Citrus Sinensis ID: 010551


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------
MDSGSWHLELPYDLWVTLPVSGARPSPRYKHAAAVFDQKLYIVGGSRNGRFLSDVQVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVTRGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPAAAAAAASVTAAYALAKSEKLDIPKTLSSKFAGIGNDLSEKDVRTDIDAIKEDKRVLELSLTEVRTENSRFREKIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESSQTIENEVQILRQQKSAFEQEMERATSVQTQGSGGVWRWIAGGQ
ccccEEEECcccccEEECcccccccccccccEEEEEccEEEEEcccccccccccEEEEEcccccEEcEEEcccccccccccccccccccccccCEEEEEccEEEEEEcccccccccEEEEEEEcccccEEECcccccccccccccEEEEEccEEEEEccccccccccccEEEECccccEEEEECccccccccccccEEEEEccEEEEEEcccccccccccEEEECcccccEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEEcccccEEEEcccccccccccccccEEEEEEEcccEEEEEccccccccccEEEECccccccccccccccccccccccccccccccccccCECcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccc
MDSGSWHLELPYDLWVTLPVSGARPSPRYKHAAAVFDQKLYIVGGSRNGRFLSDVQVFDLRSLAWSNLRLETELDADKT**SGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVTRGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQ************AAYALAKSE*LDI*******FAG********************************************************************RCFKLEAQI*******************************************G**RWIAGG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSGSWHLELPYDLWVTLPVSGARPSPRYKHAAAVFDQKLYIVGGSRNGRFLSDVQVFDLRSLAWSNLRLETELDADKTEDSGLLEVLPPMSDHCMVKWGTKLLILGGHYKKSSDSMIVRFIDLETNLCGVMETSGKVPVTRGGHSVTLVGSRLIIFGGEDRSRKLLNDVHFLDLETMTWDAVEVTQTPPAPRYDHSAALHANRYLIVFGGCSHSIFFNDLHVLDLQTNEWSQPEIKGDLVTGRAGHAGITIDENWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPAAAAAAASVTAAYALAKSEKLDIPKTLSSKFAGIGNDLSEKDVRTDIDAIKEDKRVLELSLTEVRTExxxxxxxxxxxxxxxxxxxxxLSSVQGQLVAERSRCFKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQTQGSGGVWRWIAGGQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VPJ, chain A
Confidence level:very confident
Coverage over the Query: 36-71,88-345
View the alignment between query and template
View the model in PyMOL
Template: 2WOZ, chain A
Confidence level:very confident
Coverage over the Query: 4-71,88-315
View the alignment between query and template
View the model in PyMOL
Template: 1K3I, chain A
Confidence level:very confident
Coverage over the Query: 4-72,89-362
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:very confident
Coverage over the Query: 412-444
View the alignment between query and template
View the model in PyMOL
Template: 1QHU, chain A
Confidence level:probable
Coverage over the Query: 4-228
View the alignment between query and template
View the model in PyMOL
Template: 2FXO, chain A
Confidence level:probable
Coverage over the Query: 397-486
View the alignment between query and template
View the model in PyMOL