PAS domain-containing serine/threonine-protein KI; 98.97
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.97
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 98.96
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 98.96
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.95
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.95
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 98.94
4ase_A353 Vascular endothelial growth factor receptor 2; tra 98.94
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 98.94
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.94
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.93
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.92
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.92
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 98.92
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.92
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.91
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.91
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.9
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.9
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 98.9
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 98.9
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.9
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.9
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.89
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 98.89
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.88
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 98.88
3li6_A66 Calcium-binding protein; calcium signaling protein 98.88
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 98.88
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.87
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.87
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.86
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 98.86
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 98.85
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.84
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.84
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.84
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.84
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.83
3uqc_A286 Probable conserved transmembrane protein; structur 98.82
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 98.82
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 98.82
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 98.82
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.81
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.81
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.81
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 98.81
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.8
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.79
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.78
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.78
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 98.78
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 98.78
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 98.78
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 98.78
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 98.77
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.77
1c07_A95 Protein (epidermal growth factor receptor pathway 98.77
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.77
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.77
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.77
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.77
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 98.77
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 98.77
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.76
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 98.76
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 98.76
3lzb_A327 Epidermal growth factor receptor; epidermal growth 98.75
3poz_A327 Epidermal growth factor receptor; kinase domain, a 98.75
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 98.75
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 98.74
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 98.74
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.74
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 98.74
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.73
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 98.73
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.73
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.72
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 98.72
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.72
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.72
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 98.71
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 98.71
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 98.71
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 98.7
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 98.7
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 98.7
3pls_A298 Macrophage-stimulating protein receptor; protein k 98.7
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.69
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.69
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.68
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 98.68
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 98.67
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 98.67
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.67
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 98.66
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 98.66
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.66
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 98.65
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.65
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.65
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.65
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 98.64
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 98.64
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 98.64
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 98.64
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.64
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 98.64
1c07_A95 Protein (epidermal growth factor receptor pathway 98.64
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 98.64
2xir_A316 Vascular endothelial growth factor receptor 2; ang 98.64
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.64
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 98.64
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.63
3li6_A66 Calcium-binding protein; calcium signaling protein 98.63
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.63
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.63
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 98.63
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.63
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.63
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.62
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.62
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.62
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.61
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 98.61
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.6
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 98.6
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.6
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 98.6
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.6
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.6
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 98.59
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.59
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 98.59
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.59
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 98.58
3soc_A322 Activin receptor type-2A; structural genomics cons 98.58
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 98.58
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.57
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 98.57
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.57
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 98.57
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.56
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 98.56
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.55
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.55
2a19_B284 Interferon-induced, double-stranded RNA-activated 98.55
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.55
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
Probab=100.00  E-value=2.2e-35  Score=312.03  Aligned_cols=294  Identities=21%  Similarity=0.257  Sum_probs=199.3

Q ss_pred             HHHHhhccCCCCCCCCCCCccccccccCCCCCCCccccch--------------------------------hhHHHHHH
Q 010530           18 IQRLHSRQLSAPPESPSASLPVLSKASNANTDHLKDCIFD--------------------------------SLARWFSG   65 (508)
Q Consensus        18 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------------------~~~~Ws~G   65 (508)
                      +++||+.++.|++.+|.    +|+........+++.|+|+                                ..|+||+|
T Consensus       159 l~~lH~~~ivH~Dlkp~----Nil~~~~~~~~~~kl~Dfg~a~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~DiwslG  234 (504)
T 3q5i_A          159 ICYLHKHNIVHRDIKPE----NILLENKNSLLNIKIVDFGLSSFFSKDYKLRDRLGTAYYIAPEVLKKKYNEKCDVWSCG  234 (504)
T ss_dssp             HHHHHHTTEECSCCSGG----GEEESSTTCCSSEEECCCTTCEECCTTSCBCCCCSCTTTCCHHHHTTCBCTHHHHHHHH
T ss_pred             HHHHHHCCeEeCCCcHH----HEEEecCCCCccEEEEECCCCEEcCCCCccccccCCcCCCCHHHhccCCCchHHHHHHH
Confidence            58999999999999976    7775544433456666664                                46999999


Q ss_pred             HHH-HHhhCCccccCCCCccccccccCCccccccccccccc-ccCCCCCCCCccccccchHHHhhhcCCCCCCccchhhh
Q 010530           66 IVV-GSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMST-LTNDTTDDDDDDRQSSSSSLFRKLSLPDYSSNFLFGEA  143 (508)
Q Consensus        66 vi~-~~l~g~~pf~~~~~~~~~~~I~~g~~~f~~~~w~~~S-~akd~~~~~~~~~~~~~~~li~klL~~d~~~R~s~~~a  143 (508)
                      ||+ .+++|.+||.+.+..+++.+|..|.+.|+.+.|.++| ++++               ||++||++||.+|||+.|+
T Consensus       235 ~il~~ll~g~~pf~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~~~~---------------li~~~L~~dp~~R~t~~e~  299 (504)
T 3q5i_A          235 VIMYILLCGYPPFGGQNDQDIIKKVEKGKYYFDFNDWKNISDEAKE---------------LIKLMLTYDYNKRCTAEEA  299 (504)
T ss_dssp             HHHHHHHHSSCSSCCSSHHHHHHHHHHCCCCCCHHHHTTSCHHHHH---------------HHHHHTCSSTTTSCCHHHH
T ss_pred             HHHHHHHhCCCCCCCCCHHHHHHHHHcCCCCCCccccCCCCHHHHH---------------HHHHHcCCChhHCCCHHHH
Confidence            999 9999999999999999999999999999999999999 9999               9999999999999999999


Q ss_pred             hhhhHHHHHHHhhhcC--CChHHHHHHHhcccCCCCccccCHHHHHHhhcCCCCCCCccccccccccCccCCCccCCCHH
Q 010530          144 YRRKIFFNYEKRIRLR--SPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPS  221 (508)
Q Consensus       144 l~h~w~~~~~~~~~~~--~~~~~~f~~f~~~~~~~g~~~m~~~e~~~~l~~~~~~~e~~~~~~~~l~~~~~~~e~~~~~~  221 (508)
                      |+||||..+.......  ......+..+..+   .+...+....+.......++                 ++++ ....
T Consensus       300 l~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~kl~~a~l~~i~~~~~~-----------------~~~~-~~l~  358 (504)
T 3q5i_A          300 LNSRWIKKYANNINKSDQKTLCGALSNMRKF---EGSQKLAQAAILFIGSKLTT-----------------LEER-KELT  358 (504)
T ss_dssp             HTSHHHHHTCCCCCGGGHHHHHHHHHHHHHC---CCCSHHHHHHHHHHHHHTSC-----------------HHHH-HHHH
T ss_pred             hcCHhhhhchhcccccchhhHHHHHHHHHHH---HHHHHHHHHHHHHhhccCCc-----------------HHHH-HHHH
Confidence            9999999765432110  0112233333322   22221122222222211111                 1111 1344


Q ss_pred             HHHhHHcCCCCcceeHHHHHHHHHHc----------CCCHHHHHHHhhhcCCCCCCcccHHHHHHHHHHHHhccccCccc
Q 010530          222 EFFMLFDMNNDGLISFKEYIFFVTLL----------SIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFH  291 (508)
Q Consensus       222 ~lf~~~D~d~dG~Is~~EF~~~l~~l----------~~~~~~l~~~F~~~D~d~dG~Is~~Ef~~~l~~~~~~~~~~~~~  291 (508)
                      ++|+.+|.|++|.|+++||..++..+          ....++++.+|+.+|.|++|.|+++||..++.....        
T Consensus       359 ~~F~~~D~d~dG~I~~~El~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~D~d~dG~I~~~EF~~~~~~~~~--------  430 (504)
T 3q5i_A          359 DIFKKLDKNGDGQLDKKELIEGYNVLRNFKNELGELKNVEEEVDNILKEVDFDKNGYIEYSEFISVCMDKQI--------  430 (504)
T ss_dssp             HHHHHHCTTCSSEECHHHHHHHHHHHHHHC--CCSCCCHHHHHHHHHHHHCTTCSSSEEHHHHHHHHSCHHH--------
T ss_pred             HHHHeeCCCCCCeEcHHHHHHHHHHhhhcccccccccccHHHHHHHHHHhCCCCCCcEeHHHHHHHHHhhhc--------
Confidence            66777777777777777766655543          133455666666666666666666666555432100        


Q ss_pred             ccccccccCCCCCCCchhHHHHHhccCCCccccHHHHHHHHHHHhHHHHHHHHhcccCCCCccccHHHHHHHHHHhcCcc
Q 010530          292 RDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMG  371 (508)
Q Consensus       292 ~~~~~~~~~~~~~~~~~~~~~~~~D~d~dG~I~~~EF~~~~~~l~~e~l~~~F~~~D~d~~G~Is~~Ef~~~l~~~~~~~  371 (508)
                                                                ....+.++.+|+.+|.|++|.|+.+||..++       
T Consensus       431 ------------------------------------------~~~~~~~~~~F~~~D~d~dG~Is~~El~~~l-------  461 (504)
T 3q5i_A          431 ------------------------------------------LFSEERLRRAFNLFDTDKSGKITKEELANLF-------  461 (504)
T ss_dssp             ------------------------------------------HTCHHHHHHHHHHHCTTCCSEECHHHHHHHT-------
T ss_pred             ------------------------------------------ccCHHHHHHHHHHhcCCCCCcCcHHHHHHHH-------
Confidence                                                      0112345666666666666666666664333       


Q ss_pred             HHHHHHHHHHhhhcccccCCcccCHHHHHHHHHHHhhhhhHHHHhhhcccCCCccCHHHHHHHHHHHhCCCCCHHHHHHH
Q 010530          372 HLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDII  451 (508)
Q Consensus       372 ~~~~~l~~~~~~~~~~~~~~~~Is~~eF~~~~~l~~~~~~~~~a~~~~~d~~G~Is~~Ef~~~l~~~~g~~ls~~ei~~l  451 (508)
                                                                                      ..   ..+++++++.+
T Consensus       462 ----------------------------------------------------------------~~---~~~~~~~~~~~  474 (504)
T 3q5i_A          462 ----------------------------------------------------------------GL---TSISEKTWNDV  474 (504)
T ss_dssp             ----------------------------------------------------------------TC---SCCCHHHHHHH
T ss_pred             ----------------------------------------------------------------hh---CCCCHHHHHHH
Confidence                                                                            21   24678889999


Q ss_pred             HHHHcCCCCCCccHHHHHHHHhhh
Q 010530          452 FQVFDSNRDGNLSLEEFVRVLHNR  475 (508)
Q Consensus       452 f~~~D~d~dG~Is~~EF~~~~~~~  475 (508)
                      |+.+|.|+||.|+|+||+.+|...
T Consensus       475 ~~~~D~d~dG~I~~~EF~~~~~~~  498 (504)
T 3q5i_A          475 LGEADQNKDNMIDFDEFVSMMHKI  498 (504)
T ss_dssp             HHTTCSSCSSSEEHHHHHHHHHHH
T ss_pred             HHHhCCCCCCcEeHHHHHHHHHHh
Confidence            999999999999999999999764
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 508
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 4e-10
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-06
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 3e-09
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-04
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 0.003
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 5e-09
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 0.004
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 7e-09
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 8e-06
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 6e-04
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-08
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-04
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 1e-08
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 1e-08
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-04
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 0.001
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-08
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-04
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-08
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-05
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 4e-08
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 8e-07
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 3e-06
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-08
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-07
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-06
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-07
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 9e-06
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 4e-05
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 4e-05
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 1e-07
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 3e-04
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-07
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.001
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-07
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-06
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 4e-07
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 1e-04
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.004
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 5e-07
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 0.003
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 5e-07
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 1e-06
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 2e-06
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 7e-07
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-06
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-06
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 8e-07
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 2e-04
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 8e-07
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 3e-06
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 5e-06
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 1e-06
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 9e-05
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 3e-04
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 1e-06
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 0.002
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 2e-06
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 0.002
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-06
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-06
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 8e-05
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 3e-06
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 0.002
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 3e-06
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 1e-04
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 0.003
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-06
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-06
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-05
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 5e-06
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-04
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 5e-04
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 1e-05
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 2e-05
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-05
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 9e-05
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 3e-04
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 2e-05
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 4e-04
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 2e-05
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 6e-05
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 2e-05
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-05
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 2e-04
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-05
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-04
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 0.001
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 2e-05
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.003
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 3e-05
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 4e-05
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 5e-05
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 0.001
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 5e-05
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 3e-04
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 0.001
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 5e-05
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 5e-05
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 4e-04
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 0.002
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 5e-05
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 6e-05
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 9e-05
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 8e-05
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 8e-05
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 6e-04
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 8e-05
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 8e-05
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.002
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.002
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 1e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 4e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 7e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 0.001
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 1e-04
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 0.001
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 1e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 2e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 2e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 7e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 0.004
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 0.004
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 3e-04
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 0.001
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 3e-04
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 7e-04
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 0.001
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 4e-04
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 4e-04
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 8e-04
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 0.001
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 0.001
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 0.001
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 0.001
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.001
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.002
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 0.002
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 0.003
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 0.004
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
domain: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
species: Physarum polycephalum [TaxId: 5791]

 Score = 58.9 bits (141), Expect = 4e-10
 Identities = 40/314 (12%), Positives = 82/314 (26%), Gaps = 29/314 (9%)

Query: 162 PEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRP--GELRCA 219
               F +       E ++  +  +    +       ++          ER    G+    
Sbjct: 29  DHTSFAHKEDRDRLEAQIAQKEQEQKAKLAEYDQKVQNEFDARERAEREREAARGDAAAE 88

Query: 220 PSEFFMLFDMNNDGLISFKEYIFFVTLLSIPE-SSFSVAFKMFDIDNNGEISKEEFKQVM 278
                 L     D    +        +LS  + +     F    +  +G+ S ++ KQV+
Sbjct: 89  KQRLASLLKDLEDDASGYNRLRPSKPMLSEEDTNILRQLFLSSAVSGSGKFSFQDLKQVL 148

Query: 279 ALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEE 338
           A       +G   +                 L                K       L   
Sbjct: 149 AKYADTIPEGPLKK-----------------LFVMVE--------NDTKGRMSYITLVAV 183

Query: 339 MLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEE 398
              L     D+++  T S    +        +       +  D L       +       
Sbjct: 184 ANDLAALVADFRKIDTNSNGTLSRKEFREHFVRLGFDKKSVQDALFRYADEDESDDVGFS 243

Query: 399 FKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSN 458
                 L   +     A   + K +G L++++ Q+               +  F V D +
Sbjct: 244 EYVHLGLCLLVLRILYAFADFDK-SGQLSKEEVQKVLEDAHIPESARKKFEHQFSVVDVD 302

Query: 459 RDGNLSLEEFVRVL 472
              +LS +EFV ++
Sbjct: 303 DSKSLSYQEFVMLV 316
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query508
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.82
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.81
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.8
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.79
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.77
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.75
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.73
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.72
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.71
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.69
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.69
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.68
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.67
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.67
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.67
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.66
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.66
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.66
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.65
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.65
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.65
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.65
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.64
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.64
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.63
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.62
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.62
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.61
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.61
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.6
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.6
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.6
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.59
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.59
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.58
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.58
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.58
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.57
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.57
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.56
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.56
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.55
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.55
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.55
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.55
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.55
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.54
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.54
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.53
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.53
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.53
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.52
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.51
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.51
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.5
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.5
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.5
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.5
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.5
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.5
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.48
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.48
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.47
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.47
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.47
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.47
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.47
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.47
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.46
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.46
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.45
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.44
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.44
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.44
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.44
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.44
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.43
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.43
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.43
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.43
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.42
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.41
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.41
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.41
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.4
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.4
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.4
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.39
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.39
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.36
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.35
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.35
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.35
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.34
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.33
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.33
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.31
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.28
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.28
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.27
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.27
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.25
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.25
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.24
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.23
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.23
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.23
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.22
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.22
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.2
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.2
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.2
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.19
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.19
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.19
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.19
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.18
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.16
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.16
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.14
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.14
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.13
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.12
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.12
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.11
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.11
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.09
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.09
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.08
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.06
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.05
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.02
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.02
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.02
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.02
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.0
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.99
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 98.97
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 98.96
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 98.96
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.95
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 98.94
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.94
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.94
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.93
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 98.93
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.92
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 98.91
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 98.91
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 98.9
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 98.9
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.9
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.89
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.87
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.86
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 98.85
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.82
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.81
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.8
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.8
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.79
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 98.79
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.79
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.78
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.76
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.74
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.73
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.72
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.7
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 98.7
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.69
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.62
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.6
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.6
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.59
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.59
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.59
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.56
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.54
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.52
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.5
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 98.48
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.47
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.44
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.43
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.35
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.32
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.31
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.3
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.26
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 98.15
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.14
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.14
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.09
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.04
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.97
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.93
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.81
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.53
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.48
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.35
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.12
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 96.94
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.79
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 96.57
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.97
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 93.71
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 92.97
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 88.76
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 87.86
d1df0a2159 Calpain large subunit, middle domain (domain III) 83.39
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 83.36
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 80.4
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
domain: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
species: Physarum polycephalum [TaxId: 5791]

Probab=99.82  E-value=2e-20  Score=182.93  Aligned_cols=192  Identities=19%  Similarity=0.232  Sum_probs=157.1

Q ss_pred             HHHHHHhhhcCCCCCCcccHHHHHHHHHHHHhccccCcccccccccccCCCCCCCchhHHHHHhccCCCccccHHHHHHH
Q 010530          252 SSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQF  331 (508)
Q Consensus       252 ~~l~~~F~~~D~d~dG~Is~~Ef~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~d~dG~I~~~EF~~~  331 (508)
                      ..++.+|..+|.|++|.|+.+||+.+|..++..                +  +...+..++..+|.+++|.|+|.||...
T Consensus       122 ~~~~~~F~~~D~~~~g~i~~~e~~~~l~~~~~~----------------~--~~~~~~~~~~~~d~~~~g~i~~~ef~~~  183 (321)
T d1ij5a_         122 NILRQLFLSSAVSGSGKFSFQDLKQVLAKYADT----------------I--PEGPLKKLFVMVENDTKGRMSYITLVAV  183 (321)
T ss_dssp             HHHHHHHTSSSSTTSSCCCHHHHHHHHHHHHTT----------------S--CSSHHHHHHHHHHHCCSSTHHHHHHTTS
T ss_pred             HHHHHHHHHHcCCCCCeEcHHHHHHHHHHcCCc----------------c--cHHHHHHHHHHHhhcCCccccchhhhhh
Confidence            357899999999999999999999999877532                1  3467888999999999999999999998


Q ss_pred             HHHHhHHHHHHHHhcccCCCCccccHHHHHHHHHHhcCcc--HHHHHHHHHHhhhcccccCCcccCHHHHHHHHHHHhhh
Q 010530          332 MRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMG--HLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKL  409 (508)
Q Consensus       332 ~~~l~~e~l~~~F~~~D~d~~G~Is~~Ef~~~l~~~~~~~--~~~~~l~~~~~~~~~~~~~~~~Is~~eF~~~~~l~~~~  409 (508)
                      +....  .+...|+.+|.+++|.++..++...+...+...  ....++..++..      .++.+.+.+|.......   
T Consensus       184 ~~~~~--~~~~~F~~~d~d~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~i~~~ef~~~~~~~---  252 (321)
T d1ij5a_         184 ANDLA--ALVADFRKIDTNSNGTLSRKEFREHFVRLGFDKKSVQDALFRYADED------ESDDVGFSEYVHLGLCL---  252 (321)
T ss_dssp             HHHHH--TSCCCHHHHCTTCCSEECHHHHHHHHHHTTCCCHHHHHHHHHHHCTT------CSSCEEHHHHHHHHHHH---
T ss_pred             hhhhh--hhhHHHHHHhhcccccchhHHHhhhhhcccccchHHHHHHHHhhhcc------cccccccccccchhhhh---
Confidence            87654  466789999999999999999999988776332  223334434333      67889999998765433   


Q ss_pred             hhHHHHhhhcc-cCCCccCHHHHHHHHHHHhCCC-CCHHHHHHHHHHHcCCCCCCccHHHHHHHHh
Q 010530          410 QPFCLALFSYG-KVNGLLTRDDFQRAAYRVCGIL-LTDNVIDIIFQVFDSNRDGNLSLEEFVRVLH  473 (508)
Q Consensus       410 ~~~~~a~~~~~-d~~G~Is~~Ef~~~l~~~~g~~-ls~~ei~~lf~~~D~d~dG~Is~~EF~~~~~  473 (508)
                      ..+..+|..++ +++|+|+.+||+.++.. .|.+ ++++++..+|+.+|.|+||.|+|+||+.+|.
T Consensus       253 ~~~~~~F~~~D~d~~G~Is~~E~~~~l~~-~~~~~~~~~~~~~l~~~~D~d~dG~Is~~EF~~~ml  317 (321)
T d1ij5a_         253 LVLRILYAFADFDKSGQLSKEEVQKVLED-AHIPESARKKFEHQFSVVDVDDSKSLSYQEFVMLVL  317 (321)
T ss_dssp             HHHHHHHHHTCSSSCSSEEHHHHHHHHHH-TTCCGGGCSTHHHHHHHHTTTTCSEECHHHHHHHHH
T ss_pred             hHHHHHHHHHhcCCCCCCcHHHHHHHHHH-cCCCcCcHHHHHHHHHHhCCCCCCcCcHHHHHHHHH
Confidence            33445677777 99999999999999999 5764 8999999999999999999999999999984
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure