Citrus Sinensis ID: 010538

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
MDYADKEEFLKEFGEDYGYPNAPKSIDQIRATEFKRLENGTVYLDHAGATLYSELQMEAIFRDFTTNVYGNPHSQSDISLATCDIVRAAREQVLDYFNASMKDYKCIFTSGATAALKLVGEAFPWSHQSSYMYTMENHNSVLGIREYALSQGAAAFAIDVEEAVDNDGLSESLVTSTKISLLPIQRRKGASFPERDPAGDAYNLFAFPSECNFSGSRFNLDLINIMKKNPERILEISPFSKGRWMVLIDAAKGCVTQPPDLSKYPVDFVVMSFYKIFGYPTGLGALIMRNDAAKLLKNTYFSGGTVAASIADIDFVKRRQGVEELFEDGTASFLSIASIRHGFNLINSLTVPAICRHIASLGMYVRKVLLSLRHENGADVCTIYGTYTSEVSYHDTGSMVSFNLKRPDGSWFGYREVEKLASLSGIQLRTGCFCNPGACAKYLGLSHSDLLSNIEAGHVCWDDNDIIHGKPTGAIRVSFGYMSTFEDAKVNRCSSFDFVNFSQFLNSK
cccHHHHHHHHHHHcccccccccccHHHHHHHcccccccccEEECccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHcccEEEEEccccccccccccccccccccccccHHHccccccccccccccccccEEEEEcccccccccccHHHHHHHHcccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccCEEEEEEEHHHHHHccccccccccEEEEECcccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccEEEEEEcccccccccHHHHHHHHHHcccEEccccccccHHHHHHHcccHHHHHHHHcccccccccccccccccccEEEEEEcccccHHHHHHHcccHHHHHHHHHccccc
******E*FLKEFGEDYGYPNAPKSIDQIRATEFKRLENGTVYLDHAGATLYSELQMEAIFRDFTTNVYGNPHSQSDISLATCDIVRAAREQVLDYFNASMKDYKCIFTSGATAALKLVGEAFPWSHQSSYMYTMENHNSVLGIREYALSQGAAAFAIDVEEAVDNDGLSESLVTSTKISLLPIQR**********PAGDAYNLFAFPSECNFSGSRFNLDLINIMKKNPERILEISPFSKGRWMVLIDAAKGCVTQPPDLSKYPVDFVVMSFYKIFGYPTGLGALIMRNDAAKLLKNTYFSGGTVAASIADIDFVKRRQGVEELFEDGTASFLSIASIRHGFNLINSLTVPAICRHIASLGMYVRKVLLSLRHENGADVCTIYGTYTSEVSYHDTGSMVSFNLKRPDGSWFGYREVEKLASLSGIQLRTGCFCNPGACAKYLGLSHSDLLSNIEAGHVCWDDNDIIHGKPTGAIRVSFGYMSTFEDAKVNRCSSFDFVNFSQFLN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYADKEEFLKEFGEDYGYPNAPKSIDQIRATEFKRLENGTVYLDHAGATLYSELQMEAIFRDFTTNVYGNPHSQSDISLATCDIVRAAREQVLDYFNASMKDYKCIFTSGATAALKLVGEAFPWSHQSSYMYTMENHNSVLGIREYALSQGAAAFAIDVEEAVDNDGLSESLVTSTKISLLPIQRRKGASFPERDPAGDAYNLFAFPSECNFSGSRFNLDLINIMKKNPERILEISPFSKGRWMVLIDAAKGCVTQPPDLSKYPVDFVVMSFYKIFGYPTGLGALIMRNDAAKLLKNTYFSGGTVAASIADIDFVKRRQGVEELFEDGTASFLSIASIRHGFNLINSLTVPAICRHIASLGMYVRKVLLSLRHENGADVCTIYGTYTSEVSYHDTGSMVSFNLKRPDGSWFGYREVEKLASLSGIQLRTGCFCNPGACAKYLGLSHSDLLSNIEAGHVCWDDNDIIHGKPTGAIRVSFGYMSTFEDAKVNRCSSFDFVNFSQFLNSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Molybdenum cofactor sulfurase Sulfurates the molybdenum cofactor. Sulfation of molybdenum is essential for xanthine dehydrogenase (XDH) and aldehyde oxidase (ADO) enzymes in which molybdenum cofactor is liganded by 1 oxygen and 1 sulfur atom in active form. Modulates cold stress- and osmotic stress-responsive gene expression by acting as key regulator of abscisic acid (ABA) biosynthesis.probableQ9C5X8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T3I, chain A
Confidence level:very confident
Coverage over the Query: 25-166,182-229,242-439,452-455,471-503
View the alignment between query and template
View the model in PyMOL
Template: 3E9K, chain A
Confidence level:confident
Coverage over the Query: 25-166,182-229,242-431,471-501
View the alignment between query and template
View the model in PyMOL
Template: 2C81, chain A
Confidence level:confident
Coverage over the Query: 50-166,182-229,242-501
View the alignment between query and template
View the model in PyMOL
Template: 3LVJ, chain A
Confidence level:probable
Coverage over the Query: 42-142,159-175,193-304
View the alignment between query and template
View the model in PyMOL